CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP022419	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-4, complete sequence	0 crisprs	NA	0	0
NZ_CP022420	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-5, complete sequence	0 crisprs	NA	0	1
NZ_CP022417	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence	0 crisprs	csa3	0	20
NZ_CP022416	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-1, complete sequence	0 crisprs	csa3	0	2
NZ_CP022418	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-3, complete sequence	0 crisprs	PrimPol	0	22
NZ_CP022415	Sulfitobacter pseudonitzschiae strain SMR1 chromosome, complete genome	1 crisprs	csa3,WYL,cas3,DEDDh	2	3
NZ_CP022421	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-6, complete sequence	0 crisprs	DEDDh	0	0
NZ_CP022422	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-7, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1911

Staphylococcus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423007.1\|153_1911_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	9.7e-33	30.9

DBSCAN-SWA_2

7077 : 9983

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423237.1\|7077_8058_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.3e-17	31.0
WP_089423238.1\|8084_9083_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.7e-16	28.5
WP_089423012.1\|9092_9983_-	alpha/beta fold hydrolase	A0A2K9L3Q7	Tupanvirus	6.7e-06	24.9

DBSCAN-SWA_3

13052 : 13889

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423015.1\|13052_13889_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.9e-11	29.1

DBSCAN-SWA_4

23001 : 23751

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423021.1\|23001_23751_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	4.6e-08	27.5

DBSCAN-SWA_5

29539 : 35186

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423028.1\|29539_32647_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.2e-22	20.5
WP_089423029.1\|33374_34214_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157729100.1\|34412_35186_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.6e-30	35.1

DBSCAN-SWA_6

39619 : 42412

Tupanvirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423036.1\|39619_41131_-\|holin	choline-sulfatase	A0A2K9L1A5	Tupanvirus	1.1e-19	23.1
WP_089423037.1\|41284_42412_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.5e-34	27.9

DBSCAN-SWA_7

48213 : 48957

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423043.1\|48213_48957_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	8.9e-12	29.1

DBSCAN-SWA_8

59201 : 63506

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423054.1\|59201_60086_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	1.6e-12	41.6
WP_089423055.1\|60165_60879_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	2.0e-08	24.9
WP_089423056.1\|60938_61796_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_089423057.1\|61740_62886_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_089423243.1\|62759_63506_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.6e-14	30.9

DBSCAN-SWA_9

91126 : 145870

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423246.1\|91126_91708_+	recombinase family protein	A0A219Y912	Aeromonas_phage	1.9e-25	39.9
WP_089423078.1\|91730_93116_+\|transposase	ISKra4 family transposase	NA	NA	NA	NA
WP_089423079.1\|93623_94307_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_089423080.1\|94614_95367_-	hypothetical protein	NA	NA	NA	NA
WP_089423081.1\|95617_96556_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_157729085.1\|96614_98201_-	hypothetical protein	NA	NA	NA	NA
WP_089423084.1\|98387_98594_+	hypothetical protein	NA	NA	NA	NA
WP_089423085.1\|98997_99642_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_089423086.1\|99856_101464_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_089423087.1\|101463_102414_+	ABC transporter permease	NA	NA	NA	NA
WP_089423088.1\|102410_103319_+	ABC transporter permease	NA	NA	NA	NA
WP_089423089.1\|103315_104266_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-16	29.8
WP_089423090.1\|104262_105285_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-17	34.2
WP_089423091.1\|105310_106900_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_089423092.1\|107110_107254_+	hypothetical protein	NA	NA	NA	NA
WP_114284442.1\|107424_107967_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_089422115.1\|108047_109073_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089423094.1\|109914_110946_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157729086.1\|111693_113706_+	VWA domain-containing protein	NA	NA	NA	NA
WP_089423096.1\|113740_114223_+	hypothetical protein	NA	NA	NA	NA
WP_089423097.1\|114239_115037_+	hypothetical protein	NA	NA	NA	NA
WP_089423098.1\|115055_116903_+	hypothetical protein	NA	NA	NA	NA
WP_157729087.1\|117057_117648_+	hypothetical protein	NA	NA	NA	NA
WP_089423100.1\|117701_119549_+	hypothetical protein	NA	NA	NA	NA
WP_089423101.1\|119607_120180_+	hypothetical protein	NA	NA	NA	NA
WP_157729088.1\|120211_121579_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.4e-10	23.5
WP_089423247.1\|121575_122064_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_089423103.1\|122292_123279_-	hypothetical protein	NA	NA	NA	NA
WP_089423104.1\|123423_123906_+	hypothetical protein	NA	NA	NA	NA
WP_089423105.1\|123994_125083_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.2e-11	33.1
WP_089423106.1\|125079_125664_+	hypothetical protein	NA	NA	NA	NA
WP_089423107.1\|126092_126455_+	hypothetical protein	NA	NA	NA	NA
WP_089423248.1\|126897_127452_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_089423108.1\|127465_127756_+	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_089423109.1\|127761_128091_+	type IV secretion system protein VirB3	NA	NA	NA	NA
WP_089423110.1\|128090_130451_+	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_089423111.1\|130447_131149_+	type IV secretion system family protein	NA	NA	NA	NA
WP_114284581.1\|131145_131418_+	EexN family lipoprotein	NA	NA	NA	NA
WP_089423113.1\|131426_132299_+	type IV secretion system protein	NA	NA	NA	NA
WP_089423114.1\|132344_132533_+	hypothetical protein	NA	NA	NA	NA
WP_089423115.1\|132519_133203_+	virB8 family protein	NA	NA	NA	NA
WP_089423116.1\|133199_134051_+	TrbG/VirB9 family P-type conjugative transfer protein	NA	NA	NA	NA
WP_089423117.1\|134050_135193_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_089423118.1\|135199_136228_+	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_089423119.1\|136374_138357_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_089423120.1\|138371_140171_+	hypothetical protein	NA	NA	NA	NA
WP_089423121.1\|140384_141770_+\|transposase	transposase	NA	NA	NA	NA
WP_089423122.1\|142131_143172_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089423123.1\|143434_144349_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089423249.1\|144440_145136_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_089423250.1\|145150_145870_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.4e-15	28.2

DBSCAN-SWA_10

149424 : 156118

Geobacillus_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423128.1\|149424_150240_+	thymidylate synthase	A6M9A2	Geobacillus_virus	1.5e-89	58.3
WP_089423129.1\|150236_150713_+	dihydrofolate reductase	F8SJN4	Pseudomonas_phage	1.8e-21	42.1
WP_089423251.1\|150932_151730_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_089423131.1\|152138_153158_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089423132.1\|153686_154433_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-27	35.2
WP_089423133.1\|154460_155189_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_089423134.1\|155191_156118_-	3-keto-5-aminohexanoate cleavage protein	A0A1V0SL81	Klosneuvirus	3.2e-19	26.8

DBSCAN-SWA_11

165729 : 172057

Gordonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423144.1\|165729_166698_-	ParB/RepB/Spo0J family partition protein	A0A160DCL1	Gordonia_phage	3.5e-08	34.1
WP_089423145.1\|166699_167440_-	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	3.7e-10	29.1
WP_089423146.1\|167475_167982_-	hypothetical protein	NA	NA	NA	NA
WP_089423147.1\|167983_168187_-	hypothetical protein	NA	NA	NA	NA
WP_089423148.1\|168280_169168_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	4.4e-58	45.1
WP_089423149.1\|170074_170320_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_089423150.1\|170319_170745_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_089423151.1\|170863_171085_-	hypothetical protein	NA	NA	NA	NA
WP_089423152.1\|171274_172057_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.7e-26	32.8

DBSCAN-SWA_12

176948 : 178781

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423156.1\|176948_178781_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-16	27.0

DBSCAN-SWA_13

195232 : 200890

Burkholderia_phage(75.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423171.1\|195232_196060_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	3.4e-36	37.5
WP_089423172.1\|196056_196944_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_114284729.1\|197126_197546_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_089423173.1\|197956_199222_+	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	3.2e-110	54.2
WP_089423174.1\|199221_199695_+	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	3.9e-45	56.5
WP_089423254.1\|199672_200890_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.5e-96	47.0

DBSCAN-SWA_14

205450 : 206593

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423178.1\|205450_206593_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.4e-26	35.1

DBSCAN-SWA_15

209657 : 210716

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423182.1\|209657_210716_+	2-hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	9.7e-28	29.2

DBSCAN-SWA_16

214480 : 224762

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423186.1\|214480_216787_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	6.1e-67	29.6
WP_089423187.1\|216799_217369_+	peroxidase-related enzyme	NA	NA	NA	NA
WP_089423188.1\|217372_217768_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_089423255.1\|217794_219462_+	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	7.8e-24	27.5
WP_089423189.1\|219491_220889_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_089423190.1\|221062_221464_+	hypothetical protein	NA	NA	NA	NA
WP_089423191.1\|222131_222884_-	ATP-binding cassette domain-containing protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.1e-16	28.6
WP_089423192.1\|222880_223825_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_089423193.1\|223814_224762_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-57	40.3

DBSCAN-SWA_17

231158 : 232961

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423199.1\|231158_232961_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	6.1e-22	27.5

DBSCAN-SWA_18

243163 : 248568

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423207.1\|243163_244048_+	recombinase family protein	A0A0C4UR34	Shigella_phage	8.3e-33	55.4
WP_089423208.1\|244093_244387_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_089423209.1\|245081_246281_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.8e-91	48.8
WP_089423258.1\|246280_247255_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	3.5e-32	31.7
WP_089423210.1\|247482_248568_+	replication protein C	L7TKN6	Rhizobium_phage	3.4e-12	28.5

DBSCAN-SWA_19

255342 : 256789

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423216.1\|255342_256089_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-10	24.1
WP_089423217.1\|256081_256789_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.4e-13	26.9

DBSCAN-SWA_20

261304 : 265719

Dishui_lake_phycodnavirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423260.1\|261304_263746_-	DEAD/DEAH box helicase family protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	2.7e-33	30.7
WP_089423221.1\|264636_265719_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	8.7e-16	28.3

DBSCAN-SWA_21

269698 : 274561

Acidithiobacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423261.1\|269698_271240_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.9
WP_089423226.1\|271226_272336_+	ABC transporter permease	NA	NA	NA	NA
WP_089423227.1\|272325_273264_+	ABC transporter permease	NA	NA	NA	NA
WP_157729098.1\|273550_274126_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	5.1e-31	41.3
WP_157729099.1\|274129_274561_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	1.7e-15	36.4

DBSCAN-SWA_22

281824 : 282541

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089423235.1\|281824_282541_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	7.8e-13	26.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25156 : 56380

Burkholderia_virus(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422419.1\|25156_25858_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_157729040.1\|26117_27413_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_089422421.1\|27613_28219_+	hypothetical protein	NA	NA	NA	NA
WP_089422739.1\|28270_29470_-	CoA transferase	NA	NA	NA	NA
WP_089422422.1\|29508_31119_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-17	30.3
WP_089422423.1\|31115_31859_-	ABC transporter permease	NA	NA	NA	NA
WP_089422424.1\|31998_32940_-	ABC transporter permease	NA	NA	NA	NA
WP_089422425.1\|32939_34529_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_089422426.1\|34594_36295_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_089422427.1\|36569_37499_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-07	31.5
WP_114284529.1\|37495_38104_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089422740.1\|38153_39387_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	8.7e-105	68.3
WP_157729041.1\|39424_39697_-	hypothetical protein	NA	NA	NA	NA
WP_114284527.1\|39704_40037_+	hypothetical protein	NA	NA	NA	NA
WP_089422430.1\|40215_40869_-	hypothetical protein	NA	NA	NA	NA
WP_089422431.1\|41122_41860_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_089422432.1\|41954_42827_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_089419164.1\|43297_44326_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.3e-16	28.8
WP_089419165.1\|44579_45620_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089422434.1\|45799_47044_-	MFS transporter	NA	NA	NA	NA
WP_089422435.1\|47166_47871_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089422436.1\|48138_48519_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089422437.1\|48617_49826_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	5.3e-06	27.8
WP_089422741.1\|50721_51042_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089422438.1\|51038_51485_+	polyketide cyclase	NA	NA	NA	NA
WP_089422439.1\|51525_51945_+	GFA family protein	NA	NA	NA	NA
WP_089422440.1\|52120_52522_-	cell wall hydrolase	A0A172Q0A7	Acinetobacter_phage	1.2e-07	35.4
WP_089422441.1\|52702_52990_+	H-NS histone family protein	NA	NA	NA	NA
WP_089422442.1\|53394_54408_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089422443.1\|54534_55245_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.7e-29	37.2
WP_089422442.1\|55366_56380_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

72485 : 121513

Macacine_betaherpesvirus(12.5%)

transposase,integrase

attL 96251:96266|attR 129853:129868

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422455.1\|72485_73187_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_089422456.1\|73606_74593_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_089422457.1\|74589_75792_-	AAA family ATPase	A0A2I6B2X3	Macacine_betaherpesvirus	8.1e-39	35.3
WP_089422458.1\|76419_77430_+	replication initiation protein	NA	NA	NA	NA
WP_157729042.1\|77426_78566_-	CHAT domain-containing protein	NA	NA	NA	NA
WP_089422461.1\|79202_79559_-	hypothetical protein	NA	NA	NA	NA
WP_089422462.1\|79666_81613_+	HAMP domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	4.6e-07	23.9
WP_089422463.1\|81904_82882_+	serine hydrolase	NA	NA	NA	NA
WP_089422464.1\|83059_83311_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_089422465.1\|83310_84633_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_089422466.1\|84927_85197_-	hypothetical protein	NA	NA	NA	NA
WP_089422467.1\|85193_86765_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.5e-74	34.2
WP_089422468.1\|86833_87187_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_089422469.1\|87183_87615_-\|transposase	transposase	NA	NA	NA	NA
WP_089422470.1\|88028_88370_+	DUF2853 family protein	NA	NA	NA	NA
WP_089422471.1\|88438_88735_+	hypothetical protein	NA	NA	NA	NA
WP_089422472.1\|89689_90529_-	FkbM family methyltransferase	NA	NA	NA	NA
WP_089422473.1\|91066_91747_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_089422474.1\|91915_94258_+	cytochrome P450	NA	NA	NA	NA
WP_089422744.1\|94314_95325_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_089422475.1\|95391_95883_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_089422476.1\|95879_97181_+	TRAP transporter large permease	NA	NA	NA	NA
96251:96266	attL	NA	NA	NA	NA
WP_089422477.1\|97621_98512_-	acyltransferase	NA	NA	NA	NA
WP_089422478.1\|98862_99885_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.3e-18	32.7
WP_089422479.1\|99881_100871_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-11	27.0
WP_089422745.1\|100867_101635_-	ABC transporter permease	NA	NA	NA	NA
WP_089422480.1\|101742_102759_-	ABC transporter permease	NA	NA	NA	NA
WP_089422481.1\|102763_104350_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_089422482.1\|104384_105653_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_089422483.1\|106078_106729_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_089422484.1\|106922_108650_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_089422485.1\|109199_110157_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.0e-12	27.6
WP_157729043.1\|110990_111455_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_089422487.1\|111733_112117_-	DoxX family protein	NA	NA	NA	NA
WP_157729044.1\|112808_112985_+	hypothetical protein	NA	NA	NA	NA
WP_089422488.1\|113511_114102_+	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_089422489.1\|114094_115282_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_157729045.1\|115315_115897_+	hypothetical protein	NA	NA	NA	NA
WP_089422115.1\|115977_117003_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089422491.1\|117184_117703_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.6e-20	36.9
WP_089420773.1\|118455_119754_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_089422492.1\|120016_121513_-\|integrase	site-specific integrase	Q6A1Z6	Oenococcus_phage	8.3e-09	27.4
129853:129868	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP022420

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28782 : 54189

uncultured_Mediterranean_phage(20.0%)

integrase,transposase

attL 22373:22388|attR 41680:41695

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
22373:22388	attL	NA	NA	NA	NA
WP_089423257.1\|28782_29769_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037239259.1\|30048_30933_+	DUF1403 family protein	NA	NA	NA	NA
WP_037240140.1\|30980_31592_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	7.1e-15	27.2
WP_157729111.1\|31608_32544_-	hypothetical protein	NA	NA	NA	NA
WP_051922089.1\|32615_33482_-	AAA family ATPase	NA	NA	NA	NA
WP_081896153.1\|33498_34869_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_051922139.1\|35319_36279_+	hypothetical protein	NA	NA	NA	NA
WP_051922138.1\|36873_37689_+	phosphonate metabolism transcriptional regulator PhnF	NA	NA	NA	NA
WP_037239976.1\|37885_38359_+	hypothetical protein	NA	NA	NA	NA
WP_081896186.1\|38327_38942_+	hypothetical protein	NA	NA	NA	NA
WP_051922137.1\|38943_40134_+	hypothetical protein	NA	NA	NA	NA
WP_037239970.1\|40130_41018_+	hypothetical protein	NA	NA	NA	NA
WP_037239966.1\|41002_41839_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.9e-09	30.9
41680:41695	attR	NA	NA	NA	NA
WP_037239963.1\|41835_42573_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.7e-13	28.6
WP_057821629.1\|42569_43760_+	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_037239960.1\|43768_44818_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_037239958.1\|44887_45724_+	hypothetical protein	NA	NA	NA	NA
WP_051922135.1\|45746_46748_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.6e-26	33.8
WP_037239957.1\|46744_47566_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_089423474.1\|48194_49556_-\|transposase	ISKra4 family transposase	NA	NA	NA	NA
WP_089423475.1\|49893_50622_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_089423477.1\|51056_51359_+\|transposase	transposase	NA	NA	NA	NA
WP_089423478.1\|51524_52886_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.4e-111	47.1
WP_089423479.1\|53820_54189_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP022417

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7802

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422769.1\|524_1436_-	ABC transporter permease	NA	NA	NA	NA
WP_089422770.1\|1444_2362_-	ABC transporter permease	NA	NA	NA	NA
WP_089422771.1\|2432_3947_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_089422772.1\|4199_4856_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_089422773.1\|5026_6280_+	malonyl-CoA decarboxylase	NA	NA	NA	NA
WP_089422774.1\|6284_7802_+	malonyl-CoA synthase	A0A2H4PQM9	Staphylococcus_phage	1.3e-38	28.9

DBSCAN-SWA_2

17277 : 20923

Enterobacteria_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422783.1\|17277_18039_-	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	1.5e-09	27.6
WP_089422784.1\|18426_18987_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.2e-37	45.4
WP_089422785.1\|18983_20051_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.6e-92	51.1
WP_089422786.1\|20047_20923_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.2e-86	53.7

DBSCAN-SWA_3

26129 : 27050

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422790.1\|26129_27050_+	glutamine amidotransferase family protein	F2Y1G4	Organic_Lake_phycodnavirus	2.0e-05	25.5

DBSCAN-SWA_4

32319 : 32862

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422794.1\|32319_32862_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-07	33.3

DBSCAN-SWA_5

44585 : 47319

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422804.1\|44585_45569_+	hypothetical protein	A0A1B1IVB5	uncultured_Mediterranean_phage	5.1e-23	30.9
WP_089422805.1\|45565_45883_-	NIPSNAP family protein	NA	NA	NA	NA
WP_089422806.1\|45892_46609_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_089422807.1\|46623_47319_-	nickel pincer cofactor biosynthesis protein LarB	A0A096XTB6	Enterococcus_phage	8.9e-14	33.8

DBSCAN-SWA_6

52056 : 53757

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422812.1\|52056_53757_+	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	6.8e-23	24.2

DBSCAN-SWA_7

64008 : 78122

Bacillus_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422820.1\|64008_65085_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-20	28.0
WP_089422821.1\|65088_66177_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.9e-21	32.9
WP_089422822.1\|66186_67773_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_089422823.1\|67990_68752_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_089422979.1\|68953_69928_+	response regulator	W8CYM9	Bacillus_phage	4.2e-09	33.6
WP_089422980.1\|70171_71143_+	response regulator	NA	NA	NA	NA
WP_089422981.1\|71145_71496_+	hypothetical protein	NA	NA	NA	NA
WP_089422824.1\|71672_72631_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.0e-12	27.6
WP_089422982.1\|72731_73106_-	response regulator	NA	NA	NA	NA
WP_089422983.1\|73118_74741_-	PAS domain-containing protein	A0A1V0SGX0	Hokovirus	1.1e-14	30.9
WP_089422825.1\|74924_78122_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.7e-20	30.6

DBSCAN-SWA_8

84028 : 84913

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422829.1\|84028_84913_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	1.1e-11	41.6

DBSCAN-SWA_9

88084 : 89062

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422833.1\|88084_89062_+	TAXI family TRAP transporter solute-binding subunit	B2ZXX0	Ralstonia_phage	4.6e-08	26.5

DBSCAN-SWA_10

103243 : 104080

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422844.1\|103243_104080_-	helix-turn-helix domain-containing protein	A0A2H4J437	uncultured_Caudovirales_phage	2.2e-14	43.4

DBSCAN-SWA_11

113674 : 171239

Bacillus_phage(30.0%)

integrase,transposase

attL 142407:142423|attR 173402:173418

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422485.1\|113674_114633_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.0e-12	27.6
WP_089422853.1\|115043_116225_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_089422854.1\|116233_117103_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.5e-34	34.3
WP_089422855.1\|117415_118768_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_089422856.1\|118764_119436_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.8e-26	32.6
WP_089422857.1\|119612_120728_+	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-24	31.0
WP_089422858.1\|121156_122338_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_089422859.1\|122334_125457_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_157729063.1\|125461_125638_-	hypothetical protein	NA	NA	NA	NA
WP_157729064.1\|125737_126169_+	hypothetical protein	NA	NA	NA	NA
WP_157729065.1\|126176_126509_+	hypothetical protein	NA	NA	NA	NA
WP_089422861.1\|126636_127572_+	bifunctional enoyl-CoA hydratase/phosphate acetyltransferase	NA	NA	NA	NA
WP_089422862.1\|127608_129132_+	phospholipase	NA	NA	NA	NA
WP_089422863.1\|129162_129879_-	hypothetical protein	A0A1V0S9M4	Catovirus	1.0e-04	46.8
WP_089422864.1\|129854_130706_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_089422865.1\|130752_132078_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_089422987.1\|132077_132623_-	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_089422988.1\|132731_133733_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_089422866.1\|133864_134899_-	C-terminal binding protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	3.0e-26	31.3
WP_089422867.1\|135077_135773_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_089422868.1\|135975_137139_+	ATP-binding protein	NA	NA	NA	NA
WP_089422869.1\|137169_138198_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_089422870.1\|138167_139541_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.5e-12	24.9
WP_089422871.1\|139533_140205_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.8e-23	29.2
WP_089422872.1\|140328_141315_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_089422989.1\|141418_141907_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_089422873.1\|141919_143434_+	tripartite tricarboxylate transporter TctA	NA	NA	NA	NA
142407:142423	attL	NA	NA	NA	NA
WP_157729066.1\|143716_144103_+	hypothetical protein	NA	NA	NA	NA
WP_089422874.1\|144279_145419_-	DUF2855 family protein	NA	NA	NA	NA
WP_089422875.1\|145568_146213_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_089422877.1\|146983_150352_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_089422878.1\|150364_150883_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	8.1e-12	31.5
WP_089422879.1\|150905_151262_-	nucleotide-binding protein	NA	NA	NA	NA
WP_089422880.1\|151498_153358_-	AAA family ATPase	NA	NA	NA	NA
WP_157729067.1\|162263_162422_-	hypothetical protein	NA	NA	NA	NA
WP_089422881.1\|162438_164154_-	thiamine pyrophosphate-requiring protein	NA	NA	NA	NA
WP_089422990.1\|164295_165378_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_089422882.1\|165364_166756_-	AAA family ATPase	A0A0K2FLP4	Brevibacillus_phage	2.3e-08	27.8
WP_089422991.1\|167257_168436_+	replication initiation protein	NA	NA	NA	NA
WP_089422883.1\|168432_169536_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_089422992.1\|169592_171239_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
173402:173418	attR	NA	NA	NA	NA

DBSCAN-SWA_12

181062 : 191980

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422892.1\|181062_182100_+	phosphate ABC transporter substrate-binding protein	A0A1B1IWY0	uncultured_Mediterranean_phage	3.7e-88	49.0
WP_089422893.1\|182169_183546_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_089422894.1\|183559_184864_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_089422993.1\|184887_185685_+	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-13	30.7
WP_089422895.1\|185696_186413_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_089422896.1\|186412_187102_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	6.7e-38	36.8
WP_089422897.1\|187088_187799_+	hypothetical protein	NA	NA	NA	NA
WP_089422898.1\|187805_188042_-	thioredoxin family protein	NA	NA	NA	NA
WP_089422899.1\|188053_189112_-	permease	NA	NA	NA	NA
WP_089422900.1\|189108_189396_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_089422994.1\|189617_190475_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.6e-49	40.0
WP_089422995.1\|190489_191980_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	4.2e-178	67.1

DBSCAN-SWA_13

202582 : 203389

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422909.1\|202582_203389_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-28	33.3

DBSCAN-SWA_14

212666 : 214152

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422918.1\|212666_213407_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.3e-15	26.2
WP_089422919.1\|213399_214152_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-10	25.4

DBSCAN-SWA_15

221318 : 222623

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422999.1\|221318_222623_+	type II and III secretion system protein family protein	R9TEZ5	Vibrio_phage	1.2e-08	27.0

DBSCAN-SWA_16

231045 : 232011

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157729072.1\|231045_232011_-	response regulator	W8CYM9	Bacillus_phage	2.3e-12	35.4

DBSCAN-SWA_17

242966 : 245102

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422936.1\|242966_245102_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.3e-23	25.5

DBSCAN-SWA_18

257278 : 258743

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422946.1\|257278_257980_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.6e-16	27.6
WP_089422947.1\|257972_258743_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.0e-15	29.0

DBSCAN-SWA_19

268618 : 271345

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422957.1\|268618_271345_+	molybdopterin-dependent oxidoreductase	A0A0P0I429	Acinetobacter_phage	3.7e-55	27.3

DBSCAN-SWA_20

275089 : 278338

Saccharomonospora_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089422960.1\|275089_278338_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	1.2e-63	26.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP022415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022415_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022415_1

1565207-1565334

Orphan

Consensus_repeat	Method
CCGATCAGGCAGTTGTTGCCGAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP022415_1

>merge|NZ_CP022415|1|1565207-1565334|CRISPRCasFinder
CCGATCAGGCAGTTGTTGCCGATTTTGGCCCCGTTCAGCACGGTGGCCCCCATGCCGATCAGGCTGTTGTTGCCGATGGTGCAGCCATGCAGCATGACCTTGTGACCGATGGTGCAGTTTTCGCCTAT

>NZ_CP022415|1|1|1565207-1565334|CRISPRCasFinder
CCGATCAGGCAGTTGTTGCCGAT	TTTGGCCCCGTTCAGCACGGTGGCCCCCATG
CCGATCAGGCTGTTGTTGCCGAT	GGTGCAGCCATGCAGCATGACCTTGTGA
CCGATGGTGCAGTTTTCGCCTAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022415.1\|WP_089420282.1\|1574052_1574877_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP022415.1\|WP_089420278.1\|1568079_1569453_-\|3-deoxy-7-phosphoheptulonate-synthase-class-II	unknown	unknown	gnl\|CDD\|366662
NZ_CP022415.1\|WP_089422215.1\|1567321_1568011_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|284676
NZ_CP022415.1\|WP_089422214.1\|1562772_1563807_-\|two-component-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP022415.1\|WP_089420280.1\|1571971_1573168_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380569
NZ_CP022415.1\|WP_089420277.1\|1566215_1567094_-\|YicC-family-protein	unknown	unknown	gnl\|CDD\|236993
NZ_CP022415.1\|WP_089420271.1\|1560412_1561102_-\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
NZ_CP022415.1\|WP_089422216.1\|1570672_1571788_-\|PQQ-dependent-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|369642
NZ_CP022415.1\|WP_089420279.1\|1569667_1570672_+\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP022415.1\|WP_089420283.1\|1574945_1575956_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP022415.1\|WP_089420276.1\|1565549_1566209_-\|guanylate-kinase	unknown	unknown	gnl\|CDD\|234719
NZ_CP022415.1\|WP_089422211.1\|1553656_1554421_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235975
NZ_CP022415.1\|WP_089420270.1\|1558496_1560125_+\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	unknown	unknown	gnl\|CDD\|100087
NZ_CP022415.1\|WP_089420273.1\|1561834_1562629_-\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|237645
NZ_CP022415.1\|WP_089420272.1\|1561114_1561822_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|273990
NZ_CP022415.1\|WP_089420281.1\|1573273_1574056_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP022415.1\|WP_089422213.1\|1556521_1558222_-\|acyl--CoA-ligase	unknown	unknown	gnl\|CDD\|235730
NZ_CP022415.1\|WP_089422212.1\|1554426_1555710_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173844
NZ_CP022415.1\|WP_089420269.1\|1555755_1556529_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180591
NZ_CP022415.1\|WP_089420274.1\|1563839_1565027_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|99738

Protein	Function_ID	Function_description	E-value
NZ_CP022415.1\|WP_089420282.1\|1574052_1574877_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	2.44127e-109
NZ_CP022415.1\|WP_089420278.1\|1568079_1569453_-\|3-deoxy-7-phosphoheptulonate-synthase-class-II	gnl\|CDD\|366662	pfam01474, DAHP_synth_2, Class-II DAHP synthetase family. Members of this family are aldolase enzymes that catalyze the first step of the shikimate pathway.	0
NZ_CP022415.1\|WP_089422215.1\|1567321_1568011_+\|PAS-domain-containing-protein	gnl\|CDD\|284676	pfam07310, PAS_5, PAS domain. This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long. This region is is distantly similar to other PAS domains.	6.12138e-39
NZ_CP022415.1\|WP_089422214.1\|1562772_1563807_-\|two-component-sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.99425e-100
NZ_CP022415.1\|WP_089420280.1\|1571971_1573168_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380569	cd06346, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.	1.70387e-96
NZ_CP022415.1\|WP_089420277.1\|1566215_1567094_-\|YicC-family-protein	gnl\|CDD\|236993	PRK11820, PRK11820, YicC family protein.	4.44042e-100
NZ_CP022415.1\|WP_089420271.1\|1560412_1561102_-\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	3.46917e-123
NZ_CP022415.1\|WP_089422216.1\|1570672_1571788_-\|PQQ-dependent-sugar-dehydrogenase	gnl\|CDD\|369642	pfam07995, GSDH, Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.	6.2393e-171
NZ_CP022415.1\|WP_089420279.1\|1569667_1570672_+\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	3.10403e-126
NZ_CP022415.1\|WP_089420283.1\|1574945_1575956_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	7.67398e-58
NZ_CP022415.1\|WP_089420276.1\|1565549_1566209_-\|guanylate-kinase	gnl\|CDD\|234719	PRK00300, gmk, guanylate kinase; Provisional.	5.11788e-109
NZ_CP022415.1\|WP_089422211.1\|1553656_1554421_-\|SDR-family-oxidoreductase	gnl\|CDD\|235975	PRK07231, FabG-like, SDR family oxidoreductase.	1.70266e-78
NZ_CP022415.1\|WP_089420270.1\|1558496_1560125_+\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	gnl\|CDD\|100087	cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes. In one direction, G-1-P produced from sucrose catabolism is converted to G-6-P, the first intermediate in glycolysis. In the other direction, conversion of G-6-P to G-1-P generates a substrate for synthesis of UDP-glucose which is required for synthesis of a variety of cellular constituents including cell wall polymers and glycoproteins. The PGM1 family also includes a non-enzymatic PGM-related protein (PGM-RP) thought to play a structural role in eukaryotes, as well as pp63/parafusin, a phosphoglycoprotein that plays an important role in calcium-regulated exocytosis in ciliated protozoans. PGM1 belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP022415.1\|WP_089420273.1\|1561834_1562629_-\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|237645	PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional.	0
NZ_CP022415.1\|WP_089420272.1\|1561114_1561822_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|273990	TIGR02135, Uncharacterized_protein, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. [Regulatory functions, Other, Transport and binding proteins, Anions].	9.15721e-69
NZ_CP022415.1\|WP_089420281.1\|1573273_1574056_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	9.19873e-103
NZ_CP022415.1\|WP_089422213.1\|1556521_1558222_-\|acyl--CoA-ligase	gnl\|CDD\|235730	PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated.	4.78593e-127
NZ_CP022415.1\|WP_089422212.1\|1554426_1555710_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173844	cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2. FadE2-like Acyl-CoA dehydrogenase (ACAD). Acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACAD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. ACAD's are generally homotetramers and have an active site glutamate at a conserved position.	0
NZ_CP022415.1\|WP_089420269.1\|1555755_1556529_-\|enoyl-CoA-hydratase	gnl\|CDD\|180591	PRK06494, PRK06494, enoyl-CoA hydratase; Provisional.	4.84143e-107
NZ_CP022415.1\|WP_089420274.1\|1563839_1565027_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|99738	cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of antimicrobials and herbicides. This subgroup also includes cystathionine gamma-lyases (CGL), O-acetylhomoserine sulfhydrylases and O-acetylhomoserine thiol lyases. CGL's are very similar to CGS's. Members of this group are widely distributed among all three forms of life.	1.6282e-129

>NZ_CP022415.1|WP_089420274.1|1563839_1565027_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MRNEKGSLIRPVPLPNSASRPVVTPLSPSVVYASDTPDMLDRQYEGELHGYTYSREGHPNADVVAGLLDRMENAPNPGVLTSSGMAAVSAVLLGLLKAGDHVIGGNQLYGRSLRMMSEDLPRLGIETTLADPGDVQAVRAALRPETRMILVEVVSNPTLRVADMVGLAALAKETGVLLVVDNTFTTPRAYQPFEHGADIVIHSVTKLLAGHSDVMLGYVAARDPALNTRLRVFTVTAGMTPSPFDCWLAERGMLSFDLRFERCQQTAMKLADALGTLKGVKRVIYPARSDHPDHARAAELLQARWCNMVSFELDGGREAANAFTTAAEGLSFAPTLGDVGTTLSHPASSSHRALTAARRKALGMSEGFFRVSVGLEDPDILLAVFERAVDAAVKA
>NZ_CP022415.1|WP_089422214.1|1562772_1563807_-|two-component-sensor-histidine-kinase
MLEALPMPGLVVNQSEVIVGANIAARNLIGQRIEGRPYVTMLRQPALLDAVEACLRQGKPRTAPYLTNDGAQHSTFSVHVAQVVTDDAAPMVLLTFEDVTHVQQAGQMRRDFVANVSHELRTPLTALMGFIETLRGPARNDPAAQARFLGIMQDQAERMNRLVGDLLSLSRVEGDERVRPTGQVNLRECLASVVALMTPLADEAGVTLVAELGDNPVTVAADRDQLVQVVSNLIENAIKYGGKDRAVTLRLNVNTNLRALRGPGATIEVIDQGHGIDPIHLPRLTERFYRADNHRSRELGGTGLGLAIVKHIVSRHRGRLRIDSVLGQGTTVQVALPWTPPDES
>NZ_CP022415.1|WP_089420273.1|1561834_1562629_-|phosphate-ABC-transporter-ATP-binding-protein
MKDLMAKNTVDIQNLKISARNVQVYYGDTHAIKDVNVDIEDKTVTAFIGPSGCGKSTFLRCINRMNDTIDVCRVQGDILIDGEDIYDKHVDPVQLRAKVGMVFQKPNPFPKSIYDNVAYGPRIHGLARNKADLDNIVERALRRGAIWDEVKDRLDGPGTGLSGGQQQRLCIARAVATEPEVLLMDEPCSALDPIATAQVEELIDELRQNYSVVIVTHSMQQAARVSQKTAFFHLGNLVEYGETGTIFTNPTDARTESYITGRIG
>NZ_CP022415.1|WP_089420272.1|1561114_1561822_-|phosphate-signaling-complex-protein-PhoU
MSSDQHIASVFDRDLETIQAQIMKMGGLVEEAILEAATSLETRDEERAEAVRKADKRIDALEETINEEAARVIALRAPIAVDLRLILSVIKISANLERIGDYAKNMAKRTGVLATLAPVSDSAGALRRMAREVERMLKDALDSYVNRDAELAQDVIDRDMEVDQMYNALFREFLTFMMEDPRNITACMHLHFIAKNIERMGDHVTSIAEQTVYLVTGAHADENRTKADTTSVQPL
>NZ_CP022415.1|WP_089420271.1|1560412_1561102_-|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MSADQPRVLLVEDEAAQREVLAYNLSAEGFEVVSADNGEDAIMLIGEAPPDIIVLDWMMPHLSGIEVCRRLKVRPETRDIPVIMLSARSEEVDKVRGLETGADDYVVKPYSMVELMARVRTQLRRVRPATVGVPLHYEDIMLDAESHRVTRGEVELKLGPTEFRLLSTFMEKPGRVWSRESLLDRVWGRDIYVDTRTVDVHIGRLRKALTLTGGSDPLRTVRGAGYALG
>NZ_CP022415.1|WP_089420270.1|1558496_1560125_+|alpha-D-glucose-phosphate-specific-phosphoglucomutase
MTVKTISTTAFNDQKPGTSGLRKKTRAFMMANYLENYVAATFTAIDGGAGKTFVLGGDGRFFNRDAIQTILKMAAALGAARMIVGQGGLLSTPAASHLIRRHKAHGGFILSASHNPGGIDADFGLKFNAANGGPAPEALTARIHAATLTIERYDIADVPDINLDTVGQTQMGDMVIDVVDPVADYSDLMASLFDFAAIRALFTGGFTMRFDAMHAVTGPYAHAILEDTLGAAKGTVVNGIPLEDFGKGHPDPNPIWASDLMALMMSDAAPDMGAASDGDGDRNMIVGKGTYITPSDSLAMLAANAHLAPAYRDGITGIARSMPTSAAADRVADALGVPCFETPTGWKFFGTLLDAGRVTICGEESAGTGSHHVREKDGLWAVLLWLNILAARGMSVAEVQADHWQRFGRNYYARHDYEAVETARADKMMAHLRAQLDGLPGQSHAGLTVTKADDFAYTDPVDGSTSAAQGIRLFFEGGARAVFRLSGTGTEGATIRLYLEQFVSEGNHAAAVDQMLDAVRQAALTISDLPAFTGRDAPDVQT
>NZ_CP022415.1|WP_089422213.1|1556521_1558222_-|acyl--CoA-ligase
MTAMTYDEAAAHLTTTDPRFELAKANIRGVDFTVYKNAPGDVVTMMRASREAQQNGAAEYLVFENERWTYDEFMADIDRLAHILGNQFGVRRGTRVALAMRNCPELLLGMMAIASLGGVVVFLNGWWTTEELDYALQDSAAKLVLADGDRAARLVPLEVPLGLTVIGVRDAQLPHSLADLMQGVGDVAPAQVTIDTDDDFAIMYSSGTTGKPKGVVQTHRGVVNAVYSWLLTFVMGPLIEPPEDPDAVAPRPAVLIVTPLFHVTATHPSFMLSMPAGAKIVVMPKWDARRAVELIRDEEVTRFLGVPTQSADLVVAAREMGEDLPLLTYIGSGGAKRPAAQVAEIAGTFKNAAVATGWGMTETNAMGIGLLGDDYLKHPGAAGRLYPAVQELRFLDDAGQPVGVGEVGEITVKSPCNMREYLNKPKATAEVLQDGWLRSGDLGFIDDEGIVTIVDRKKNIIIRGGENIACLDVEGALHSHPAVAEACVFSVPHDRLGEVVGAGVQLKPGHSVNEEDLKAFLRDHIAKFKVPEHFWFQTDPLPRGTTDKIDRRGLQATCLNKDKLNA
>NZ_CP022415.1|WP_089420269.1|1555755_1556529_-|enoyl-CoA-hydratase
MPEFVTSETRGPILIVTMNRPEVYNAVHPPMHMEMDAIWNDFRDNPDLWVAVLTGAGDKAFSAGNDLKHSASGKGGSIPDSGFAGLSKRFDLDKPVIAAVNGFAMGGGFETALACDIIIGADNSTYALPEVKVGFFAATGGVQRLSRFMSRTKANELLFTGRHMDAAEALGHGILNAVVPQADLMEAAMKMAEEIASQSPSSVRATKRVLNEMARAEGLNDSLAYSYEVLGELMKTEDHREGVTAFVEKRKPDWVNR
>NZ_CP022415.1|WP_089422212.1|1554426_1555710_-|acyl-CoA-dehydrogenase
MNNLEMSEGNKPLLNAVIRHIRDNVDPITEEFYRLGEGRADRWSYAPGQLELLEGAKQKAREAGLWNFFLPNAETGEGLSNLDYAYIAAELGKSPLAPETLNCSAPDTGNMEVLERVGTQAQKDKWLKPLLAGEIRSAFAMTEPDVASSDAKNISTSAVLENGEWVINGEKYYISGAGDPRCKIMIVMVKTSPDAESFRQQSQILVPVDTPGVEILGPMHVFGHDDAPHGHMHIKFTNVRVPEENILWGEGRGFEISQVRLGPGRIHHCMRSIGQAEKALDLLMDRAINRQAFGKRIVDLGKNMETISRARIEIEAMRLMVLKAAKAMDVLGNKEARIWVSMIKAMVPEKVCQIIDQSMQVHGATGLSQWSPLSNMYTGQRTLRFADGPDEVHHHVVARAEVSEFQASNERQLAAHGKAQGKVFSGP
>NZ_CP022415.1|WP_089422211.1|1553656_1554421_-|SDR-family-oxidoreductase
MFDLTGKVALLTGASKGMGLAMATALAEHGATVVISARKQDQLDAAAADINKTVGATRAHGLACNVGYKDQLQALVDQTRKIAGPIDIVVGNAGVNPYYGKTSEIPDDAYQKTMNANVLSNQWLATMVAPDMIEKGAGSMMFTSSIGAFKPSEMLGTYGMSKLALIGLVRNLAQEFGPQGIRFNAICPGLVKTDFARELWDNPEVEKRIQGEIPLRRLGEPDDFGGLAVYLASDASKYMTGQALTVCGGSNMWT
>NZ_CP022415.1|WP_089420276.1|1565549_1566209_-|guanylate-kinase
MTTERRKNDRRGLLMILSSPSGAGKSTLAKRLRAWDTSIRFSVSATTRAPRVGEVDKSDYHFVSEDEFKRMVTNDEMLEHAHVFGNFYGSPTGPVRDAIEQGNDVLFDIDWQGAQQIRNSALGMHTLSVFLLPPSITELRRRLEARGQDSKEVIDQRMKKCWDEISHWDGYDFVLVNDDLDETENSLRKIIDVARMRRSQQPNLTEHVRQLQSEFQEQL
>NZ_CP022415.1|WP_089420277.1|1566215_1567094_-|YicC-family-protein
MTAFAASAGESGAYRWSCELRSVNGKGLDIRVRAPDWVDGLEVALRTQVAATVARGNVTLNVRVTREDAAVTVQVNNAQLSAMLAALTEIEAQAMDLGLSLAPSKATDIAVMRGVLEQSSGDQDTGPLKAALEADIAAMLEDFVQMRANEGAVLAKVLHAQLDEVAKLTAQAAQVAEARKDEVAQGLRRTLARIVENAEGLDEARITQELALLAVKADITEEIDRLGAHVAAARDLVNVAGPVGRKLDFLMQEFNRETNTLCAKAQNTELTRVGLALKALIDQMREQVQNVE
>NZ_CP022415.1|WP_089422215.1|1567321_1568011_+|PAS-domain-containing-protein
MDLFDRNTRNVVAMTDFQADTGFSALAQVEGYWDALRGNRLMPNRAEIDPRGIESALEYTFILERIAPGMARLRIAGSHLGDLMGMEVRGMSLTTLVSPDGRRQLSDTLEDVFQRPSICEVRLSAPAGFDKPAMDARMILLPMKSDLGDVSRALGCFVARGTIGRKPRRFDVTGVDTRPIVAPATSTFNSQEPQPVVAMRESGMSEPAKPFVKRRRSGDVPYLRLIKSD
>NZ_CP022415.1|WP_089420278.1|1568079_1569453_-|3-deoxy-7-phosphoheptulonate-synthase-class-II
MSEWSKSDWRNKPRIQMPDYTDTAALQAVTAQLSKYPPLVFAGEARKLKAHLGAASRGEAFLLQGGDCAEAFDQFSADAIRDTFKVMLQMAMVLTFGAKVPVVKVGRMAGQFAKPRSAPTEVIDGVELPSYRGDIINGLDFTPESRIPDPAKMLQAYTQAAGTLNLLRAFSTGGFADMHRVHAWTLGFTDGEDAAKYAEIANRIQDTIDFMGAAGINSKTTHEFSTVEFYTSHESLLLEYEEALTRLDSTSGKWLAGSGHMIWIGDRTRQPDGAHVEFARGVQNPIGLKCGPTTTAEDLKVLMEKLNPENEAGRLTLIARFGAGSVGDHLPRLIKAVQEEGANVLWTCDAMHGNTIKSSTGYKTRPFESVLREVREFFAVHQAEGTIPGGVHFEMTGQDVTECTGGVRAVSEEDLSARYHTACDPRLNASQSLELAFLVAEELSARRNSQNGQQQAV
>NZ_CP022415.1|WP_089420279.1|1569667_1570672_+|GlxA-family-transcriptional-regulator
MSQTRTSAIRPDQPDKPQRYVFVLLNNFTLLCFSAAVESLRIANRMAGRDLYEWKIVGEGGDTAVCSAGTAFKLDGDLDELNRDDTVMVCGGIDVQDATTKRLLNWLRREARKGLRVAGLCTAAYSLARAGLLDGKKATIHWENQDSFAEEFEEVNLTKSVFVVDGLRITTAGGTSSIDLMLKLIADSHGEDLANAVADQLIYSSIRTDQDTQRLSVPTRIGVRHPKLSQVIQIMESHIEEPISPSILAKDVGMSTRQLERLFRRYLSRSPKRYYMELRLQKARNLLMQTDMSVINVALACGFASPSHFSKCYRAHYDTTPYRERGSHAARLSI
>NZ_CP022415.1|WP_089422216.1|1570672_1571788_-|PQQ-dependent-sugar-dehydrogenase
MMRLFVILLLVWGLGPVFCPPPAQAQQTSAGQVSFTVQVDGLDTPWAFAFLPDGGVLITERDGKLLHVAADGTRNAVSGVPDVAANGQGGLLDITLPRDFDISGMVFLTYAKAQAGGGAGTALASGTLSADGQSLGDVKLLFEMKPGNRGGVHFGSRVVEGADGTLFVTVGERGQRPLAQDLNQHNGKVVRVGRDGSVPADNPFVGQAGALPEIWSYGHRNPQGAALDAKGRLWVVEHGARGGDEVNLIGKGANYGWPVISYGRHYSGGRIGEGTSKDGMQQPAHYWDPSIAPSGMMIYDGSMFPEWQGDMFVGALKLNYISRLQIDSNTASEVEKITAPQTARVRDIQTAPDGSIWFLSVVDGALYRMAR
>NZ_CP022415.1|WP_089420280.1|1571971_1573168_+|ABC-transporter-substrate-binding-protein
MKKFLMATAATALMTGAAFADAHAKEVKIGVILGFTGPLESITPAMGAGAELAMAEVSESGALLDGAKVTSIRGDSTCIDAGAATSAAERLITSDKVSAIMGADCSGVTGAILQNAARPNGVVMISPSATSPGLSTAEDDGLFFRTAPSDARQGVIMTEILQDRGVNEVALTYTNNDYGKGLADAFQAAFEEAGGTVTISTSHEDGKADYSAEVGALASAGGEVLVVAGYVDQGGSGVIRAALDTGAFDTFYVPDGMVGEKLNENFGAEMNGSFGAYPGTDSEGAALFVELAKEAGFDGTGAFAPESYDAAALIMLSMQAAGSMDSADFKEHVIDVANAPGEKIYPGELAKALELIKNGQEVDYEGASAVELIGPGESAGNYQEIEFADGVYSTIKYR
>NZ_CP022415.1|WP_089420281.1|1573273_1574056_+|ABC-transporter-ATP-binding-protein
MIVVDDIHKHFGGFHAVDGASLSITPGSITGLIGPNGAGKTTLFNVIAGVLKPTSGRVTMNGEDITGLPPHTLFHKGLLRTFQIAHEFSSMTCRENLMMVPGNQSGETLWNTWFGRKRIADEERALRAKADEVLEFLTVEHLADHKAGQVSGGQKKLLELGRTMMVDAKIVFLDEVGAGVNRTLLNTIGDAILRLNKERNYTFVVIEHDMDFIGKICDPVICMAEGKVLAQGTLDEIKANEQVIEAYLGTGLKNKEQVGA
>NZ_CP022415.1|WP_089420282.1|1574052_1574877_+|ABC-transporter-ATP-binding-protein
MSGNPYNDGRGNKDASIANPKGVGTLTAHPGTGAAMNTRNAFLIGDSMTGGYGNGPDILHDCTVAVDAGEIAVIVGPNGAGKSTAMKAVFGMLNVRKGSVHLDGEDITDLSPQDRVAKGMGFVPQTSNIFTSMTVEENLEMGAFIRRDDFRDTMAQVYDLFPILKEKRRQAAGELSGGQRQQVAVGRALMTRPKVLMLDEPTAGVSPIVMDELFDRIIEVARTGIPILMVEQNARQALEIADKGYVLVQGRNAFSGTGKELLADPEVRKSFLGG
>NZ_CP022415.1|WP_089420283.1|1574945_1575956_+|branched-chain-amino-acid-ABC-transporter-permease
MDLLNAFVALSNFVLIPAIAYGSQLALGALGVTLIYGILRFSNFAHGDTMAFGTMVTVLFTWLFQSWGVSLGPLPTALLALPFGILGCMALLLFTDRVVYKFYRAQKAKPVILVIVSLGVMFIMNGLVRFIIGPDDQRFSDGERFIVSVRTFKEMTGLEEGVAIKTTQGITVITAVIVVAALFWFLNRTRTGKSMRAYSDNEDLALLSGINPERVVMITWLIVAALATVAGVLYGLDKSFKPFTYFQLLLPIFASAIVGGLGSPLGAIAGGFTIAFSEVMVTYAWKKVAGYALPDSLAPDSLAQLLSTDYKFAVSFVILLIVLLFRPTGLFAGKSV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	626222-626249	5	0.821
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	477208-477235	5	0.821
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1376882-1376909	5	0.821
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	30470-30497	5	0.821
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	319203-319230	5	0.821
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1484775-1484802	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1489443-1489470	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1821284-1821311	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	317895-317922	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1551607-1551634	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	580783-580810	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1229784-1229811	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	236748-236775	6	0.786
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NC_012529	Deinococcus deserti VCD115 plasmid 2, complete sequence	261954-261981	7	0.75
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	KR052482	Sinorhizobium phage phiN3, complete genome	22780-22807	7	0.75
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	248037-248064	7	0.75
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	278737-278764	7	0.75
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	296687-296714	7	0.75
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	239610-239637	7	0.75
NZ_CP022415_1	1.1\|1565230\|31\|NZ_CP022415\|CRISPRCasFinder	1565230-1565260	31	NZ_CP020717	Cnuibacter physcomitrellae strain XA(T) plasmid unnamed2, complete sequence	50308-50338	8	0.742
NZ_CP022415_1	1.2\|1565284\|28\|NZ_CP022415\|CRISPRCasFinder	1565284-1565311	28	HQ634174	Cyanophage MED4-213, complete genome	89722-89749	8	0.714
NZ_CP022415_1	1.1\|1565230\|31\|NZ_CP022415\|CRISPRCasFinder	1565230-1565260	31	MN369765	Microbacterium phage Zanella, complete genome	11744-11774	9	0.71
NZ_CP022415_1	1.1\|1565230\|31\|NZ_CP022415\|CRISPRCasFinder	1565230-1565260	31	MT553337	Mycobacterium phage DroogsArmy, complete genome	39200-39230	10	0.677
NZ_CP022415_1	1.1\|1565230\|31\|NZ_CP022415\|CRISPRCasFinder	1565230-1565260	31	JF957060	Mycobacterium phage Timshel, complete genome	39260-39290	10	0.677

1. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggtgcagccatgcagcatgacc----ttgtga	CRISPR spacer
ggtgcagccatgcagcatgaccagcatc----	Protospacer
**********************    *.

2. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatcaccacgagg	Protospacer
****************** *** .* *.

3. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
cgtgcagccatgcagcatgacgatgagc	Protospacer
 ********************  ** *

4. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatagcctgatgc	Protospacer
******************..*** .**

5. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 5, identity: 0.821

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
gctgcagccatgcggcatcaccttgcgg	Protospacer
* ***********.**** ******.*.

6. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
cgtgcagccatgcagcatgaccaccagc	Protospacer
 ********************* .  *

7. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
cgtgcagccatgcagcatgaccaccagc	Protospacer
 ********************* .  *

8. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccgtgcagcatgaccaccagg	Protospacer
*********.************ .  *.

9. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatcaccaccagc	Protospacer
****************** *** .  *

10. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatcaccaccagc	Protospacer
****************** *** .  *

11. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatcaccaccagc	Protospacer
****************** *** .  *

12. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
cgtgcagccatgcagcatgacgaggagc	Protospacer
 ********************   * *

13. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 6, identity: 0.786

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcatcaccaccagc	Protospacer
****************** *** .  *

14. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NC_012529 (Deinococcus deserti VCD115 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
cttgcagccatgcagcatgaccatcacg	Protospacer
  ******************** *   .

15. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to KR052482 (Sinorhizobium phage phiN3, complete genome) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
atgccagccatgccgcatgaccttgttg	Protospacer
.   ********* ************ .

16. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcacgacgaccagc	Protospacer
*****************.***  .  *

17. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcacgacgaccagc	Protospacer
*****************.***  .  *

18. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcacgacgaccagc	Protospacer
*****************.***  .  *

19. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 7, identity: 0.75

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
ggtgcagccatgcagcacgacgaccagc	Protospacer
*****************.***  .  *

20. spacer 1.1|1565230|31|NZ_CP022415|CRISPRCasFinder matches to NZ_CP020717 (Cnuibacter physcomitrellae strain XA(T) plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

tttggccccgttcagcacggtggcccccatg	CRISPR spacer
cgtggcccctttcagctcggtggccgacgcg	Protospacer
. ******* ****** ********  *..*

21. spacer 1.2|1565284|28|NZ_CP022415|CRISPRCasFinder matches to HQ634174 (Cyanophage MED4-213, complete genome) position: , mismatch: 8, identity: 0.714

ggtgcagccatgcagcatgaccttgtga	CRISPR spacer
taattgtccatgcagcattaccttgtga	Protospacer
 .  .. *********** *********

22. spacer 1.1|1565230|31|NZ_CP022415|CRISPRCasFinder matches to MN369765 (Microbacterium phage Zanella, complete genome) position: , mismatch: 9, identity: 0.71

tttggccccgttcagcacggtggcccccatg	CRISPR spacer
gatcgccccgttcagcccggaggccccgtac	Protospacer
  * ************ *** ******

23. spacer 1.1|1565230|31|NZ_CP022415|CRISPRCasFinder matches to MT553337 (Mycobacterium phage DroogsArmy, complete genome) position: , mismatch: 10, identity: 0.677

tttggccccgttcagcacggtggcccccatg	CRISPR spacer
cttgacaccgttcagcacggtggcagaggac	Protospacer
.***.* *****************    .

24. spacer 1.1|1565230|31|NZ_CP022415|CRISPRCasFinder matches to JF957060 (Mycobacterium phage Timshel, complete genome) position: , mismatch: 10, identity: 0.677

tttggccccgttcagcacggtggcccccatg	CRISPR spacer
cttgacaccgttcagcacggtggcagaggac	Protospacer
.***.* *****************    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

685573 : 743347

Catovirus(25.0%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089419534.1\|685573_687097_+\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	3.4e-18	23.4
WP_089419535.1\|687184_688366_+\|holin	choline transporter	NA	NA	NA	NA
WP_089419536.1\|688437_689892_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_089419537.1\|689891_691538_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	3.9e-60	31.9
WP_089419538.1\|691592_692267_+	thermonuclease family protein	NA	NA	NA	NA
WP_089419539.1\|692263_693664_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089419540.1\|693712_694942_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	2.2e-23	26.5
WP_089422109.1\|695133_696666_+	acyl-CoA carboxylase subunit beta	NA	NA	NA	NA
WP_089419541.1\|696720_696981_+	Rho termination factor	NA	NA	NA	NA
WP_089422110.1\|697000_697387_+	hypothetical protein	NA	NA	NA	NA
WP_089419542.1\|697811_698168_+	hypothetical protein	NA	NA	NA	NA
WP_089419543.1\|698490_698697_+	hypothetical protein	NA	NA	NA	NA
WP_089419544.1\|698838_700887_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_089419545.1\|700940_701390_-	DUF4174 domain-containing protein	NA	NA	NA	NA
WP_157728962.1\|701489_702527_+	hypothetical protein	NA	NA	NA	NA
WP_089419547.1\|702468_704613_+	methylmalonyl-CoA mutase	NA	NA	NA	NA
WP_089422111.1\|704666_705290_+	VOC family protein	NA	NA	NA	NA
WP_089419548.1\|705286_705772_+	N-acetyltransferase	NA	NA	NA	NA
WP_089419549.1\|705803_706496_+	molecular chaperone DjiA	NA	NA	NA	NA
WP_089419550.1\|706495_707524_+	endonuclease	NA	NA	NA	NA
WP_089419551.1\|707566_707923_+	hypothetical protein	NA	NA	NA	NA
WP_089419552.1\|707959_709546_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_089419553.1\|709621_711790_-	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_089419554.1\|711913_712588_-	chromosomal replication initiator DnaA	NA	NA	NA	NA
WP_089419555.1\|712591_713698_-	AI-2E family transporter	NA	NA	NA	NA
WP_089419556.1\|713774_715136_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_089419557.1\|715255_716512_+	peptidase T	NA	NA	NA	NA
WP_089422112.1\|716784_718122_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_089419558.1\|718172_718661_+	DUF2937 family protein	NA	NA	NA	NA
WP_089419559.1\|718712_719999_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_089419560.1\|719991_720672_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.6e-13	28.1
WP_089419561.1\|720767_721340_+	hypothetical protein	NA	NA	NA	NA
WP_089419562.1\|721572_722508_+\|transposase	transposase	Q75QL1	Wolbachia_phage	3.1e-22	30.4
WP_089419563.1\|722545_723229_-	hypothetical protein	NA	NA	NA	NA
WP_089419564.1\|723286_723787_-	PhnA protein	NA	NA	NA	NA
WP_089419565.1\|723896_724307_-	PaaI family thioesterase	NA	NA	NA	NA
WP_089419566.1\|724694_726650_-	type IIA DNA topoisomerase subunit B	G3M9Z3	Bacillus_virus	8.1e-105	37.4
WP_089422113.1\|726765_727170_-	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_089419567.1\|727673_728285_+	sulfotransferase family 2 domain-containing protein	NA	NA	NA	NA
WP_089419568.1\|728388_728940_-	2OG-Fe(II) oxygenase	A0A1V0S983	Catovirus	4.0e-25	37.5
WP_089419569.1\|729114_729417_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_089419570.1\|729485_730367_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_089419571.1\|730363_731656_-	dienelactone hydrolase	NA	NA	NA	NA
WP_089419572.1\|732102_733167_+	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_089422114.1\|733322_734669_+	MATE family efflux transporter	NA	NA	NA	NA
WP_089419573.1\|734665_735067_-	hypothetical protein	NA	NA	NA	NA
WP_089422115.1\|736250_737276_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089419574.1\|739373_739772_-	tautomerase family protein	NA	NA	NA	NA
WP_089419575.1\|739843_740776_-	DMT family transporter	NA	NA	NA	NA
WP_089422116.1\|740875_741322_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_089419576.1\|742318_743347_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.2e-17	30.0

DBSCAN-SWA_2

1217849 : 1271038

Streptococcus_phage(25.0%)

tRNA,protease,transposase,integrase

attL 1227121:1227168|attR 1258162:1258209

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089419972.1\|1217849_1218977_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.7e-100	54.0
WP_089419973.1\|1219484_1221890_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	6.7e-202	48.7
WP_089419974.1\|1222130_1222583_+	hypothetical protein	NA	NA	NA	NA
WP_089419975.1\|1222862_1224023_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.2e-43	33.4
WP_089419976.1\|1224296_1225076_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_089419977.1\|1225098_1226379_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.0e-83	43.6
WP_089419978.1\|1226475_1227048_+	histidine phosphatase family protein	NA	NA	NA	NA
1227121:1227168	attL	NA	NA	NA	NA
WP_089419979.1\|1227234_1228338_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_089419980.1\|1228327_1228555_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157728969.1\|1228797_1229043_-	hypothetical protein	NA	NA	NA	NA
WP_157728970.1\|1229294_1230035_-	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_157728971.1\|1230117_1230327_+	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	1.0e-05	39.3
WP_089419984.1\|1230567_1231899_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_157728972.1\|1232074_1232881_+	hypothetical protein	NA	NA	NA	NA
WP_157728973.1\|1233011_1233305_-	hypothetical protein	NA	NA	NA	NA
WP_089419986.1\|1233332_1234718_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_089419987.1\|1234934_1235954_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089419164.1\|1236870_1237899_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.3e-16	28.8
WP_089419988.1\|1238154_1239195_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_089419989.1\|1239520_1241011_-	C4-dicarboxylate ABC transporter permease	NA	NA	NA	NA
WP_089419990.1\|1241012_1241462_-	hypothetical protein	NA	NA	NA	NA
WP_089419991.1\|1241465_1242416_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_089419992.1\|1242442_1243174_-	GntR family transcriptional regulator	A0A2H5BLU5	Streptomyces_phage	2.1e-05	38.7
WP_089419993.1\|1243255_1244032_+	amidohydrolase family protein	NA	NA	NA	NA
WP_089419994.1\|1244767_1246396_-	AMP-binding protein	NA	NA	NA	NA
WP_089422180.1\|1246403_1247153_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_089419995.1\|1247163_1248855_-	methylmalonyl-CoA mutase	NA	NA	NA	NA
WP_089419996.1\|1248851_1249853_-	methylmalonyl Co-A mutase-associated GTPase MeaB	NA	NA	NA	NA
WP_089419997.1\|1249849_1250317_-	cobalamin B12-binding domain-containing protein	NA	NA	NA	NA
WP_089419998.1\|1250328_1251666_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_089419999.1\|1251762_1252620_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_089420000.1\|1253306_1254110_-	hypothetical protein	H8ZJI7	Ostreococcus_tauri_virus	3.4e-17	29.3
WP_089420001.1\|1254630_1255047_+	hypothetical protein	NA	NA	NA	NA
WP_089420002.1\|1255321_1256281_+	hypothetical protein	NA	NA	NA	NA
WP_157728974.1\|1256833_1257298_-	hypothetical protein	NA	NA	NA	NA
WP_089420004.1\|1257328_1257985_-	hypothetical protein	NA	NA	NA	NA
WP_089420005.1\|1258786_1259722_+	pirin family protein	NA	NA	NA	NA
1258162:1258209	attR	NA	NA	NA	NA
WP_089420006.1\|1260020_1260713_-	hypothetical protein	NA	NA	NA	NA
WP_089420007.1\|1260907_1261783_+	hypothetical protein	NA	NA	NA	NA
WP_089420008.1\|1261779_1262667_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_089420009.1\|1262794_1264168_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_089420010.1\|1264225_1264561_-	hypothetical protein	NA	NA	NA	NA
WP_089422181.1\|1264925_1266161_+	5-aminolevulinate synthase	NA	NA	NA	NA
WP_089420011.1\|1266277_1267498_+	DUF4115 domain-containing protein	NA	NA	NA	NA
WP_089420012.1\|1267609_1268734_+	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_089420013.1\|1268923_1269673_-	DsbA family protein	NA	NA	NA	NA
WP_089420014.1\|1269676_1271038_-\|protease	M48 family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

2070095 : 2078550

Rhizobium_phage(100.0%)

head,terminase,portal,capsid,protease,integrase

attL 2059206:2059220|attR 2084719:2084733

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2059206:2059220	attL	NA	NA	NA	NA
WP_089420686.1\|2070095_2071166_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_089420687.1\|2071162_2071345_-	hypothetical protein	NA	NA	NA	NA
WP_089420688.1\|2071355_2071850_-	hypothetical protein	NA	NA	NA	NA
WP_089420689.1\|2071951_2072320_-	hypothetical protein	NA	NA	NA	NA
WP_089420690.1\|2072444_2072657_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089420691.1\|2072649_2073147_+	hypothetical protein	NA	NA	NA	NA
WP_089420692.1\|2073258_2074323_-\|portal	phage portal protein	NA	NA	NA	NA
WP_089420693.1\|2074325_2074904_-\|head,protease	HK97 family phage prohead protease	NA	NA	NA	NA
WP_089420694.1\|2074903_2076175_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_089420695.1\|2076167_2076518_-	HNH endonuclease	NA	NA	NA	NA
WP_089420696.1\|2076514_2076856_-\|head	phage head closure protein	NA	NA	NA	NA
WP_089420697.1\|2076846_2078550_-\|terminase	terminase	B4UTP0	Rhizobium_phage	3.1e-28	28.9
2084719:2084733	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022418

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP022420

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP022417

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. NZ_CP022415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection