CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	0 crisprs	csa3,cas14j,Cas14u_CAS-V,RT	0	0	4
NZ_CP022447	Bacillus cereus C1L plasmid pC1L69, complete sequence	0 crisprs	NA	0	0	0
NZ_CP022445	Bacillus cereus C1L chromosome, complete genome	3 crisprs	cas3,csa3,WYL,c2c9_V-U4,DinG,RT,DEDDh	17	9	6
NZ_CP022448	Bacillus cereus C1L plasmid pC1L8, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

147121 : 165491

Bacillus_phage(33.33%)

holin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089607872.1\|147121_148234_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.8e-80	48.4
WP_016078303.1\|148245_148644_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.2e-50	68.2
WP_025687304.1\|149915_151517_-	SH3 domain-containing protein	A0A1J0MS59	Bacillus_phage	5.0e-44	54.9
WP_074642552.1\|152095_152965_-	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_089607873.1\|153060_153642_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157797771.1\|154109_156839_-	EAL domain-containing protein	NA	NA	NA	NA
WP_157797772.1\|158261_159920_+	peptidase M4 family protein	NA	NA	NA	NA
WP_015406545.1\|160388_160790_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	2.0e-50	71.2
WP_089607877.1\|160795_161875_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	1.7e-19	31.8
WP_025688697.1\|163069_163462_+	thiol-disulfide oxidoreductase DCC family protein	NA	NA	NA	NA
WP_142292996.1\|163534_163693_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_089608129.1\|164369_165491_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.7e-171	80.7

DBSCAN-SWA_2

373039 : 381309

Bacillus_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089607957.1\|373039_374095_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	4.9e-149	70.7
WP_025686992.1\|374091_374331_-	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	2.7e-26	77.2
WP_000377824.1\|374330_374567_-	hypothetical protein	A0A288WG97	Bacillus_phage	3.9e-14	88.6
WP_025686993.1\|375272_376157_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	4.2e-77	52.4
WP_001051379.1\|376429_377251_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	4.9e-27	43.8
WP_089607958.1\|377392_378361_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.7e-31	41.7
WP_000460733.1\|378598_378985_-	hypothetical protein	A0A288WG73	Bacillus_phage	2.6e-47	69.8
WP_000510881.1\|379087_379984_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	4.3e-77	63.8
WP_000527101.1\|380056_380293_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	9.7e-13	60.0
WP_000579788.1\|380429_380858_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	9.3e-30	51.4
WP_025689473.1\|380880_381309_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.1e-34	54.4

DBSCAN-SWA_3

499609 : 536027

Bacillus_phage(58.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001098040.1\|499609_500497_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000935869.1\|501018_501354_+	hypothetical protein	NA	NA	NA	NA
WP_001233534.1\|501420_501771_+	PrgI family protein	NA	NA	NA	NA
WP_000892006.1\|501771_502686_+	hypothetical protein	NA	NA	NA	NA
WP_089608002.1\|502688_504788_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_089608003.1\|504817_508852_+	hypothetical protein	NA	NA	NA	NA
WP_089608005.1\|510725_512549_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.6e-24	34.3
WP_089608006.1\|512732_513578_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	5.7e-15	37.5
WP_089608007.1\|513594_514170_+	hypothetical protein	NA	NA	NA	NA
WP_089608008.1\|514331_514715_+	hypothetical protein	NA	NA	NA	NA
WP_089608009.1\|514705_515011_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_089608010.1\|515415_515835_-	FosB/FosD family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	1.0e-60	93.7
WP_089608011.1\|516501_517185_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_089608012.1\|517390_517792_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.2e-50	72.0
WP_089608014.1\|519335_519515_+	hypothetical protein	NA	NA	NA	NA
WP_089608015.1\|519680_521111_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_088118919.1\|521220_522382_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.9e-39	40.1
WP_089608016.1\|522521_523289_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_089608017.1\|523263_524190_-	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_089608018.1\|525215_525416_+	hypothetical protein	NA	NA	NA	NA
WP_065230122.1\|526310_526589_+	hypothetical protein	A0A1B1P8A6	Bacillus_phage	3.9e-13	46.8
WP_089608020.1\|526597_526744_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_089608021.1\|526727_526922_+	hypothetical protein	A0A1B1P7U9	Bacillus_phage	5.3e-17	68.8
WP_089608022.1\|527176_527509_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1Q1PVV9	Staphylococcus_phage	5.9e-24	49.1
WP_089608023.1\|528183_529164_+	site-specific DNA-methyltransferase	A0A2H4JD00	uncultured_Caudovirales_phage	2.5e-115	60.6
WP_088020555.1\|529827_530196_+	DUF3888 domain-containing protein	NA	NA	NA	NA
WP_089608024.1\|530491_530680_-	hypothetical protein	A0A288WGN0	Bacillus_phage	8.8e-09	64.8
WP_088020556.1\|530791_531421_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	2.2e-48	60.1
WP_089608025.1\|531559_531946_+	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	7.6e-23	44.8
WP_089608026.1\|532006_532345_-	hypothetical protein	NA	NA	NA	NA
WP_089608027.1\|533402_533675_+	hypothetical protein	NA	NA	NA	NA
WP_065230133.1\|533755_533962_-	hypothetical protein	NA	NA	NA	NA
WP_000376551.1\|534251_534389_-	DUF3956 domain-containing protein	NA	NA	NA	NA
WP_089608028.1\|534596_536027_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

568092 : 574728

Bacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016078507.1\|568092_569211_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.6e-172	81.2
WP_001161905.1\|569750_570125_-	hypothetical protein	D2XQ01	Bacillus_virus	1.2e-28	51.3
WP_001057821.1\|570172_570514_-	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	3.2e-09	30.4
WP_089608045.1\|570510_571776_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.1e-102	46.7
WP_130067921.1\|572616_572757_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_001281107.1\|572888_573584_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	1.3e-36	37.7
WP_000791890.1\|573573_574728_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.7e-17	25.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022445

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022445_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022445_1

2581139-2581431

Orphan

Consensus_repeat	Method
CCAACAGGAATGGTAGCGATAACTGCATTGGTAGCAGTATTAATAACAGAAACAGTATTGCT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP022445_1

>merge|NZ_CP022445|1|2581139-2581431|PILER-CR
ATAACTGCATTGGTAGCGGTGTTAATAACAGAAACAGTATTGCTGTTTTGATTTGTGACATAAGCACGAGTACCATCTAGTGTGAAGACGATTATTCTAGGACGAATACCGACAGGAATGGTAGCGATAACTGCATTGGTAGCAGTATTAATAACAGAAATTGTGTTGCTTAATTCGTTTGCAACATATGCAAAGGTCCCATTTGGTGAAACAGTGATTCCTTGTGGAGCGAGGCCAACAGGAATGGTAGCGATAACTGCATTGGTAGCTGCATTAATAACAGAAACAGTATT

>NZ_CP022445|1|1|2581139-2581431|PILER-CR
ATAACTGCATTGGTAGCGGTGTTAATAACAGAAACAGTATTGCTGTTTTGATTTGTGACATAA	GCACGAGTACCATCTAGTGTGAAGACGATTATTCTAGGACGAATACCGACAGGAATGGTAGCGA
TAACTGCATTGGTAGCAGTATTAATAACAGAAATTGTGTTGCTTAATTCGTTTGCAACATATG	CAAAGGTCCCATTTGGTGAAACAGTGATTCCTTGTGGAGCGAGGCCAACAGGAATGGTAGCGAT
AACTGCATTGGTAGCTGCATTAATAACAGAAACAGTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022445.1\|WP_089607520.1\|2572940_2574128_+\|UDP-glucosyltransferase	unknown	unknown	gnl\|CDD\|273616
NZ_CP022445.1\|WP_025687414.1\|2583077_2583485_-\|DUF4870-domain-containing-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_000864372.1\|2574218_2574899_-\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|224707
NZ_CP022445.1\|WP_025687416.1\|2578697_2579966_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|236901
NZ_CP022445.1\|WP_025687419.1\|2572151_2572682_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP022445.1\|WP_025687471.1\|2592199_2593189_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176227
NZ_CP022445.1\|WP_002164530.1\|2585604_2585817_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_001097547.1\|2580185_2580344_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_025689464.1\|2590519_2591401_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|223589
NZ_CP022445.1\|WP_001038210.1\|2575308_2575857_+\|ECF-type-riboflavin-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|184218
NZ_CP022445.1\|WP_000556372.1\|2577560_2578361_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
NZ_CP022445.1\|WP_025689467.1\|2588272_2588674_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240033
NZ_CP022445.1\|WP_000754941.1\|2580362_2580512_+\|DUF3954-domain-containing-protein	unknown	unknown	gnl\|CDD\|315731
NZ_CP022445.1\|WP_001170283.1\|2588824_2589775_+\|nucleoside-hydrolase	unknown	unknown	gnl\|CDD\|238257
NZ_CP022445.1\|WP_000120182.1\|2578497_2578605_+\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_000450247.1\|2587098_2587479_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_001109242.1\|2583786_2584251_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_025687417.1\|2575867_2577568_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213192
NZ_CP022445.1\|WP_089607522.1\|2590251_2590413_-\|cell-wall-anchor-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_000682204.1\|2586386_2586683_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022445.1\|WP_089607520.1\|2572940_2574128_+\|UDP-glucosyltransferase	gnl\|CDD\|273616	TIGR01426, Glycosyl_transferase, glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance].	8.38478e-91
NZ_CP022445.1\|WP_025689467.1\|2588272_2588674_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.20831e-49
NZ_CP022445.1\|WP_000864372.1\|2574218_2574899_-\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|224707	COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane].	5.42243e-90
NZ_CP022445.1\|WP_025687416.1\|2578697_2579966_-\|histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	1.00561e-42
NZ_CP022445.1\|WP_025687417.1\|2575867_2577568_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	8.91446e-87
NZ_CP022445.1\|WP_025687471.1\|2592199_2593189_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176227	cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	3.68326e-98
NZ_CP022445.1\|WP_025689464.1\|2590519_2591401_-\|serine/threonine-protein-kinase	gnl\|CDD\|223589	COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair].	7.93223e-08
NZ_CP022445.1\|WP_001038210.1\|2575308_2575857_+\|ECF-type-riboflavin-transporter-substrate-binding-protein	gnl\|CDD\|184218	PRK13661, PRK13661, ECF-type riboflavin transporter substrate-binding protein.	9.145e-62
NZ_CP022445.1\|WP_000556372.1\|2577560_2578361_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	1.49098e-32
NZ_CP022445.1\|WP_001170283.1\|2588824_2589775_+\|nucleoside-hydrolase	gnl\|CDD\|238257	cd00455, nuc_hydro, nuc_hydro: Nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains eukaryotic, bacterial and archeal proteins similar to the inosine-uridine preferring nucleoside hydrolase from Crithidia fasciculata, the xanthosine-inosine-uridine-adenosine-preferring nucleoside hydrolase RihC from Salmonella enterica serovar Typhimurium, the purine-specific inosine-adenosine-guanosine-preferring nucleoside hydrolase from Trypanosoma vivax and, pyrimidine-specific uridine-cytidine preferring nucleoside hydrolases such as URH1 from Saccharomyces cerevisiae, RihA and RihB from Escherichia coli. Nucleoside hydrolases are of interest as a target for antiprotozoan drugs as, no nucleoside hydrolase activity or genes encoding these enzymes have been detected in humans and, parasitic protozoans lack de novo purine synthesis relying on nucleoside hydrolase to scavenge purine and/or pyrimidines from the environment. .	1.10015e-117
NZ_CP022445.1\|WP_000754941.1\|2580362_2580512_+\|DUF3954-domain-containing-protein	gnl\|CDD\|315731	pfam13128, DUF3954, Protein of unknown function (DUF3954). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 60 amino acids in length.	2.34058e-12
NZ_CP022445.1\|WP_025687419.1\|2572151_2572682_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	1.08926e-51

>NZ_CP022445.1|WP_000754941.1|2580362_2580512_+|DUF3954-domain-containing-protein
MKKVEIDVGSNKLLIVKGGNVTVVNPPMSGFGEQVAVWINGKVDRVDVK
>NZ_CP022445.1|WP_001097547.1|2580185_2580344_+|hypothetical-protein
MNTRRFQRVVDKFSNWDTAEELCKAVRDKKEIIPVRVYLGSGFKTDVVEYMR
>NZ_CP022445.1|WP_025687416.1|2578697_2579966_-|histidine-kinase
MDFVYINQNVLNNLLYILCSIFVFYFIYDSRHYLKKYKILLITLCSSIPLILCMRYPIYMDESCIHDLRQIPVIIATLYGGFPVGIILFTILLITRFIFYGFNMLTVVVYGIMFIVTALASSKFNTYNRKLKVAFSMFLTFFLAIFTTLIVLTLSDFEVNNLYIIYFMVLPTTLMLFIVYINEVIKDAVLMRSKLIKMEKMEIVSQLAASISHEVRNPLTVVKGFTQLLKTQNLTPESRDEYIKHILEELNRAQEIIDDYLTFAKPAPEKLDQISVKQELNRVINMILPLCNMNTIHITQDFSEATIVGNKQHFQQCFLNLIKNSIEAMPNGGTLNISSSINNSKVEIRIEDSGVGMSQEQIHRFGEPYFSTKTKGTGLGTMVAVKIIETMHGSLKIRSIVSNGTTLTITFPKYSENTHLNK
>NZ_CP022445.1|WP_000120182.1|2578497_2578605_+|YjcZ-family-sporulation-protein
MSYGGSCGFGGGFALLVVLFILLIIVGCSCWGGGY
>NZ_CP022445.1|WP_000556372.1|2577560_2578361_+|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MHSTYFHRMDGVVKLFLFIFCMTLTFLFFDFRVLLILFIIGCIGLSIAKIPFRKILIVFSVIFTFSLLNSVMILFITPTHGSELTESYTAFLHVGYATITYETLFYAATLSLKYFTLLPFTLLFIYTTDPSEFVSSLSKLGIHYKITYAINIALRYIPDIQSEYKIIKHAQEARGVAFEKGEASLWVRMKNRVLIFWPLIIHSLERIDTVSNAMDLRGFGKKDKRTWFYTSKAKREDFIALFAGIFIFIVAVYLKLNVFQNFWYPF
>NZ_CP022445.1|WP_025687417.1|2575867_2577568_+|ABC-transporter-ATP-binding-protein
MQPIISFEQFTFQYGHAAQPTLSDITFHIYPGEKVLIAGRSGSGKSTLAHCINGLIPFSYEGNSTGNVLIAGKDSREGSIFEQSKQVGTILQDQDAQFIGLTVEEDVAFYLENECVKQDNMKKIVSDSLRKVKMHTFHKQSPHELSGGQKQTVSLAGLLTTNADILLFDEPLANLDPLSAIHTIELMKDIHEQYNKTIVIIEHRIEEILKLDLDKVILIDEGKVIAMGTPKEILASNILPRIGLREPIYIEALKRLHFDRNNDVIYPMENLQKEKVSNVIKEWMEKQVILERNAKNKELLKVENLSFSYPNKQKVLENVNLLIYEGEIVALLGHNGAGKSTLAHSLIGINKMKNGKIALKGEDISSWSIRKRGEIISYVMQNPNHMITQPTVFEEVSFTLTLHNFSKEEIKNKVEGILKICGLYPFRNWPIQALSYGQKKRLTIASVLTTNPKLIILDEPTAGQDYYHYKQFMSFIKNLAKKGISFVVITHDMNLALEYTDRAVVLHEGEIIADNTVFDVLGDQETLQRANLRESSLTKLIKFSGIACPEKFMELYLDSNRREEGA
>NZ_CP022445.1|WP_001038210.1|2575308_2575857_+|ECF-type-riboflavin-transporter-substrate-binding-protein
MNKLSTKLVVAIGIGAALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLIGHTVTDTIAGWGIWWGWVISSGIIGFSMGLIQKRVGFSVKNGSFNKGDISYLAITGLVGIVIAIIFAGAFDIIVMGEPFDKIVIQVLGATISDVIVFLVLGLPLTIGLAKSNKKHTHLKIEK
>NZ_CP022445.1|WP_000864372.1|2574218_2574899_-|aspartate/glutamate-racemase-family-protein
MKVIGLIGGLSWESTSLYYKHINTLTLSQYDQNAKLILYSMDFGEVTTLLQNHQYEEVKNELVTVAKKVEKSGAECLLMCSNTVHLFAEEVEQAISIPLLHIGDVSAKEMVEQNIKRIGLLGTKQTMEQDFYKSRLAKYNIETIIPNDEERTFIHHVILDELSRGIISETSKKRLLQITKSLIQNGAEGILLGCTEIPLLISQNDLTVPVFDTAFLHANTAVQFAG
>NZ_CP022445.1|WP_089607520.1|2572940_2574128_+|UDP-glucosyltransferase
MLNILVVNFPAEGHVNPTLNLVKAFTERGDNVHYITTANFKDRIEDLGATVHTHPDLLKEISIDAETSSGLNAFFHVHVQTSLYILEITKQLYESINFDFVIYDIFGAGELVKEYLQVPGVVSSPIFLIPPEFLKTLPFHPNADMPFQPEEISEKLLNQMEHKFGVKPKNNLQFMNNKGDVCLVYTSPYFQPNSESFGENNIFIGPSISKRKTNIKFPLESLKEKKVIYISMGTLLEGLEPFFNTCIDTFSDFDGIVVMAIGDRNDISKIKEAPDNFIIAPYVPQSEILNEADVFITHGGMNSVHDAIHYNVPFVIIPHDKDQPMIARRLTELEAAHRLLKEHVNVHTLKEAVTDVLSNEKYKYGIRKLNDSFLECGGSKEAIAVIESLLNKVKL
>NZ_CP022445.1|WP_025687419.1|2572151_2572682_+|signal-peptidase-I
MKLFILKYWRNICSYIFIIIGVIFINKSFLFCMVEGISMQPTLNEKDYILVNKVNVCLSSFHHGDVVIIKKEDEPTYYVKRIIGLSGDNIQLKEDEVFINSKKRDESYIHLDMSQVSNRFSNFREIKVPTHKLFVLGDNRNHSKDSRNTLGLIDESNIIGKVEMVFYPFDHIKWIK
>NZ_CP022445.1|WP_025687414.1|2583077_2583485_-|DUF4870-domain-containing-protein
MILTQEKNIKLIMHFLTLLSFFILIFFSVTIFYIPLVFYFVCKSQNIQKNILEAVFYQLFIWIITVIWNLFIIRILMLFWSNLDLASNNTLIIFGVAPLYLILFLLLIFGPIKGILYVLQEKNFHYPIISKWINK
>NZ_CP022445.1|WP_001109242.1|2583786_2584251_-|hypothetical-protein
MNYQNDNNSNIHKPCSCPSPTANSLNVVQTTPSIVSVNSAIPLDTVVNSNGTAISFTPPTTVLLEGGRTYLAIYEVQVIIQPGGNSAGITMYLNNNPIIGSGTSLGYTAGFTSVSAPAIFTTPPGITSTLTVNVGPYSNTLNTLGLTLAVVALT
>NZ_CP022445.1|WP_002164530.1|2585604_2585817_+|hypothetical-protein
MEVQLIHEQTYKSQYDLENAVEKFYDSLPEEFGMLEDEDIKKFDHISGVFEATAVMKNGLKLKVEIFFAD
>NZ_CP022445.1|WP_000682204.1|2586386_2586683_-|hypothetical-protein
MKHNINLWSFFSLVCIAFFLLYLEVCTPEMNTSFINIVYFHPLFFVLIFSIGTFFAGIKGFSKAGNWIAMLRSIVTVLLTLLLSVFLTLTLIVGYALS
>NZ_CP022445.1|WP_000450247.1|2587098_2587479_+|hypothetical-protein
METSTFLGLFWGWMTVIVSGILFVRPSVLRDLKKLVVEDRGFGIMYGFLSIFLGLGTVILHNVWVFNWQGFLTVIAWLALLKGIYIIAYPEPSKKTDFEVRILSTRIVLAIIGALALWMLIVIYIK
>NZ_CP022445.1|WP_025689467.1|2588272_2588674_+|NUDIX-domain-containing-protein
MTTNKDYIRYIRGKVGHDLIFLNFAGGIVYNERNEILLQKRGDRNEWGIPGGAMELGESLEETAKREIFEETGLNVEVEHLIGVYSKYSGEFPNGDKAQTITHCFQCKPIGGELTVDGIETLDLKYFPIDQTT
>NZ_CP022445.1|WP_001170283.1|2588824_2589775_+|nucleoside-hydrolase
MQKKVLLFTDLGIDDAFAILYIFFRKDIQLVGIVADYGNVSRENVIRNINYLKYIAGREEIPVFLGASVPLTGILIQYFPEVHGKVGLGPIIPPEISYPVYPLNDIYQIIESNLEDLTIINLGRLSSLATTFVLNLETMRNVRECICMGGAFFYPGNVTAVAEANFYADPYAANLILQHAKNLTIIPLNVTQHAIVTPEMVQQIDAFHRNTQDLAGLIIKPMLDYYYNFYSKSNPGISGSPMHDFVTVWYLLNQEAVSLSRVPIKVIPDQGEGFGQSIADFRFVTNPGYKTHNVAFQFDYEWFKKDIMETFLKKRV
>NZ_CP022445.1|WP_089607522.1|2590251_2590413_-|cell-wall-anchor-protein
MNRVNNDVRTRNVNTTNNLNDNQNKNNNWAWLGLLGLLGLFGLRKKDKDPETC
>NZ_CP022445.1|WP_025689464.1|2590519_2591401_-|serine/threonine-protein-kinase
MKDNSVEIQLNNVTFQLKEYHNFDWLIKLGTVFAVFDQQDSGNISFGVEKDGHKKFIKYAGAQTIAYEGTTGDAIKRLKNSVTIYEDLKHESLIRLINHFPVQSGYVLIFDWFDGECLHSHWSFPPPEKYKNPNSPFYKFRHLSAIERIHSLHSIFSFHSYVEKKNYVAIDFYDGSILYNFNTNETKICDIDLYSKKPYINRMGRLWGSSRFMSPEEFELNAIIDERTNVFNMGAMAFSLLGGEKDRSFLKWEASKELYEVAYRAVNANRAERYASVIEFYEAWLKAANAERI
>NZ_CP022445.1|WP_025687471.1|2592199_2593189_+|zinc-binding-dehydrogenase
MKAIVHQYEKGLEGLEYKFSPEISPNAGEVKIKLKAAGLNHRDLFIINNRKEMDLPLVIGSDGSGIVTEIGEGVSNITLHTEVIINPSIGWEHATEVPELPEVLGGPKDGTFAEYVIVPAKNVVEKPSYITWEESGVLSLSALTAYRALFTKGRLKCGEHVLIPGIGGGVATFAMLFAKAIGAKVSVTSRVENKRKLAAKYGADISFHSSGNWEESLQGEKVDLIIDSIGPATFLKYFDVLKPNGTIVNFGASSGDKIELPLRALFYNQIDIMGTSMGSREEFNEMIKFIEKHQIKPIIDKVYSLEEAIRALSRMEHGEQFGNIVLKMN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022445_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022445_2

3623477-3625464

Orphan

Consensus_repeat	Method
ACAGGTGCTACCGGCGCTACTGGN	CRT

29 spacers

The CRISPR arrays of NZ_CP022445_2

>merge|NZ_CP022445|2|3623477-3625464|CRT
ACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCCCGAGGTAACACAGGCGCTACTGGACCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCACCACTGGACCTCAAGGTAACACGGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGGCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGGCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACCGGCGCTACTGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACGGGTGCTACCGGCGCTACTGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACATGGTGCTACCGGCGCTACTGGTGCCTTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACGGCGCTACTGGTGCTACTGGACCAAGGTGTTAAACAGGTGCTACCGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTAACACGGGTGCCACTGGCGCTACTGGTATAGGAGTTACCGGACCTACTGG

>NZ_CP022445|2|1|3623477-3625464|CRT
ACTGGACCTACCGGTGCCACTGG	GCCTCGAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCCCGAGGTAACACAGGCGCT
ACTGGACCTACCGGTGCCACTGG	ACCTCGAGGTAACACGGGCGCTACTGGCACCACTGGACCTCAAGGTAACACGGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	GCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	ACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAGGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	GCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	ACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	ACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
ACAGGTGCTACTGGTGCCACTGG	ACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCT
ACTGGTGCTACCGGCGCTACTGG	TGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAGGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAGGGTGTTCAAGGTAACACAGGTGCT
ACCGGCGCTACTGGCGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACGGGCGCTACTGGCGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAGGGTGTTCAAGGTAAC
ACGGGTGCTACCGGCGCTACTGG	CGCTACTGGACCTCAGGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	TGCTACTGGACCTCAAGGTGTTCAAGGTAA
CATGGTGCTACCGGCGCTACTGG	TGCCTTGGACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACGGCGCTACTGGT	GCTACTGGACCAAGGTGTTAA
ACAGGTGCTACCGGCGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACAGGTGCTACCGGCGCTACTGG	ACCTCAAGGTAACACGGGTGCCACTGGCGCTACTGGT
ATAGGAGTTACCGGACCTACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022445.1\|WP_000228315.1\|3635807_3636350_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP022445.1\|WP_025687333.1\|3633614_3634367_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP022445.1\|WP_000814429.1\|3627832_3628078_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_000438177.1\|3620787_3621744_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP022445.1\|WP_000031382.1\|3613830_3614373_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP022445.1\|WP_000656783.1\|3616690_3617080_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP022445.1\|WP_089607588.1\|3613026_3613830_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NZ_CP022445.1\|WP_001179093.1\|3634526_3635690_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP022445.1\|WP_088343817.1\|3629456_3630811_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP022445.1\|WP_000504956.1\|3626698_3627652_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP022445.1\|WP_000734605.1\|3628140_3629091_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP022445.1\|WP_000092763.1\|3615307_3616642_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP022445.1\|WP_000704605.1\|3630836_3632693_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP022445.1\|WP_025686811.1\|3617264_3618536_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|226585
NZ_CP022445.1\|WP_001102628.1\|3614365_3614689_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP022445.1\|WP_089607589.1\|3621857_3622823_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP022445.1\|WP_000813896.1\|3626452_3626677_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP022445.1\|WP_086403757.1\|3632706_3633618_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP022445.1\|WP_025686812.1\|3618528_3619803_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP022445.1\|WP_000312266.1\|3619895_3620519_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415

Protein	Function_ID	Function_description	E-value
NZ_CP022445.1\|WP_000228315.1\|3635807_3636350_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NZ_CP022445.1\|WP_025687333.1\|3633614_3634367_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.81171e-83
NZ_CP022445.1\|WP_000438177.1\|3620787_3621744_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.36822e-156
NZ_CP022445.1\|WP_000031382.1\|3613830_3614373_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	1.57489e-80
NZ_CP022445.1\|WP_000656783.1\|3616690_3617080_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP022445.1\|WP_089607588.1\|3613026_3613830_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	1.39005e-18
NZ_CP022445.1\|WP_001179093.1\|3634526_3635690_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP022445.1\|WP_088343817.1\|3629456_3630811_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	6.68038e-58
NZ_CP022445.1\|WP_000504956.1\|3626698_3627652_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	3.67391e-165
NZ_CP022445.1\|WP_000734605.1\|3628140_3629091_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.49105e-36
NZ_CP022445.1\|WP_000092763.1\|3615307_3616642_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP022445.1\|WP_000704605.1\|3630836_3632693_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	1.29193e-142
NZ_CP022445.1\|WP_025686811.1\|3617264_3618536_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|226585	COG4100, COG4100, Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism].	0
NZ_CP022445.1\|WP_001102628.1\|3614365_3614689_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.79312e-24
NZ_CP022445.1\|WP_089607589.1\|3621857_3622823_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.44125e-12
NZ_CP022445.1\|WP_000813896.1\|3626452_3626677_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP022445.1\|WP_086403757.1\|3632706_3633618_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	6.77928e-142
NZ_CP022445.1\|WP_025686812.1\|3618528_3619803_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP022445.1\|WP_000312266.1\|3619895_3620519_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.79506e-60

>NZ_CP022445.1|WP_089607589.1|3621857_3622823_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVQFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NZ_CP022445.1|WP_000438177.1|3620787_3621744_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKNDLIGISSMDLMLEEETHST
>NZ_CP022445.1|WP_000312266.1|3619895_3620519_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSIHK
>NZ_CP022445.1|WP_025686812.1|3618528_3619803_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTQELEPDVIVFNNELTPSQIRNLSSVLNARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIETKMKKEMDCYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NZ_CP022445.1|WP_025686811.1|3617264_3618536_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTSAGLVDFEAVAAAIHNNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLTIS
>NZ_CP022445.1|WP_000656783.1|3616690_3617080_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP022445.1|WP_000092763.1|3615307_3616642_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP022445.1|WP_001102628.1|3614365_3614689_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWRDFAKGVQEIIEGVEWDE
>NZ_CP022445.1|WP_000031382.1|3613830_3614373_-|DUF1700-domain-containing-protein
MSKEGFLKELSSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIIAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLFLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NZ_CP022445.1|WP_089607588.1|3613026_3613830_-|DUF4097-family-beta-strand-repeat-protein
MMKKLLLIAIACIIIGVIGISQTYEKAVQTAEKGDKENVIKNETLKNIEVKLDAGDIIVQKSPDSSFYVKQSGDVRKQEIRIAEDGDTLKIIGEREKGASFDFSFYDFRFQTSKLTLLVPERSYQDVKVNSSAGQIEMSDVKSDSVSVRTLAGEVELKQVTAKNVEGSTKAGEVNFKKVLGKVTAKTTSGEINIQDHDSKYNLEASSTAGDIDITLSEKPQDAVITGQSAAGDVTIFNEENKNVTIGNGSKKISGKTAAGDVTIETR
>NZ_CP022445.1|WP_000813896.1|3626452_3626677_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP022445.1|WP_000504956.1|3626698_3627652_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKVLNGEIISGDSMQIYRTMDIGTAKVTKAEMDGIPHYMIDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRASLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NZ_CP022445.1|WP_000814429.1|3627832_3628078_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTLHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NZ_CP022445.1|WP_000734605.1|3628140_3629091_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDILNVRENPNVESKLVGKVFSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPARTNTPVKNNTVVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NZ_CP022445.1|WP_088343817.1|3629456_3630811_-|IS3-family-transposase
MAKFTADEKIQIVLRYLNGNESYREMGRSLGISDTIILNWVNQYKQNGLEAFLKRCTNYTQQFKLDVLNFMIENGMSLFETAAIFNIPAPSTISVWKKQLETQGIDALQSKKKGRPSMKKDSNKQVKQPLAEGSVEALEARIKQLEMENEYFKKVKCLSSKQGKITKQDKAQVVYELRHKYSVKALVELATIPRSTYYDLVKKMNRPDVDADLKAEIKAIYEENEGRYGYRRIRDELTNRGQKVNHKKVQRIMKELGLKCVVRMKKYKSYKGKVSRIAPNILERNFHTDAPNQKWVTDITEFKLFGEKLYVSPVLDLYNGEIITYTIGSRPTYSLVSDMLEKALERLPETHQLLMHSDQGWHYQMRQYVRTLESRAIVQSMSRKGNCYDNAVIENFFGIMKSEFLYIKEFENVEHFKIELEKYIDYYNTKRIKAKLKMSPVQYRTHFYQAA
>NZ_CP022445.1|WP_000704605.1|3630836_3632693_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKTEFKEAILKREAQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKSESIEGEKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAVMLGVWKKKVQ
>NZ_CP022445.1|WP_086403757.1|3632706_3633618_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVSSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLQTEGVTTNFVQVDEDTRINVKIKGEEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPVSIPNTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NZ_CP022445.1|WP_025687333.1|3633614_3634367_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVIEQGDCIYLDAGSTTFEMIPFLINKDITVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKQQTNVIEADKQ
>NZ_CP022445.1|WP_001179093.1|3634526_3635690_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTTSVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCEAVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEGNVSRFKQFAIRVFNVETDGKTDREIALEGIQALRQFWTSIEAPVTLSDYAIGENEIDLMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP022445.1|WP_000228315.1|3635807_3636350_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022445_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022445_3

5098925-5099043

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP022445_3

>merge|NZ_CP022445|3|5098925-5099043|CRISPRCasFinder
GTTGATTTTTCTTCTTTTTTATCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTACTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NZ_CP022445|3|1|5098925-5099043|CRISPRCasFinder
GTTGATTTTTCTTCTTTTTTATC	ACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTACTTTCTGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022445.1\|WP_000457978.1\|5096712_5097714_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP022445.1\|WP_000931959.1\|5095849_5096284_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP022445.1\|WP_000057889.1\|5106094_5106331_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP022445.1\|WP_000544012.1\|5097874_5098147_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP022445.1\|WP_089607754.1\|5100638_5101481_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP022445.1\|WP_031312366.1\|5090819_5091587_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP022445.1\|WP_000008901.1\|5098455_5098590_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022445.1\|WP_017674225.1\|5089021_5089681_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|274398
NZ_CP022445.1\|WP_025688654.1\|5109554_5111417_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP022445.1\|WP_001207164.1\|5091699_5092401_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP022445.1\|WP_088344001.1\|5106533_5108054_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP022445.1\|WP_000411274.1\|5103994_5105299_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP022445.1\|WP_075676678.1\|5101662_5102670_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP022445.1\|WP_000672663.1\|5102768_5103788_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP022445.1\|WP_000393115.1\|5092390_5093134_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP022445.1\|WP_089607755.1\|5108055_5109558_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP022445.1\|WP_059304264.1\|5105338_5106049_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP022445.1\|WP_006926555.1\|5099931_5100639_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP022445.1\|WP_141529016.1\|5094826_5095504_-\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP022445.1\|WP_017674224.1\|5089699_5090578_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131

Protein	Function_ID	Function_description	E-value
NZ_CP022445.1\|WP_000457978.1\|5096712_5097714_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP022445.1\|WP_000931959.1\|5095849_5096284_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP022445.1\|WP_000057889.1\|5106094_5106331_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NZ_CP022445.1\|WP_000544012.1\|5097874_5098147_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP022445.1\|WP_089607754.1\|5100638_5101481_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.84021e-89
NZ_CP022445.1\|WP_031312366.1\|5090819_5091587_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	5.04185e-107
NZ_CP022445.1\|WP_017674224.1\|5089699_5090578_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NZ_CP022445.1\|WP_017674225.1\|5089021_5089681_-\|sugar-transferase	gnl\|CDD\|274398	TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.	1.97068e-98
NZ_CP022445.1\|WP_025688654.1\|5109554_5111417_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP022445.1\|WP_001207164.1\|5091699_5092401_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	8.02666e-84
NZ_CP022445.1\|WP_088344001.1\|5106533_5108054_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	1.49798e-151
NZ_CP022445.1\|WP_000411274.1\|5103994_5105299_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP022445.1\|WP_089607755.1\|5108055_5109558_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	1.14387e-176
NZ_CP022445.1\|WP_000672663.1\|5102768_5103788_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	5.80584e-135
NZ_CP022445.1\|WP_000393115.1\|5092390_5093134_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	1.97657e-83
NZ_CP022445.1\|WP_059304264.1\|5105338_5106049_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	6.91664e-34
NZ_CP022445.1\|WP_006926555.1\|5099931_5100639_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	5.40923e-09
NZ_CP022445.1\|WP_141529016.1\|5094826_5095504_-\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.50931e-81
NZ_CP022445.1\|WP_075676678.1\|5101662_5102670_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	6.24105e-31

>NZ_CP022445.1|WP_000008901.1|5098455_5098590_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEEFEREE
>NZ_CP022445.1|WP_000544012.1|5097874_5098147_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP022445.1|WP_000457978.1|5096712_5097714_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP022445.1|WP_000931959.1|5095849_5096284_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP022445.1|WP_141529016.1|5094826_5095504_-|polysaccharide-biosynthesis-tyrosine-autokinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTISNLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRVMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKILGVVLNDKREEKEQYGYY
>NZ_CP022445.1|WP_000393115.1|5092390_5093134_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHIFKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMFQAGEIQTNIQLTNTYKVIIKSPVILEQVNEKLNLNMTAQELTKKVNVANEKDSQVIAVTAEDKDPKIARDIANATADVFKGEVAKIMNVDNVTVISKAEVAENQSPIKPAPMLNIAIAFIVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPSSRKVRGQTIGS
>NZ_CP022445.1|WP_001207164.1|5091699_5092401_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>NZ_CP022445.1|WP_031312366.1|5090819_5091587_-|tyrosine-protein-phosphatase
MIDLHCHILPGIDDGAQTVTDSLAMAQQAVSEGIHTIVATPHHQNGKYVNERTSIIHHVKQLNDELQQHNIPLTILPGQEVRLYGELLEDYEAGKIVTLNETHKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGTSVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP022445.1|WP_017674224.1|5089699_5090578_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAETPCLRQLMDQYEGTKSSVIGVQTVPENETHRYGIIDPIERNGRNYQVRQFVEKPPEGTAPSNLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEMQRVFAYDFEGTRYDVGEKFGFIRTTIEMALQQKELKEQLIKYMVELVHKEAIK
>NZ_CP022445.1|WP_017674225.1|5089021_5089681_-|sugar-transferase
MKTGENIARDYQITPDTQTIQVESNQSKIYLGIKYLLDVMFSLVGLIVLMPVILIFSILIILESPGSPFYLQERLGLNGKRFKVIKLRSMRNDAEKNGAKWAEKNDPRVTKIGLFIRKTRIDELPQLFNILKGDMSLVGPRPERPIFTEKFERDIPGFKKRLEVKPGLTGWAQVNGGYEITPKEKLNLDVYYINHASIILDFKIIIKTVRVVITGDGAR
>NZ_CP022445.1|WP_006926555.1|5099931_5100639_-|ABC-transporter-permease
MTFSMKRFSAIVRKEISDAGKNSQVILMALLPILLAVFYSNMDSIKEFFAGFIIVMTITMVGSYVQAIIIAEEKEKHTLRVLMLSPASPIEVILGKSVLTVFFVLASSFISLVILDTFKGNISMLVIIILIGTLLCVVLGTIVGLLSQNIAQTSILGLPIFIIFIMGPMLQEMVKNEFIIKVVKLLPTNHVMEALQKVIKGEGFIAIQEHILNNTIWTICLIILCIIVYKKKQLD
>NZ_CP022445.1|WP_089607754.1|5100638_5101481_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFSGKTALRNVNIEVKRGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLTQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNEEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIEVVLKGKRKEVVQKDELGANRISEWMKKGELLSIHSYEPTLGDIFIEVTGRGL
>NZ_CP022445.1|WP_075676678.1|5101662_5102670_-|ATP-binding-cassette-domain-containing-protein
MALLELKQLGKTNQLPAIELKVEKGQCIVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGEAIGKKNYSRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQSVGLLDKLNVKIEKLSFSEKRRLHIGRIMIHNPDLIILEEPEQNVDIESTVIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEVEEVGEEKVIQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP022445.1|WP_000672663.1|5102768_5103788_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVETLPVEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKDELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP022445.1|WP_000411274.1|5103994_5105299_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP022445.1|WP_059304264.1|5105338_5106049_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEKKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKEKANIQKWEVEQSPDGYKATSYKKLSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQNMNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP022445.1|WP_000057889.1|5106094_5106331_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP022445.1|WP_088344001.1|5106533_5108054_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKSRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMIFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTMDSMWFYMLAYMLMNIGAFAIIHGLILQNDEENITIFTGLYKRSPFTAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP022445.1|WP_089607755.1|5108055_5109558_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKNLSLFDEKMKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLATLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVNAEGALVIPSSLQLSVFIAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGASDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP022445.1|WP_025688654.1|5109554_5111417_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLIHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEEVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYCKKSISRDWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEMYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022445_2	2.11\|3624490\|49\|NZ_CP022445\|CRT	3624490-3624538	49	NZ_CP022445.1	3625585-3625633	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625558-3625579	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625612-3625633	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625657-3625678	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625702-3625723	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625792-3625813	0	1.0
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625828-3625849	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625558-3625579	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625612-3625633	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625657-3625678	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625702-3625723	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625792-3625813	0	1.0
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625828-3625849	0	1.0
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625549-3625579	0	1.0
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625603-3625633	0	1.0
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625648-3625678	0	1.0
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625693-3625723	0	1.0
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625819-3625849	0	1.0
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625549-3625579	0	1.0
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625603-3625633	0	1.0
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625648-3625678	0	1.0
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625693-3625723	0	1.0
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625819-3625849	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625558-3625579	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625612-3625633	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625657-3625678	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625702-3625723	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625792-3625813	0	1.0
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625828-3625849	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625558-3625579	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625612-3625633	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625657-3625678	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625702-3625723	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625792-3625813	0	1.0
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625828-3625849	0	1.0
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625549-3625579	0	1.0
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625603-3625633	0	1.0
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625648-3625678	0	1.0
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625693-3625723	0	1.0
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625819-3625849	0	1.0
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625549-3625579	0	1.0
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625603-3625633	0	1.0
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625648-3625678	0	1.0
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625693-3625723	0	1.0
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625819-3625849	0	1.0
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625549-3625579	0	1.0
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625603-3625633	0	1.0
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625648-3625678	0	1.0
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625693-3625723	0	1.0
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625819-3625849	0	1.0
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625549-3625578	0	1.0
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625603-3625632	0	1.0
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625648-3625677	0	1.0
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625693-3625722	0	1.0
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625819-3625848	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625558-3625579	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625612-3625633	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625657-3625678	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625702-3625723	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625792-3625813	0	1.0
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625828-3625849	0	1.0
NZ_CP022445_2	2.10\|3624427\|40\|NZ_CP022445\|CRT	3624427-3624466	40	NZ_CP022445.1	3625558-3625597	1	0.975
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625558-3625579	1	0.955
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625612-3625633	1	0.955
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625657-3625678	1	0.955
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625702-3625723	1	0.955
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625792-3625813	1	0.955
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625828-3625849	1	0.955
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625558-3625588	1	0.968
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625612-3625642	1	0.968
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625657-3625687	1	0.968
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625702-3625732	1	0.968
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625828-3625858	1	0.968
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625522-3625543	1	0.955
NZ_CP022445_2	2.14\|3624661\|22\|NZ_CP022445\|CRT	3624661-3624682	22	NZ_CP022445.1	3625738-3625759	1	0.955
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625522-3625543	1	0.955
NZ_CP022445_2	2.15\|3624706\|22\|NZ_CP022445\|CRT	3624706-3624727	22	NZ_CP022445.1	3625738-3625759	1	0.955
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625513-3625543	1	0.968
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP022445.1	3625729-3625759	1	0.968
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625513-3625543	1	0.968
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP022445.1	3625729-3625759	1	0.968
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625522-3625543	1	0.955
NZ_CP022445_2	2.18\|3624859\|22\|NZ_CP022445\|CRT	3624859-3624880	22	NZ_CP022445.1	3625738-3625759	1	0.955
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625522-3625543	1	0.955
NZ_CP022445_2	2.19\|3624904\|22\|NZ_CP022445\|CRT	3624904-3624925	22	NZ_CP022445.1	3625738-3625759	1	0.955
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625513-3625543	1	0.968
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP022445.1	3625729-3625759	1	0.968
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625513-3625543	1	0.968
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP022445.1	3625729-3625759	1	0.968
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625558-3625579	1	0.955
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625612-3625633	1	0.955
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625657-3625678	1	0.955
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625702-3625723	1	0.955
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625792-3625813	1	0.955
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625828-3625849	1	0.955
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	NZ_CP022445.1	3625783-3625813	1	0.968
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625513-3625543	1	0.968
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP022445.1	3625729-3625759	1	0.968
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625513-3625542	1	0.967
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP022445.1	3625729-3625758	1	0.967
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625522-3625543	1	0.955
NZ_CP022445_2	2.28\|3625360\|22\|NZ_CP022445\|CRT	3625360-3625381	22	NZ_CP022445.1	3625738-3625759	1	0.955
NZ_CP022445_2	2.10\|3624427\|40\|NZ_CP022445\|CRT	3624427-3624466	40	NZ_CP022445.1	3625612-3625651	2	0.95
NZ_CP022445_2	2.10\|3624427\|40\|NZ_CP022445\|CRT	3624427-3624466	40	NZ_CP022445.1	3625657-3625696	2	0.95
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625522-3625543	2	0.909
NZ_CP022445_2	2.12\|3624562\|22\|NZ_CP022445\|CRT	3624562-3624583	22	NZ_CP022445.1	3625738-3625759	2	0.909
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625522-3625552	2	0.935
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625738-3625768	2	0.935
NZ_CP022445_2	2.13\|3624607\|31\|NZ_CP022445\|CRT	3624607-3624637	31	NZ_CP022445.1	3625792-3625822	2	0.935
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625522-3625543	2	0.909
NZ_CP022445_2	2.22\|3625057\|22\|NZ_CP022445\|CRT	3625057-3625078	22	NZ_CP022445.1	3625738-3625759	2	0.909

1. spacer 2.11|3624490|49|NZ_CP022445|CRT matches to position: 3625585-3625633, mismatch: 0, identity: 1.0

tgctaccggcgctactggtgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctaccggcgctactggtgctactggacctcaaggtgttcaaggtaac	Protospacer
*************************************************

2. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

3. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

4. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

5. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

6. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

7. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

8. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

9. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

10. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

11. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

12. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

13. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

14. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625549-3625579, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

15. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625603-3625633, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

16. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625648-3625678, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

17. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625693-3625723, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

18. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625819-3625849, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

19. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625549-3625579, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

20. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625603-3625633, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

21. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625648-3625678, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

22. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625693-3625723, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

23. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625819-3625849, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

24. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

25. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

26. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

27. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

28. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

29. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

30. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

31. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

32. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

33. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

34. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

35. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

36. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625549-3625579, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

37. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625603-3625633, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

38. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625648-3625678, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

39. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625693-3625723, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

40. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625819-3625849, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

41. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625549-3625579, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

42. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625603-3625633, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

43. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625648-3625678, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

44. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625693-3625723, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

45. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625819-3625849, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

46. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625549-3625579, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

47. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625603-3625633, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

48. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625648-3625678, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

49. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625693-3625723, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

50. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625819-3625849, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaac	Protospacer
*******************************

51. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625549-3625578, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaa	Protospacer
******************************

52. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625603-3625632, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaa	Protospacer
******************************

53. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625648-3625677, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaa	Protospacer
******************************

54. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625693-3625722, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaa	Protospacer
******************************

55. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625819-3625848, mismatch: 0, identity: 1.0

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggtaa	Protospacer
******************************

56. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

57. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

58. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

59. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

60. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

61. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 0, identity: 1.0

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
**********************

62. spacer 2.10|3624427|40|NZ_CP022445|CRT matches to position: 3625558-3625597, mismatch: 1, identity: 0.975

acctcagggtgttcaaggtaacacaggtgctaccggcgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgctaccggcgct	Protospacer
******.*********************************

63. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

64. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

65. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

66. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

67. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

68. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

69. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625558-3625588, mismatch: 1, identity: 0.968

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgct	Protospacer
******.************************

70. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625612-3625642, mismatch: 1, identity: 0.968

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgct	Protospacer
******.************************

71. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625657-3625687, mismatch: 1, identity: 0.968

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgct	Protospacer
******.************************

72. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625702-3625732, mismatch: 1, identity: 0.968

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgct	Protospacer
******.************************

73. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625828-3625858, mismatch: 1, identity: 0.968

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgct	Protospacer
******.************************

74. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******************.***

75. spacer 2.14|3624661|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
*********.************

76. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******************.***

77. spacer 2.15|3624706|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
*********.************

78. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625513-3625543, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaac	Protospacer
***************************.***

79. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to position: 3625729-3625759, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaac	Protospacer
******************.************

80. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625513-3625543, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaac	Protospacer
***************************.***

81. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to position: 3625729-3625759, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaac	Protospacer
******************.************

82. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******************.***

83. spacer 2.18|3624859|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
*********.************

84. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******************.***

85. spacer 2.19|3624904|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
*********.************

86. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625513-3625543, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaac	Protospacer
***************************.***

87. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to position: 3625729-3625759, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaac	Protospacer
******************.************

88. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625513-3625543, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaac	Protospacer
***************************.***

89. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to position: 3625729-3625759, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaac	Protospacer
******************.************

90. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625558-3625579, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

91. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625612-3625633, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

92. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625657-3625678, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

93. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625702-3625723, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

94. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625792-3625813, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

95. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625828-3625849, mismatch: 1, identity: 0.955

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggtaac	Protospacer
******.***************

96. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to position: 3625783-3625813, mismatch: 1, identity: 0.968

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
cgctactggacctcaaggtgttcaaggtaac	Protospacer
***************.***************

97. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625513-3625543, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaac	Protospacer
***************************.***

98. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to position: 3625729-3625759, mismatch: 1, identity: 0.968

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaac	Protospacer
******************.************

99. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625513-3625542, mismatch: 1, identity: 0.967

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggtgttcaaggcaa	Protospacer
***************************.**

100. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to position: 3625729-3625758, mismatch: 1, identity: 0.967

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgctactggacctcaaggcgttcaaggtaa	Protospacer
******************.***********

101. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******************.***

102. spacer 2.28|3625360|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 1, identity: 0.955

acctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
*********.************

103. spacer 2.10|3624427|40|NZ_CP022445|CRT matches to position: 3625612-3625651, mismatch: 2, identity: 0.95

acctcagggtgttcaaggtaacacaggtgctaccggcgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgctaccggtgct	Protospacer
******.*****************************.***

104. spacer 2.10|3624427|40|NZ_CP022445|CRT matches to position: 3625657-3625696, mismatch: 2, identity: 0.95

acctcagggtgttcaaggtaacacaggtgctaccggcgct	CRISPR spacer
acctcaaggtgttcaaggtaacacaggtgctaccggtgct	Protospacer
******.*****************************.***

105. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 2, identity: 0.909

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******.***********.***

106. spacer 2.12|3624562|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 2, identity: 0.909

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
******.**.************

107. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625522-3625552, mismatch: 2, identity: 0.935

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggcaacacaggtgct	Protospacer
******.***********.************

108. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625738-3625768, mismatch: 2, identity: 0.935

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggcgttcaaggtaacacaggtgct	Protospacer
******.**.*********************

109. spacer 2.13|3624607|31|NZ_CP022445|CRT matches to position: 3625792-3625822, mismatch: 2, identity: 0.935

acctcagggtgttcaaggtaacacaggtgct	CRISPR spacer
acctcaaggtgttcaaggtaacacgggtgct	Protospacer
******.*****************.******

110. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625522-3625543, mismatch: 2, identity: 0.909

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggtgttcaaggcaac	Protospacer
******.***********.***

111. spacer 2.22|3625057|22|NZ_CP022445|CRT matches to position: 3625738-3625759, mismatch: 2, identity: 0.909

acctcagggtgttcaaggtaac	CRISPR spacer
acctcaaggcgttcaaggtaac	Protospacer
******.**.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2706	5	0.833
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2760	5	0.833
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2814	5	0.833
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168898-168927	5	0.833
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26482	5	0.833
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	6	0.806
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	6	0.806
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	6	0.806
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	6	0.806
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26483	6	0.806
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	6	0.806
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	6	0.806
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	6	0.806
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	6	0.806
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26483	6	0.806
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	6	0.806
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	6	0.806
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	6	0.806
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	6	0.806
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26483	6	0.806
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	6	0.806
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	6	0.806
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	6	0.806
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	6	0.806
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26483	6	0.806
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	6	0.806
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	6	0.806
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	6	0.806
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	6	0.806
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NC_021795	Cellulophaga phage phi17:1, complete genome	26453-26483	6	0.806
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2868	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8395	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8449	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8503	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169006-169035	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169114-169143	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30928	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33728	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NC_007734	Bacillus phage WBeta, complete genome	33699-33728	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3845	6	0.8
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10552	6	0.8
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2869	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8396	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8450	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8504	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169035	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169143	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30929	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NC_007734	Bacillus phage WBeta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3846	7	0.774
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2869	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8396	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8450	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8504	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169035	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169143	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30929	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NC_007734	Bacillus phage WBeta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3846	7	0.774
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2869	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8396	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8450	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8504	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169035	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169143	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30929	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NC_007734	Bacillus phage WBeta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3846	7	0.774
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2869	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8396	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8450	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8504	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169035	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169143	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30929	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NC_007734	Bacillus phage WBeta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3846	7	0.774
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	7	0.774
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	7	0.774
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	7	0.774
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2839-2869	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8366-8396	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8420-8450	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8474-8504	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169035	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169143	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30899-30929	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	DQ289555	Bacillus anthracis phage W Beta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NC_007734	Bacillus phage WBeta, complete genome	33699-33729	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3816-3846	7	0.774
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	7	0.774
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168952-168981	7	0.767
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MN693555	Marine virus AFVG_25M96, complete genome	16858-16887	7	0.767
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274962	7	0.767
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275070	7	0.767
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	KY705251	Streptococcus phage P0091, complete genome	17096-17125	7	0.767
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20004-20033	7	0.767
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	MH937499	Streptococcus phage CHPC1062, complete genome	17280-17309	7	0.767
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	8	0.742
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	MN693555	Marine virus AFVG_25M96, complete genome	16857-16887	8	0.742
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274963	8	0.742
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275071	8	0.742
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	8	0.742
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	MN693555	Marine virus AFVG_25M96, complete genome	16857-16887	8	0.742
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274963	8	0.742
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275071	8	0.742
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	8	0.742
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	MN693555	Marine virus AFVG_25M96, complete genome	16857-16887	8	0.742
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274963	8	0.742
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275071	8	0.742
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	8	0.742
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	MN693555	Marine virus AFVG_25M96, complete genome	16857-16887	8	0.742
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274963	8	0.742
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275071	8	0.742
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	8	0.742
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	MN693555	Marine virus AFVG_25M96, complete genome	16857-16887	8	0.742
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274933-274963	8	0.742
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275041-275071	8	0.742
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169060-169089	8	0.733
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	KY705251	Streptococcus phage P0091, complete genome	17095-17124	8	0.733
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20005-20034	8	0.733
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MH937499	Streptococcus phage CHPC1062, complete genome	17279-17308	8	0.733
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30796	8	0.733
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	HQ615693	Synechococcus phage S-CRM01, complete genome	25962-25991	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2678-2707	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2732-2761	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2786-2815	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168926	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	10965-10994	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	MN693555	Marine virus AFVG_25M96, complete genome	16857-16886	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP021045	Phaeobacter gallaeciensis strain P129 plasmid pP129_e, complete sequence	32419-32448	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP033574	Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence	162529-162558	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	MT354570	Pseudomonas phage phiB1_1, complete genome	30768-30797	8	0.733
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	MH616963	CrAssphage sp. isolate ctbg_1, complete genome	22442-22471	8	0.733
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169059-169089	9	0.71
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30797	9	0.71
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169059-169089	9	0.71
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30797	9	0.71
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169059-169089	9	0.71
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30797	9	0.71
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169059-169089	9	0.71
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30797	9	0.71
NZ_CP022445_2	2.23\|3625102\|31\|NZ_CP022445\|CRT	3625102-3625132	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	9	0.71
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169059-169089	9	0.71
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	MT354570	Pseudomonas phage phiB1_1, complete genome	30767-30797	9	0.71
NZ_CP022445_2	2.25\|3625210\|30\|NZ_CP022445\|CRT	3625210-3625239	30	MH576968	Streptomyces phage Wofford, complete genome	74327-74356	9	0.7
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2840-2869	9	0.7
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169113-169142	9	0.7
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169005-169034	9	0.7
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	NC_021795	Cellulophaga phage phi17:1, complete genome	26454-26483	9	0.7
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	9	0.735
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	9	0.735
NZ_CP022445_2	2.16\|3624751\|31\|NZ_CP022445\|CRT	3624751-3624781	31	MH576968	Streptomyces phage Wofford, complete genome	74327-74357	10	0.677
NZ_CP022445_2	2.17\|3624805\|31\|NZ_CP022445\|CRT	3624805-3624835	31	MH576968	Streptomyces phage Wofford, complete genome	74327-74357	10	0.677
NZ_CP022445_2	2.20\|3624949\|31\|NZ_CP022445\|CRT	3624949-3624979	31	MH576968	Streptomyces phage Wofford, complete genome	74327-74357	10	0.677
NZ_CP022445_2	2.21\|3625003\|31\|NZ_CP022445\|CRT	3625003-3625033	31	MH576968	Streptomyces phage Wofford, complete genome	74327-74357	10	0.677
NZ_CP022445_2	2.24\|3625156\|31\|NZ_CP022445\|CRT	3625156-3625186	31	MH576968	Streptomyces phage Wofford, complete genome	74327-74357	10	0.677
NZ_CP022445_2	2.26\|3625263\|30\|NZ_CP022445\|CRT	3625263-3625292	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168980	10	0.667
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
NZ_CP022445_3	3.2\|5098987\|34\|NZ_CP022445\|CRISPRCasFinder	5098987-5099020	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.833

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggacctcaaggagttcaaggtat	Protospacer
  * ************** **********

2. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.833

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggacctcaaggggttcaaggtat	Protospacer
  * ************** **********

3. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.833

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggacctcaaggagttcaaggtat	Protospacer
  * ************** **********

4. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.833

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggacctcaaggagttcaaggtat	Protospacer
  * ************** **********

5. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 5, identity: 0.833

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgagactggacctcaaggtatacaaggtat	Protospacer
**  ***************.* *******

6. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

7. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ************** ********** .

8. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

9. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

10. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgagactggacctcaaggtatacaaggtatt	Protospacer
**  ***************.* ******* .

11. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

12. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ************** ********** .

13. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

14. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

15. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgagactggacctcaaggtatacaaggtatt	Protospacer
**  ***************.* ******* .

16. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

17. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ************** ********** .

18. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

19. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

20. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgagactggacctcaaggtatacaaggtatt	Protospacer
**  ***************.* ******* .

21. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

22. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ************** ********** .

23. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

24. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

25. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgagactggacctcaaggtatacaaggtatt	Protospacer
**  ***************.* ******* .

26. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

27. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ************** ********** .

28. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

29. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ************** ********** .

30. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.806

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgagactggacctcaaggtatacaaggtatt	Protospacer
**  ***************.* ******* .

31. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggaccccaaggagttcaaggtat	Protospacer
  * ********.***** **********

32. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
acctactggaccccaaggagttcaaggaat	Protospacer
  **********.***** ******** *

33. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
acctactggaccccaaggagttcaaggaat	Protospacer
  **********.***** ******** *

34. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
acctactggaccccaaggagttcaaggaat	Protospacer
  **********.***** ******** *

35. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggaccccaaggagttcaaggtat	Protospacer
  * ********.***** **********

36. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaacaggacctcaaggagttcaaggtat	Protospacer
  * ** *********** **********

37. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
aactactggacctcaaggaattcaaggaat	Protospacer
 .**************** .******* *

38. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
aactactggacctcaaggaattcaaggaat	Protospacer
 .**************** .******* *

39. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
aactactggacctcaaggaattcaaggaat	Protospacer
 .**************** .******* *

40. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
aactactggacctcaaggaattcaaggaat	Protospacer
 .**************** .******* *

41. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 6, identity: 0.8

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgacactggacctcagggtattcaaggtcc	Protospacer
** .***********.***.********

42. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

43. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

44. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

45. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

46. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

47. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaaggtatt	Protospacer
  * ** *********** ********** .

48. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

49. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

50. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

51. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

52. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** .***********.***.********

53. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

54. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

55. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

56. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

57. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

58. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaaggtatt	Protospacer
  * ** *********** ********** .

59. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

60. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

61. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

62. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

63. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** .***********.***.********

64. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

65. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

66. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

67. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

68. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

69. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaaggtatt	Protospacer
  * ** *********** ********** .

70. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

71. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

72. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

73. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

74. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** .***********.***.********

75. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

76. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

77. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

78. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

79. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

80. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaaggtatt	Protospacer
  * ** *********** ********** .

81. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

82. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

83. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

84. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

85. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** .***********.***.********

86. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
.* .***************.********

87. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

88. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ***********.** ********** .

89. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

90. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

91. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

92. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

93. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

94. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctactggaccccaaggagttcaaggaatt	Protospacer
  **********.***** ******** * .

95. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggtatt	Protospacer
  * ********.***** ********** .

96. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaaggtatt	Protospacer
  * ** *********** ********** .

97. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

98. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

99. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

100. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aactactggacctcaaggaattcaaggaatt	Protospacer
 .**************** .******* * .

101. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 7, identity: 0.774

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** .***********.***.********

102. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.767

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggacctcaaggggttcaaggact	Protospacer
  * ************** ********

103. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 7, identity: 0.767

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
acctcaaggacctcaaggtattcaaggtat	Protospacer
  **   ************.*********

104. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaacaggacctcaaggagttcaagggat	Protospacer
  * ** *********** ******** *

105. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accgacaggacctcaaggagttcaagggat	Protospacer
  * ** *********** ******** *

106. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.767

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gaccgtggacctcaaggtgttcaaggatta	Protospacer
 .** *********************

107. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.767

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gaccgtggacctcaaggtgttcaaggatta	Protospacer
 .** *********************

108. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 7, identity: 0.767

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gaccgtggacctcaaggtgttcaaggacca	Protospacer
 .** *********************

109. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ************** ********   .

110. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggacctcaaggtattcaaggtatt	Protospacer
  **   ************.********* .

111. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

112. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accgacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

113. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ************** ********   .

114. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggacctcaaggtattcaaggtatt	Protospacer
  **   ************.********* .

115. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

116. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accgacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

117. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ************** ********   .

118. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggacctcaaggtattcaaggtatt	Protospacer
  **   ************.********* .

119. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

120. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accgacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

121. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ************** ********   .

122. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggacctcaaggtattcaaggtatt	Protospacer
  **   ************.********* .

123. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

124. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accgacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

125. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ************** ********   .

126. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
acctcaaggacctcaaggtattcaaggtatt	Protospacer
  **   ************.********* .

127. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

128. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.742

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accgacaggacctcaaggagttcaagggatt	Protospacer
  * ** *********** ******** * .

129. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
accaactggaccccaaggagttcaaggact	Protospacer
  * ********.***** ********

130. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
agaccgtggacctcaaggtgttcaaggatt	Protospacer
 * .  *********************

131. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
agaccgtggacctcaaggtgttcaaggatt	Protospacer
 * .  *********************

132. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
agaccgtggacctcaaggtgttcaaggacc	Protospacer
 * .  *********************

133. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
agggcctggacctcaaggtgtacaaggacc	Protospacer
 *   **************** *****

134. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 8, identity: 0.733

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
tgatactggacctcaaggtgtaactggcgt	Protospacer
** ******************    **..

135. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggacctcaaggagttcaaggtatt	Protospacer
.   .************ ********** .

136. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggacctcaaggggttcaaggtatt	Protospacer
.   .************ ********** .

137. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggacctcaaggagttcaaggtatt	Protospacer
.   .************ ********** .

138. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggacctcaaggagttcaaggtatt	Protospacer
.   .************ ********** .

139. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
cttattggacctcaaggtgatgaaggtact	Protospacer
. . *************** * ****** .

140. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
cctcaaggacctcaaggtattcaaggtatt	Protospacer
. .*  ************.********* .

141. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP021045 (Phaeobacter gallaeciensis strain P129 plasmid pP129_e, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
tgcctcggacctcaaggtgatcattgcgca	Protospacer
*****.************* ***  *..

142. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP033574 (Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
agccttggagctaaaggtgttcaaagctca	Protospacer
 ******** ** ***********.*.

143. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gggcctggacctcaaggtgtacaaggaccg	Protospacer
 * *.*************** *****

144. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to MH616963 (CrAssphage sp. isolate ctbg_1, complete genome) position: , mismatch: 8, identity: 0.733

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gctgctggacctcaaggtcctcaaggtatc	Protospacer
  . .************* .******** *

145. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggactt	Protospacer
  * ********.***** ********   .

146. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
agggcctggacctcaaggtgtacaaggaccg	Protospacer
 *   **************** *****

147. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggactt	Protospacer
  * ********.***** ********   .

148. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
agggcctggacctcaaggtgtacaaggaccg	Protospacer
 *   **************** *****

149. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggactt	Protospacer
  * ********.***** ********   .

150. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
agggcctggacctcaaggtgtacaaggaccg	Protospacer
 *   **************** *****

151. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggactt	Protospacer
  * ********.***** ********   .

152. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
agggcctggacctcaaggtgtacaaggaccg	Protospacer
 *   **************** *****

153. spacer 2.23|3625102|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

cgctactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ***********.** ********   .

154. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
accaactggaccccaaggagttcaaggactt	Protospacer
  * ********.***** ********   .

155. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 9, identity: 0.71

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
agggcctggacctcaaggtgtacaaggaccg	Protospacer
 *   **************** *****

156. spacer 2.25|3625210|30|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 9, identity: 0.7

tgctactggacctcaaggtgttcaaggtaa	CRISPR spacer
aatgactggacctcaaggtgtccagggccc	Protospacer
 .. *****************.**.**.

157. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 9, identity: 0.7

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggaccccaaggagttcaaggtatt	Protospacer
.   .******.***** ********** .

158. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.7

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaacaggacctcaaggagttcaaggtatt	Protospacer
.   . *********** ********** .

159. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.7

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggaccccaaggagttcaaggtatt	Protospacer
.   .******.***** ********** .

160. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 9, identity: 0.7

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
gagactggacctcaaggtatacaaggtatt	Protospacer
 .  .*************.* ******* .

161. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

162. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

163. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

164. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

165. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

166. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

167. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

168. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

169. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

170. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

171. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

172. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

173. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

174. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

175. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

176. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

177. spacer 2.16|3624751|31|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 10, identity: 0.677

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aatgactggacctcaaggtgtccagggccct	Protospacer
 .. *****************.**.**.  .

178. spacer 2.17|3624805|31|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 10, identity: 0.677

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aatgactggacctcaaggtgtccagggccct	Protospacer
 .. *****************.**.**.  .

179. spacer 2.20|3624949|31|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 10, identity: 0.677

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aatgactggacctcaaggtgtccagggccct	Protospacer
 .. *****************.**.**.  .

180. spacer 2.21|3625003|31|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 10, identity: 0.677

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aatgactggacctcaaggtgtccagggccct	Protospacer
 .. *****************.**.**.  .

181. spacer 2.24|3625156|31|NZ_CP022445|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 10, identity: 0.677

tgctactggacctcaaggtgttcaaggtaac	CRISPR spacer
aatgactggacctcaaggtgtccagggccct	Protospacer
 .. *****************.**.**.  .

182. spacer 2.26|3625263|30|NZ_CP022445|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 10, identity: 0.667

tgccttggacctcaaggtgttcaaggtaac	CRISPR spacer
ccaactggacctcaaggggttcaaggactt	Protospacer
.   .************ ********   .

183. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

184. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

185. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

186. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

187. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

188. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

189. spacer 3.2|5098987|34|NZ_CP022445|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

315576 : 323952

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|315576_316884_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170544.1\|316972_317692_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000278825.1\|317684_317939_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666774.1\|317935_318619_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055564.1\|318602_320822_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.0e-163	41.2
WP_000879025.1\|320806_322222_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262439.1\|322327_323368_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000088589.1\|323364_323952_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_2

344711 : 403068

Bacillus_phage(67.39%)

protease,tail,tRNA,terminase,integrase,portal,head,capsid

attL 375825:375843|attR 392099:392117

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000086999.1\|344711_345002_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_000051433.1\|345017_346475_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_001047685.1\|346489_347917_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000977679.1\|348474_349380_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	4.1e-27	30.8
WP_000416672.1\|349520_350264_+	HAD family hydrolase	NA	NA	NA	NA
WP_000890407.1\|350343_351783_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_000225136.1\|351898_353266_+	PAS domain-containing protein	NA	NA	NA	NA
WP_025689704.1\|353258_354710_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000263262.1\|354757_355081_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000915110.1\|355213_355705_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_000007349.1\|355750_356980_-	aminopeptidase	NA	NA	NA	NA
WP_001233736.1\|357096_358179_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_088346582.1\|358716_359424_+	hypothetical protein	NA	NA	NA	NA
WP_001200484.1\|359469_360666_-	NupC family nucleoside transporter	NA	NA	NA	NA
WP_048567402.1\|361091_362471_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.8e-117	46.5
WP_089607176.1\|362529_363654_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.8e-213	98.9
WP_089607177.1\|364174_364486_-	hypothetical protein	NA	NA	NA	NA
WP_089607178.1\|364786_365650_-	hypothetical protein	NA	NA	NA	NA
WP_089607179.1\|366211_367351_+	hypothetical protein	H0UST6	Bacillus_phage	9.2e-125	58.6
WP_000172107.1\|367864_368218_-	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	9.6e-49	85.5
WP_089607180.1\|368439_368682_+	helix-turn-helix transcriptional regulator	A0A1B0T6B2	Bacillus_phage	8.7e-25	83.3
WP_089607181.1\|368678_369029_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	1.2e-54	87.9
WP_000969632.1\|369025_369193_+	hypothetical protein	A0A0U3B230	Bacillus_phage	6.0e-17	79.6
WP_089607183.1\|369405_370293_+	DnaD domain protein	W8CYG5	Bacillus_phage	8.9e-43	42.5
WP_089607184.1\|370231_371107_+	ATP-binding protein	Q2I8C8	Bacillus_phage	5.3e-64	46.5
WP_089607185.1\|371122_371317_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	7.7e-24	84.4
WP_089607186.1\|371333_371612_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.8e-11	55.9
WP_089607187.1\|371604_371964_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.7e-32	55.0
WP_088065306.1\|371982_372150_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.5e-12	58.5
WP_000109542.1\|372175_372427_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	2.9e-07	42.2
WP_088065305.1\|372446_372956_+	dUTPase	A0A1L2JY27	Aeribacillus_phage	5.1e-27	44.3
WP_016111352.1\|373514_373706_+	hypothetical protein	NA	NA	NA	NA
WP_089607188.1\|373725_374271_+	hypothetical protein	U5PUK4	Bacillus_phage	2.2e-36	47.6
WP_089607780.1\|374441_374819_+	hypothetical protein	A0A0U3SQD7	Bacillus_phage	9.6e-47	68.9
WP_089607189.1\|374859_375069_+	hypothetical protein	NA	NA	NA	NA
WP_089607190.1\|375313_375523_+	hypothetical protein	NA	NA	NA	NA
WP_089607191.1\|375554_375983_+	hypothetical protein	NA	NA	NA	NA
375825:375843	attL	NA	NA	NA	NA
WP_089607192.1\|376321_376720_+	hypothetical protein	A0A2H4J3B9	uncultured_Caudovirales_phage	5.8e-18	61.1
WP_089607193.1\|376756_376969_+	hypothetical protein	NA	NA	NA	NA
WP_089607194.1\|377001_377322_+	hypothetical protein	A0A0S2GLL5	Bacillus_phage	6.5e-12	70.0
WP_089607195.1\|377365_377644_+	hypothetical protein	A0A1B1P8C3	Bacillus_phage	1.4e-15	57.4
WP_078187670.1\|377676_377904_+	hypothetical protein	NA	NA	NA	NA
WP_089607196.1\|378284_378566_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_050842995.1\|378874_379357_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.9e-71	82.5
WP_001012146.1\|379356_379899_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	91.7
WP_089607199.1\|380541_380913_+	hypothetical protein	A0A0A7AQ61	Bacillus_phage	1.9e-34	70.5
WP_089607200.1\|381028_381247_+	hypothetical protein	A0A288WG15	Bacillus_phage	1.2e-06	46.9
WP_033669590.1\|381260_381575_+	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	3.0e-09	60.0
WP_016097754.1\|381540_381876_+	HNH endonuclease	D2XR61	Bacillus_phage	2.7e-53	91.0
WP_089607201.1\|381998_382310_+\|terminase	terminase	D2XR14	Bacillus_phage	6.1e-39	84.3
WP_089607202.1\|382306_383974_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	7.0e-299	89.9
WP_016125870.1\|383982_385128_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	3.4e-180	81.6
WP_086421921.1\|385127_385871_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.9e-131	98.0
WP_044796924.1\|385874_387029_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	1.4e-202	92.7
WP_086404942.1\|387034_387328_+	hypothetical protein	D2XR19	Bacillus_phage	2.6e-39	82.5
WP_086404943.1\|387329_387704_+\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	1.1e-58	89.5
WP_089607203.1\|387691_388129_+	hypothetical protein	A0A2H4JBV5	uncultured_Caudovirales_phage	1.8e-73	91.0
WP_000787877.1\|388125_388488_+	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	3.2e-55	84.2
WP_089607204.1\|388503_389088_+\|tail	phage tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	2.8e-101	94.3
WP_086404946.1\|389144_389519_+	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	1.1e-53	86.8
WP_089607205.1\|389683_394681_+\|tail	phage tail protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	80.8
392099:392117	attR	NA	NA	NA	NA
WP_089607206.1\|394720_396178_+\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	3.2e-170	58.7
WP_089607207.1\|396174_400635_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	50.7
WP_089607208.1\|400650_401025_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	5.8e-36	65.3
WP_000398730.1\|401116_401353_+	hypothetical protein	A0A0A7AQY5	Bacillus_phage	2.5e-08	97.4
WP_000461723.1\|401352_401592_+	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.2e-34	98.7
WP_089607209.1\|401588_402653_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	5.1e-202	96.9
WP_089607210.1\|402714_403068_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	1.5e-09	31.6

DBSCAN-SWA_3

1835457 : 1844073

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755513.1\|1835457_1836744_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5
WP_001194306.1\|1836843_1837608_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_088344181.1\|1837848_1839609_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-271	97.7
WP_016124455.1\|1839694_1840372_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-121	98.2
WP_142292887.1\|1840368_1841442_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.5e-185	97.2
WP_006929137.1\|1841466_1842060_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|1842250_1842970_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_089607386.1\|1843260_1844073_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	2.1e-62	45.5

DBSCAN-SWA_4

2042363 : 2070127

Bacillus_phage(35.29%)

terminase,integrase,portal,head,capsid

attL 2051565:2051580|attR 2068371:2068386

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089607420.1\|2042363_2043500_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6A8	Bacillus_phage	9.0e-64	40.5
WP_089607421.1\|2043538_2044039_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	1.1e-26	42.2
WP_089607422.1\|2044531_2045608_-	hypothetical protein	NA	NA	NA	NA
WP_089607423.1\|2045588_2046134_-	hypothetical protein	NA	NA	NA	NA
WP_089607424.1\|2046163_2047381_-	hypothetical protein	NA	NA	NA	NA
WP_089607425.1\|2047538_2047895_-	helix-turn-helix transcriptional regulator	A0A059T669	Listeria_phage	4.0e-10	37.5
WP_089607426.1\|2048083_2048299_+	helix-turn-helix domain-containing protein	A8ATX6	Listeria_phage	5.9e-09	46.0
WP_089607427.1\|2048318_2048618_+	DNA-binding protein	NA	NA	NA	NA
WP_089607428.1\|2048685_2049201_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	2.3e-11	24.7
WP_089607429.1\|2049231_2049453_+	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_017673354.1\|2049628_2049913_+	hypothetical protein	D2XR42	Bacillus_phage	6.0e-25	55.3
WP_089607430.1\|2050031_2051009_+	DnaD domain protein	A6M985	Geobacillus_virus	4.0e-52	44.6
WP_089607431.1\|2051019_2051382_+	cell division protein SepF	D2XR47	Bacillus_phage	9.2e-47	75.0
WP_050821784.1\|2051453_2051645_+	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	2.4e-14	65.1
2051565:2051580	attL	NA	NA	NA	NA
WP_088119525.1\|2051680_2051866_+	hypothetical protein	NA	NA	NA	NA
WP_089607432.1\|2052322_2053186_-	exosporium protein D	NA	NA	NA	NA
WP_089607433.1\|2053474_2054095_-	exosporium leader peptide-containing protein	NA	NA	NA	NA
WP_001109248.1\|2054375_2054840_-	hypothetical protein	NA	NA	NA	NA
WP_089607434.1\|2055741_2056170_+	hypothetical protein	NA	NA	NA	NA
WP_089607435.1\|2057447_2057912_+	ArpU family transcriptional regulator	D2XR57	Bacillus_phage	2.3e-74	92.9
WP_089607436.1\|2057911_2058454_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	5.0e-89	92.2
WP_089607789.1\|2059077_2060472_+	exo-alpha-sialidase	NA	NA	NA	NA
WP_089607437.1\|2061753_2061960_-	hypothetical protein	NA	NA	NA	NA
WP_089607438.1\|2062717_2063116_+	CHRD domain-containing protein	A0A2K9L200	Tupanvirus	2.7e-15	38.8
WP_089607439.1\|2063181_2063361_+	hypothetical protein	NA	NA	NA	NA
WP_089607440.1\|2063382_2064231_+\|terminase	terminase	A0A0A8WJN3	Clostridium_phage	3.4e-31	47.3
WP_089607441.1\|2064223_2065630_+	DEAD/DEAH box helicase family protein	A0A0A8WEW2	Clostridium_phage	4.4e-169	63.2
WP_089607442.1\|2065699_2067175_+\|portal	phage portal protein	NA	NA	NA	NA
WP_089607443.1\|2067288_2067807_+\|head	phage head morphogenesis protein	Q1WDG7	Streptomyces_phage	8.4e-09	34.4
WP_089607444.1\|2067920_2069123_+	hypothetical protein	A0A1B1IMM2	Lactococcus_phage	2.6e-37	33.3
2068371:2068386	attR	NA	NA	NA	NA
WP_089607445.1\|2069140_2070127_+\|capsid	major capsid protein	H7BVA6	unidentified_phage	8.6e-71	43.9

DBSCAN-SWA_5

2489051 : 2553342

Bacillus_phage(61.54%)

protease,bacteriocin,tail,tRNA,holin,terminase,integrase,portal,head,capsid

attL 2529903:2529919|attR 2551964:2551980

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025687952.1\|2489051_2490605_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_025687953.1\|2490664_2491093_-	cell wall hydrolase	NA	NA	NA	NA
WP_025687954.1\|2491617_2492427_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000239008.1\|2493356_2494064_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-22	29.6
WP_002183605.1\|2494060_2495044_+	sensor histidine kinase	NA	NA	NA	NA
WP_025689175.1\|2495280_2495907_-	hypothetical protein	NA	NA	NA	NA
WP_000661373.1\|2496615_2498244_+	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	7.8e-53	34.3
WP_000343078.1\|2498264_2498849_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000404284.1\|2499107_2499878_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-33	40.4
WP_000144180.1\|2499852_2501784_+	ABC transporter permease	NA	NA	NA	NA
WP_000831672.1\|2501851_2502520_+	hypothetical protein	NA	NA	NA	NA
WP_001165495.1\|2502596_2502938_-	DUF3914 domain-containing protein	NA	NA	NA	NA
WP_000517071.1\|2503216_2504458_+	lipase	NA	NA	NA	NA
WP_025687518.1\|2504545_2505571_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_000471644.1\|2505660_2507109_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_000690435.1\|2507113_2508028_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_089607483.1\|2509425_2509689_+	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_001071364.1\|2510244_2510565_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_025687515.1\|2511054_2511540_+	hypothetical protein	NA	NA	NA	NA
WP_063536437.1\|2511851_2512553_+	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_089607484.1\|2512591_2513701_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	2.2e-147	79.4
WP_089607485.1\|2514306_2515515_+	hypothetical protein	D2XQ10	Bacillus_virus	1.4e-75	43.6
WP_000367267.1\|2515960_2516311_-	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	1.4e-15	37.1
WP_001192731.1\|2516497_2516722_+	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	4.7e-09	45.1
WP_000522182.1\|2516762_2517029_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	3.2e-28	75.3
WP_089607487.1\|2517404_2518388_+	DnaD domain protein	D2XR43	Bacillus_phage	8.3e-66	50.2
WP_089607488.1\|2518391_2518670_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.0e-13	61.7
WP_089607489.1\|2518662_2519022_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.4e-31	52.5
WP_080470708.1\|2519041_2519209_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	9.5e-15	66.0
WP_089607490.1\|2519234_2519486_+	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	5.8e-16	50.0
WP_089607491.1\|2519505_2519961_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	2.9e-21	49.1
WP_157797766.1\|2522351_2523581_+	collagen-like repeat preface domain-containing protein	A0A285PXU9	Cedratvirus	4.0e-17	37.3
WP_089607493.1\|2523901_2524156_+	hypothetical protein	A0A1B1P779	Bacillus_phage	7.4e-35	78.3
WP_001010967.1\|2524337_2524802_-	hypothetical protein	NA	NA	NA	NA
WP_157797767.1\|2524995_2525787_-	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	1.5e-17	37.1
WP_089607495.1\|2525969_2526434_-	exosporium protein D	NA	NA	NA	NA
WP_089607496.1\|2527337_2527541_+	hypothetical protein	A0A0C5ABQ7	Bacteriophage	4.3e-17	64.2
WP_089607497.1\|2528058_2528253_+	hypothetical protein	NA	NA	NA	NA
WP_089607498.1\|2529114_2529771_+	hypothetical protein	NA	NA	NA	NA
2529903:2529919	attL	NA	NA	NA	NA
WP_089607500.1\|2530128_2530611_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	7.2e-71	82.5
WP_157797768.1\|2530698_2531145_+\|integrase	tyrosine-type recombinase/integrase	A0A0S2GLG4	Bacillus_phage	8.4e-66	85.8
WP_044797993.1\|2531419_2531878_+	hypothetical protein	NA	NA	NA	NA
WP_157797745.1\|2532476_2532581_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_089607502.1\|2532606_2532747_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_089607793.1\|2532851_2533262_+	hypothetical protein	NA	NA	NA	NA
WP_089607503.1\|2533675_2533903_+	hypothetical protein	D2XR60	Bacillus_phage	6.2e-25	83.1
WP_089607504.1\|2534075_2534411_+	alpha/beta hydrolase	D2XR61	Bacillus_phage	1.5e-51	87.4
WP_016125621.1\|2534530_2534842_+	hypothetical protein	D2XR14	Bacillus_phage	1.6e-39	87.3
WP_089607505.1\|2534838_2536524_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	4.6e-274	85.3
WP_089607506.1\|2536544_2537696_+\|portal	phage portal protein	A8AT96	Listeria_phage	2.4e-104	51.1
WP_089607507.1\|2537685_2538411_+\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	1.3e-44	53.2
WP_089607508.1\|2538437_2539604_+\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	1.6e-161	77.7
WP_016125626.1\|2539616_2539910_+	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	2.4e-37	78.4
WP_023522880.1\|2539911_2540262_+\|head	phage head closure protein	D2XR20	Bacillus_phage	1.9e-52	87.8
WP_088054432.1\|2540263_2540605_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	1.8e-52	93.8
WP_089607509.1\|2540604_2540934_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	9.3e-54	93.6
WP_001004915.1\|2540934_2541522_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	1.9e-86	81.0
WP_089607510.1\|2541526_2541889_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	5.4e-55	88.3
WP_089607512.1\|2542119_2545740_+	DUF2207 domain-containing protein	A0A2H4JAI2	uncultured_Caudovirales_phage	4.1e-187	85.6
WP_089607513.1\|2545781_2547245_+\|tail	phage tail protein	A0A0S2MV63	Bacillus_phage	5.1e-168	59.1
WP_089607514.1\|2547241_2551564_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	58.6
WP_089607515.1\|2551575_2551956_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.3e-48	79.2
WP_089607516.1\|2551990_2552410_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	9.9e-69	96.5
2551964:2551980	attR	NA	NA	NA	NA
WP_089607517.1\|2552409_2553342_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	2.1e-167	89.4

DBSCAN-SWA_6

4521143 : 4527571

uncultured_Caudovirales_phage(33.33%)

capsid,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089607803.1\|4521143_4521341_-	hypothetical protein	R9TQ08	Paenibacillus_phage	1.9e-17	67.2
WP_087948521.1\|4521522_4521705_-	hypothetical protein	A0A2H4J841	uncultured_Caudovirales_phage	5.9e-10	80.0
WP_089607664.1\|4521701_4521947_-	hypothetical protein	A0A1B1P7N2	Bacillus_phage	5.3e-30	84.0
WP_089607665.1\|4522143_4522803_-	hypothetical protein	NA	NA	NA	NA
WP_089607666.1\|4522807_4523506_-	hypothetical protein	NA	NA	NA	NA
WP_089607667.1\|4523869_4525048_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	3.1e-91	43.4
WP_089607668.1\|4525087_4525795_-	hypothetical protein	NA	NA	NA	NA
WP_089607669.1\|4525975_4526935_-\|capsid	phage major capsid protein	A0A2H4J9Y4	uncultured_Caudovirales_phage	6.2e-66	43.0
WP_089607670.1\|4526968_4527571_-\|head,protease	HK97 family phage prohead protease	U5U3W0	Lactobacillus_phage	2.6e-14	28.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022446

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022445

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection