CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022515	Arenibacter algicola strain SMS7 chromosome, complete genome	8 crisprs	casR,RT,cas3,DEDDh,csa3,WYL	2	2	3	1
NZ_CP022516	Arenibacter algicola strain SMS7 plasmid pSMS7, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022515_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_1

262499-262607

Orphan

Consensus_repeat	Method
TGAGAATTGAGTAGTGAGAAAAAAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_1

>merge|NZ_CP022515|1|262499-262607|CRISPRCasFinder
TGAGAATTGAGTAGTGAGAAAAAAGAATCTAGAGGCTGGAAGAGATTACAGTGAACAGTCTTCAGTTTTCAGTACACAGTATTGAGAATTGAGTAGTGAGAGAAAAGAA

>NZ_CP022515|1|1|262499-262607|CRISPRCasFinder
TGAGAATTGAGTAGTGAGAAAAAAGAA	TCTAGAGGCTGGAAGAGATTACAGTGAACAGTCTTCAGTTTTCAGTACACAGTAT
TGAGAATTGAGTAGTGAGAGAAAAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093976936.1\|268130_268625_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP022515.1\|WP_093976939.1\|270675_270939_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP022515.1\|WP_157730610.1\|254277_254757_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein-subunit	unknown	unknown	gnl\|CDD\|133459
NZ_CP022515.1\|WP_093976925.1\|249788_250433_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093980427.1\|271243_271756_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP022515.1\|WP_093976930.1\|257881_258748_+\|acyl-CoA-thioesterase-II	unknown	unknown	gnl\|CDD\|224857
NZ_CP022515.1\|WP_093976926.1\|250566_252528_-\|Sec-dependent-nitrous-oxide-reductase	unknown	unknown	gnl\|CDD\|275078
NZ_CP022515.1\|WP_093976932.1\|263547_264837_+\|DUF1593-domain-containing-protein	unknown	unknown	gnl\|CDD\|377887
NZ_CP022515.1\|WP_031445034.1\|260577_261792_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|176459
NZ_CP022515.1\|WP_093976938.1\|270382_270676_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093976927.1\|253162_253669_-\|cytochrome-c	unknown	unknown	gnl\|CDD\|365823
NZ_CP022515.1\|WP_093976931.1\|262699_263332_-\|7-carboxy-7-deazaguanine-synthase-QueE	unknown	unknown	gnl\|CDD\|223675
NZ_CP022515.1\|WP_093976929.1\|256295_257837_+\|acyl-CoA-carboxylase-subunit-beta	unknown	unknown	gnl\|CDD\|227136
NZ_CP022515.1\|WP_093976934.1\|265835_266978_-\|IS91-family-transposase	unknown	unknown	gnl\|CDD\|377437
NZ_CP022515.1\|WP_093976933.1\|265070_265538_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730612.1\|259336_259474_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_031445027.1\|252562_253144_-\|fasciclin-domain-containing-protein	unknown	unknown	gnl\|CDD\|225214
NZ_CP022515.1\|WP_093980426.1\|254770_256246_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	unknown	unknown	gnl\|CDD\|227111
NZ_CP022515.1\|WP_093976935.1\|266980_267736_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271193
NZ_CP022515.1\|WP_093976937.1\|268750_268990_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093976939.1\|270675_270939_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.82292e-13
NZ_CP022515.1\|WP_157730610.1\|254277_254757_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein-subunit	gnl\|CDD\|133459	cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase. This domain functions in transferring CO2 from one subsite to another, allowing carboxylation, decarboxylation, or transcarboxylation. During this process, biotin is covalently attached to a specific lysine.	6.60154e-22
NZ_CP022515.1\|WP_093976930.1\|257881_258748_+\|acyl-CoA-thioesterase-II	gnl\|CDD\|224857	COG1946, TesB, Acyl-CoA thioesterase [Lipid metabolism].	3.40155e-109
NZ_CP022515.1\|WP_093976926.1\|250566_252528_-\|Sec-dependent-nitrous-oxide-reductase	gnl\|CDD\|275078	TIGR04246, nitrous_NosZ_Gp, nitrous-oxide reductase, Sec-dependent. This model represents the nitrous-oxide reductase protein NosZ as characterized in Geobacillus thermodenitrificans. In contrast to the related form in Pseudomonas stutzeri, this version lacks a recognizable twin-arginine translocation (TAT) signal at the N-terminus. Consequently, its accessory protein may differ. Some members of this family have an additional cytochrome c-like domain at the C-terminus.	0
NZ_CP022515.1\|WP_093976934.1\|265835_266978_-\|IS91-family-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	3.33455e-70
NZ_CP022515.1\|WP_031445034.1\|260577_261792_+\|DNA-polymerase-IV	gnl\|CDD\|176459	cd03586, PolY_Pol_IV_kappa, DNA Polymerase IV/Kappa. Pol IV, also known as Pol kappa, DinB, and Dpo4, is a translesion synthesis (TLS) polymerase. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Known primarily as Pol IV in prokaryotes and Pol kappa in eukaryotes, this polymerase has a propensity for generating frameshift mutations. The eukaryotic Pol kappa differs from Pol IV and Dpo4 by an N-terminal extension of ~75 residues known as the "N-clasp" region. The structure of Pol kappa shows DNA that is almost totally encircled by Pol kappa, with the N-clasp region augmenting the interactions between DNA and the polymerase. Pol kappa is more resistant than Pol eta and Pol iota to bulky guanine adducts and is efficient at catalyzing the incorporation of dCTP. Bacterial pol IV has a higher error rate than other Y-family polymerases.	2.11068e-120
NZ_CP022515.1\|WP_093976927.1\|253162_253669_-\|cytochrome-c	gnl\|CDD\|365823	pfam00034, Cytochrom_C, Cytochrome c. The Pfam entry does not include all Prosite members. The cytochrome 556 and cytochrome c' families are not included. All these are now in a new clan together. The C-terminus of DUF989, pfam06181, has now been merged into this family.	4.78704e-13
NZ_CP022515.1\|WP_093976931.1\|262699_263332_-\|7-carboxy-7-deazaguanine-synthase-QueE	gnl\|CDD\|223675	COG0602, NrdG, Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones].	1.1915e-38
NZ_CP022515.1\|WP_093976929.1\|256295_257837_+\|acyl-CoA-carboxylase-subunit-beta	gnl\|CDD\|227136	COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism].	0
NZ_CP022515.1\|WP_093976936.1\|268130_268625_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	6.58766e-05
NZ_CP022515.1\|WP_093980427.1\|271243_271756_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.12344e-10
NZ_CP022515.1\|WP_031445027.1\|252562_253144_-\|fasciclin-domain-containing-protein	gnl\|CDD\|225214	COG2335, COG2335, Secreted and surface protein containing fasciclin-like repeats [Cell envelope biogenesis, outer membrane].	3.52399e-38
NZ_CP022515.1\|WP_093980426.1\|254770_256246_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
NZ_CP022515.1\|WP_093976935.1\|266980_267736_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271193	cd01193, INT_IntI_C, Integron integrase and similar protiens, C-terminal catalytic domain. Integron integrases mediate site-specific DNA recombination between a proximal primary site (attI) and a secondary target site (attC) found within mobile gene cassettes encoding resistance or virulence factors. Unlike other site specific recombinases, the attC sites lack sequence conservation. Integron integrase exhibits broader DNA specificity by recognizing the non-conserved attC sites. The structure shows that DNA target site recognition are not dependent on canonical DNA but on the position of two flipped-out bases that interact in cis and in trans with the integrase. Integron-integrases are present in many natural occurring mobile elements, including transposons and conjugative plasmids. Vibrio, Shewanella, Xanthomonas, and Pseudomonas species harbor chromosomal super-integrons. All integron-integrases carry large inserts unlike the TnpF ermF-like proteins also seen in this group.	2.30518e-61
NZ_CP022515.1\|WP_093976932.1\|263547_264837_+\|DUF1593-domain-containing-protein	gnl\|CDD\|377887	pfam07632, DUF1593, Protein of unknown function (DUF1593). A family of proteins in Rhodopirellula baltica that are predicted to be secreted. Also, a member has been identified in Caulobacter crescentus. These proteins mat be related to pfam01156.	3.14399e-88

>NZ_CP022515.1|WP_031445034.1|260577_261792_+|DNA-polymerase-IV
MNKTILHLDLDTFFVSVERLQDSKLEHRPILVGGVSDRGVVAACSYETRGFGVHSGMPMKMAKELCPEAIIIKGNAGTYSKHSDIVTDIIKEQVPVFEKSSIDEFYADLTGMDRFYGCHQFSTELRHKIIKETGLPISFGLSVNKVVSKVATNEAKPNNELKIDIGHEKPFLAPLSIKKIPMVGDKTYQTLRNLGLRQIKTIQEMPMDMMQRVLGANGGVIWKRANGIDNTPVIPFSERKSISTERTFERDTIDVIKLRGILIAMTENLAYQLRRGKKLTACIAVKIRYSDFNTYSKQLKIPYTSADHILIPKILDLFNTLYNKRLLIRLIGIRFSHLVQGNYQIDLFDDTEEILNLYNALDKIRERYGDKSVIRASGMGAKTIGRMHNPFNGQPPIVLAHRKQ
>NZ_CP022515.1|WP_157730612.1|259336_259474_+|hypothetical-protein
MQYLRELLVGKSDGIEVPMTLKLLLILVFLCFFLALFSILLYTFE
>NZ_CP022515.1|WP_093976930.1|257881_258748_+|acyl-CoA-thioesterase-II
MSNLEELIELLTLERINDNTFVGQNYQAPWGRVFGGQVLGQSLHAAYQTVADDRIAHSMHGYFILGGDLSIPITYEVDYLRDGRSFTTRRVVAKQNGKAIFNMAASFQVPEEGVEHQMTMPNLITPKKLMNSLEQIEEMKTTDPDSYNLIKLTHPKVFEFKPVERLTALLAKDGPPFNHMWMRATEKVNADLPLQQQLLAYASDYNILTTASLPHREELRKGKTFYASIDHAIWFHRNFKIDEWLLYTMDSPSACNSRGFSRGSIFDRNGVLVASVAQEGLMRSTQVG
>NZ_CP022515.1|WP_093976929.1|256295_257837_+|acyl-CoA-carboxylase-subunit-beta
MNDKIKKLEDKIAQAKLGGGQKRIETQHSKGKLTARERIHFLLDEGSFEELGALVTHRTKDFGMGKQIFYGDGVVTGYGTINGRQVCVFAQDFTVFGGSLSETHAEKICKVMDMAMKIGVPIIGLNDSGGARIQEGVRSLGGYADIFHRNVMASGVIPQISAIMGPCAGGAVYSPAMTDFTLMVENSSYMFVTGPNVVKTVTNEAMSSEELGGAMTHATKSGVTHFTAENDLECLEQIKELVGYLPQNCEDTPKSLPYSLNTEIREKLETIIPENANQPYDMRHIINEIIDESPFLEVHKHYAENIVVGFARLAGKSIGIVANQPMSLAGVLDVNSSKKAARFTRCCDCFNIPLLVLVDVPGFLPGTDQEWNGIITNGAKLLYALSEATVPKVTVITRKAYGGAYDVMNSKHIGADLNYAWPGAEIAVMGAKGASEIIFRKEIDSAEDPEAKLKEKEEEYADKFANPYSAAERGFIDEVILPKDTRRKLIKAFALLENKVVHLPKKKHGNIPL
>NZ_CP022515.1|WP_093980426.1|254770_256246_+|acetyl-CoA-carboxylase-biotin-carboxylase-subunit
MNKILVANRGEIALRIMRTAQKMGIKTVAVYSDADREAPHVRFADEAVHIGNSPSSESYLNMDKIVEAALKTKSQAIHPGYGFLSENAVFAQLVTDNGITFIGPNPYAIKVMGNKLEAKEAVKGYNIPMVPGIEESITDISLARKVSEQIGFPILIKASAGGGGKGMRVVQQPSELPEQMERAISEAKAAFGDGSVFLEKYIECPRHIEIQILADTYGNIIHLFERECSIQRRHQKVVEEAPSAVLTPKIRAAMGEAAIKVAKACDYVGAGTVEFLLDSDKNFYFLEMNTRLQVEHPVTELITGIDLVEQQIKIARNEKLEFSQEDLSIKGHALEVRVYAEDPLDNFLPSMGTLETYIRPKGKGIRLDDGFEEGMTIPIYYDPMLAKLITYGKDREEAIQLMIGAISEYKIKGISTTLPFGKFVCEHQAFSSGEFDTHFVKNYYTPELLLQQYTDEREIAAMVGLKLFLEHRDKLKVPNNENSNWALKRTK
>NZ_CP022515.1|WP_157730610.1|254277_254757_+|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein-subunit
MANYDITIDKEKFILSSKDIASLDIVPIGNQQFHALRQDRSYKIKILNTDFANKTITIEVNGNSYEMVLADEYDQMVDKMGLLSAKTHKINNIKAPMPGLIIDVMASIGQKVESGTPLIVLSAMKMENIITSQGEGIIKSINVQVNDAVDKGQLIIEME
>NZ_CP022515.1|WP_093976927.1|253162_253669_-|cytochrome-c
MKIILKSSAVLFSVLMMSCGGKEEKKKEGFSVDRAKTTTEQPAPAPAATDTKPSETVDLTNKGVGPITSVSLAAEVDQEMAKKGEEVYNKMCLACHRVDKKFIGPAPKGILERRSPEWVMNMILNPEVMVKEDPLAKALLAEFNGAPMANQSLTEEEARAVLEYFRTL
>NZ_CP022515.1|WP_031445027.1|252562_253144_-|fasciclin-domain-containing-protein
MFPTTNLKSFMLSFLMLGVLFSCKNEAKTATNPTQDNAGTEEVEKQGQAFIEDDGSTPNVLQIAIGSPDHTTLVAAVQAAELENALVNAGPLMVFAPTNEAFAALPEGTVEDLLKPENKAALANILKYHVTAGNYSKEFLMKFKKLGQANDQNVTVEVVGDDVLVGGAKILASVPAGNGIVHVVDKVILPPTE
>NZ_CP022515.1|WP_093976926.1|250566_252528_-|Sec-dependent-nitrous-oxide-reductase
MKKYTYLVLGLLGFTALLTSCGNGNQGKSSSGALNSSNAEKVYVAPGEHDEFYAFMSGGYSGNLTVYGLPSGRMFKEIPVFSQFPTSGYGYSEETKPMLNTSHGFVPWDDSHHPDISQTNGELDGRWIFINGNNTPRIARISLSTFETEEIIEVPNSAGNHSSSFVTENTEYVVAGTRFSVPIPQRDMPINQYKGNFQGSLSFISVDPEHGHMDIKFQIIMPGFNYDLSHPGRGKSHGWFFFTTYNTEEASTLQEVNSSQNDKDFIAAINWKKVEEYVNNGGGTKMPANYAHNVYDESTHTATTTMKKEVVTVNPLDVPGAVFFLPTPKSPHGCDVDPTGQYIIGNGKLSADLTIHSFDNMIAAIEGKKFDGEAYGIPILKFEDVLAGTVKSGGLGPLHTEFDGAGNAYTTFFISSEVVKWKLGTWEVIDRKPTYYSVGHLMIPGGNSRKPFGKYVVALNKITKDRYLPVGPEMEHSAQIYDISGDKMELLYDFPTHGEPHYAAGIPAELLAPKSKKFYKLADNKHPYATLGAADAKVVRDGKDVHIYMSTIRSHFTPDNIEGVKVGDKVYFHITNQEQDFDVPHGFAVIGANNSELLIMPGQTKTLVWEPKKVGVWPFYCTDFCSALHQEMQGYVRVSPANSNLELSWSLGD
>NZ_CP022515.1|WP_093976925.1|249788_250433_-|hypothetical-protein
MKNASLIMIIGPLFLLGLFAFPLWNIMLGAPQYPDPLGMNIHISGIEGVSEFDLQNIDGLNHYIGMKTIPKSGEMWEFDVFPKVIIGMMVLGVLIGLLGFFGKVDFKWFLGWFVLMSVLGVLGMYDFNEWLTDYGSNLDPHAIIKVVNEDGTPMTYKPPLLGYQKMLNFDVTSLPSVGAYMMFIGMSLTLVASYMGWKSKGTKVKQQSKKAVAA
>NZ_CP022515.1|WP_093976931.1|262699_263332_-|7-carboxy-7-deazaguanine-synthase-QueE
MVKEDVLALVDQGLMLPLMEEFYTIQGEGFHKGTAAYFIRVGGCDVGCHWCDVKESWNAETHPPTGIDHIVTNAAKYSDTIVITGGEPLTWDMGPLTEALKAKNLKTHIETSGAYPLTGTWDWICLSPKKNKLPEGIIYDKAHELKMIVYNKHDFIFAEEQAAKTNKDCILYLQPEWSVRDKVVPWIVEYVMQNPKWKVSLQTHKYLNIP
>NZ_CP022515.1|WP_093976932.1|263547_264837_+|DUF1593-domain-containing-protein
MKKTILMICLGFVATQVVAQEPVPIKPRVLISTDIGGTDPDDNQSMTHLLMYSDFIKLEGLVSSPSYGQGSKEEILRMINLYEKDFPKLQGHNKDLAEPDYLRSITKQGRKGGAPFRGYQTSTEGSEWIIKCAKEKNDQPLWVLVWGGLEDLAQALHDSPEIRNRIKVYWIGGPNKKWSANSYAYIVENFPDLWFIEVNSSYYGFFSDNNVPDSVKSSDYYDRYINEAGHLGKDFKNYYNGEIKMGDTPSLLYMLDGNPDKPMRESWGGSFEKINHSPRIVFNKPSSLKDTVAFCSILEFHLQGPKTNIPKDSVCFWMEVPYGKSVQKWPGYHLGNGEYVIRYIPKKAETLHYKFTSEIPELDALEGSMVVDNHWPGKKHESDYLLGNNWYSDKSDKEFYDGKLQGGKTIQKWRTNVLMDWAERWNWLR
>NZ_CP022515.1|WP_093976933.1|265070_265538_+|hypothetical-protein
MKNLTLLAVLLLGFASFAQIPSETSKFYLSDKEQPLLVINDDIIASVEVLRNVKTDNLTKLDISKDGVLSQTSLFPMDKKTKGIIRGDINIDLDTKTQSELNSFFGLNPTNDIYVNGYLLEDKEQTISTLSIKTIDLRKADGLILKTPSLNITIE
>NZ_CP022515.1|WP_093976934.1|265835_266978_-|IS91-family-transposase
MERAAYEVAQVLERNREQLAGLCANSWQLRTLHALRKCRTAALGGHIDCCDNPGCHKLHLSYNSCRNRHCPKCQGHKREQWIRAREAELLNVPYFHVVFTLPSELNRICLYDPKTIYNLLFATAWQVIKGFSSNPNFMGADPGMVAILHTWGQNLSLHPHLHCIVPGGGTTRSGKWKSARNKGKYLFPVKAMSKVFRARFVASLHKEFPPQPTAFYENLFKHNWVVYCKRPFLGPAQVVEYLGRYTHKIAISDHRIKSLDNNNVTFTVKDYRHGGRKSLLRLTDAEFVRRFALHILPKGFVRIRHYGILSSSRKKALVPLLQQVLGGPVPNGRPPLKHRRCPYCQIGIMATVAVFDGRGPPKARSDRLKKSAPRTTLQEA
>NZ_CP022515.1|WP_093976935.1|266980_267736_-|tyrosine-type-recombinase/integrase
MAIHFKCSPLDLDEEQILDYLHILKSQHRTPSESFFKHTVYGLRYAYRISGMKEMRVILPSIERPKKLPVVLGHNEVRQLLKAPKLLKHRLVLAMLYGCGLRSFELCNLQLKDLDLERKMLHVRQGKGRKDRYVPLCAMQVRGLRKYISAERPVTWCFNGNDSKGGPVALSARGVQWIVKEARKHSGIQKEVTTHSLRHSYATHLLEMGLDIMSVKDLLGHADIQTTLTYLHVAQLGRQRPFSPLERLYNK
>NZ_CP022515.1|WP_093976936.1|268130_268625_+|GNAT-family-N-acetyltransferase
MPELKFHILTANDKEYFDLIAGWYLNEWNIPIDKTRQNLEKVTNNNLEFHVIMTWGGKPISTGGIHNHVGLLDKAPKLKIHKNWLALVYTIPEHRQKGFGAMICEFIQNHSKVLGIEHLHLYTDTAERLYNRLGWTAIERLQIGSRNIVVMDKITKLKPAANTV
>NZ_CP022515.1|WP_093976937.1|268750_268990_+|hypothetical-protein
MKIQEILVKLDTENKYIGFQLSKRNGLINSTWLLYKKDLAYYFFDINQKIEFNDANKYSSSELLNELGKASFEIELSIN
>NZ_CP022515.1|WP_093976938.1|270382_270676_-|hypothetical-protein
MSRKHSFKLTLSNNVTEKQGINYLVEEQTGFFKIDKLMKKELLDKVNIPHNFLQSFDMVYIPKLKGIEFDKGYIETHLDEILFIELKTTKKYLPENL
>NZ_CP022515.1|WP_093976939.1|270675_270939_-|helix-turn-helix-transcriptional-regulator
MINNFLLKEFGDRVRHLRTQENLSQEQLSYKTGFHRTYIGMIERGERNISLTNMAIFAKAFDLTIDELLKFNNSKELLKQYKLKTED
>NZ_CP022515.1|WP_093980427.1|271243_271756_+|GNAT-family-N-acetyltransferase
MQIIKATIEHSAIIAEIGKQAFWESHGHSASKEDIDSFISKNYNKEAITKEFENTNVHYLLVQFHDKIAGFSKIELSTPNQNISEPNITKLDRLYLLKEFYGKNLGTGLFKATIEISKQNHQQGIWLAVWKENPKAIHFYTKTGFKIVGEYNFKISETHFNPNHIMYLKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_3

1779604-1779676

Orphan

Consensus_repeat	Method
GGTTTTTGAAACCTTGCAGGTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_3

>merge|NZ_CP022515|3|1779604-1779676|CRISPRCasFinder
GGTTTTTGAAACCTTGCAGGTCTTGCCTCCTCTCAACCTGGCGCGTCCTGGGTTTTGGAAACCTTGCAGGTCT

>NZ_CP022515|3|3|1779604-1779676|CRISPRCasFinder
GGTTTTTGAAACCTTGCAGGTCT	TGCCTCCTCTCAACCTGGCGCGTCCTG
GGTTTTGGAAACCTTGCAGGTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093977853.1\|1776536_1776923_-\|Sec-C-motif-domain-protein	unknown	unknown	gnl\|CDD\|380015
NZ_CP022515.1\|WP_093977857.1\|1781720_1782392_-\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|119440
NZ_CP022515.1\|WP_093977847.1\|1768683_1770888_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173791
NZ_CP022515.1\|WP_093977860.1\|1785934_1786699_+\|ThuA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377643
NZ_CP022515.1\|WP_093977854.1\|1777162_1778065_-\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|376494
NZ_CP022515.1\|WP_093977858.1\|1782428_1783340_-\|hydroxymethylbilane-synthase	unknown	unknown	gnl\|CDD\|234612
NZ_CP022515.1\|WP_093977862.1\|1788751_1789534_+\|glycoside-hydrolase-family-16-protein	unknown	unknown	gnl\|CDD\|185683
NZ_CP022515.1\|WP_031446247.1\|1780604_1781636_-\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|238368
NZ_CP022515.1\|WP_093977848.1\|1770914_1771628_-\|3'-5'-exonuclease	unknown	unknown	gnl\|CDD\|99825
NZ_CP022515.1\|WP_093977850.1\|1772407_1773529_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP022515.1\|WP_031446255.1\|1789612_1790059_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP022515.1\|WP_093977856.1\|1779680_1780430_-\|EI24-domain-containing-protein	unknown	unknown	gnl\|CDD\|377798
NZ_CP022515.1\|WP_093980504.1\|1773577_1774894_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP022515.1\|WP_093977859.1\|1783336_1784593_-\|glutamyl-tRNA-reductase	unknown	unknown	gnl\|CDD\|234592
NZ_CP022515.1\|WP_093977861.1\|1787364_1788330_-\|glycosylase	unknown	unknown	gnl\|CDD\|350119
NZ_CP022515.1\|WP_093977851.1\|1774904_1775417_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP022515.1\|WP_031446251.1\|1784797_1785688_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP022515.1\|WP_093977849.1\|1771934_1772408_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|234860
NZ_CP022515.1\|WP_093977852.1\|1775486_1776461_-\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|236450
NZ_CP022515.1\|WP_093977855.1\|1778850_1779423_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376616

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093977853.1\|1776536_1776923_-\|Sec-C-motif-domain-protein	gnl\|CDD\|380015	pfam17775, UPF0225, UPF0225 domain. This entry represents an NTF2-like domain found in bacterial proteins.	1.59177e-45
NZ_CP022515.1\|WP_093977857.1\|1781720_1782392_-\|uroporphyrinogen-III-synthase	gnl\|CDD\|119440	cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease.	1.47756e-36
NZ_CP022515.1\|WP_093977847.1\|1768683_1770888_+\|S8-family-serine-peptidase	gnl\|CDD\|173791	cd04842, Peptidases_S8_Kp43_protease, Peptidase S8 family domain in Kp43 proteases. Kp43 proteases are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution). Kp43 is topologically similar to kexin and furin both of which are proprotein convertases, but differ in amino acids sequence and the position of its C-terminal barrel. Kp43 has 3 Ca2+ binding sites that differ from the corresponding sites in the other known subtilisin-like proteases. KP-43 protease is known to be an oxidation-resistant protease when compared with the other subtilisin-like proteases.	1.14817e-46
NZ_CP022515.1\|WP_093977860.1\|1785934_1786699_+\|ThuA-domain-containing-protein	gnl\|CDD\|377643	pfam06283, ThuA, Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.	4.91851e-109
NZ_CP022515.1\|WP_093977854.1\|1777162_1778065_-\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|376494	pfam01218, Coprogen_oxidas, Coproporphyrinogen III oxidase.	0
NZ_CP022515.1\|WP_093977858.1\|1782428_1783340_-\|hydroxymethylbilane-synthase	gnl\|CDD\|234612	PRK00072, hemC, porphobilinogen deaminase; Reviewed.	2.62801e-106
NZ_CP022515.1\|WP_093977862.1\|1788751_1789534_+\|glycoside-hydrolase-family-16-protein	gnl\|CDD\|185683	cd00413, Glyco_hydrolase_16, glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.	3.81526e-40
NZ_CP022515.1\|WP_031446247.1\|1780604_1781636_-\|uroporphyrinogen-decarboxylase	gnl\|CDD\|238368	cd00717, URO-D, Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction is located at the branching point of the tetrapyrrole biosynthetic pathway, leading to the biosynthesis of heme, chlorophyll or bacteriochlorophyll. URO-D deficiency is responsible for the human genetic diseases familial porphyria cutanea tarda (fPCT) and hepatoerythropoietic porphyria (HEP).	3.61166e-178
NZ_CP022515.1\|WP_093977848.1\|1770914_1771628_-\|3'-5'-exonuclease	gnl\|CDD\|99825	cd05782, DNA_polB_like1_exo, Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.	3.85174e-63
NZ_CP022515.1\|WP_093977850.1\|1772407_1773529_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.01444e-61
NZ_CP022515.1\|WP_031446255.1\|1789612_1790059_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.71819e-16
NZ_CP022515.1\|WP_093977856.1\|1779680_1780430_-\|EI24-domain-containing-protein	gnl\|CDD\|377798	pfam07264, EI24, Etoposide-induced protein 2.4 (EI24). This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.	1.78501e-16
NZ_CP022515.1\|WP_093980504.1\|1773577_1774894_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	4.21988e-42
NZ_CP022515.1\|WP_093977859.1\|1783336_1784593_-\|glutamyl-tRNA-reductase	gnl\|CDD\|234592	PRK00045, hemA, glutamyl-tRNA reductase; Reviewed.	1.11039e-103
NZ_CP022515.1\|WP_093977861.1\|1787364_1788330_-\|glycosylase	gnl\|CDD\|350119	cd18607, GH130, Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.	5.07068e-11
NZ_CP022515.1\|WP_093977851.1\|1774904_1775417_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.5317e-06
NZ_CP022515.1\|WP_031446251.1\|1784797_1785688_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.82935e-26
NZ_CP022515.1\|WP_093977849.1\|1771934_1772408_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|234860	PRK00901, PRK00901, methylated-DNA--protein-cysteine methyltransferase; Provisional.	1.43244e-59
NZ_CP022515.1\|WP_093977852.1\|1775486_1776461_-\|porphobilinogen-synthase	gnl\|CDD\|236450	PRK09283, PRK09283, porphobilinogen synthase.	0
NZ_CP022515.1\|WP_093977855.1\|1778850_1779423_-\|hypothetical-protein	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	0.000603081

>NZ_CP022515.1|WP_093977855.1|1778850_1779423_-|hypothetical-protein
MKLEKLEQDCYYHIYNRGINGGPIFRSDENKRYFLRLIKKHLSDKVSILAYCLMDNHYHMAIQVIQEEQKVTQSFSNLFNAYAKAYNKMHDRTGSLFEKHFKRIKIQDTKYLRNLIIYINTNPEYHGVNNDYKKFEYSSYQTTIIDSNDAVLMPIAKEEVINLFEDIENFEYLHQQKMNLNLDLNALDLD
>NZ_CP022515.1|WP_093977854.1|1777162_1778065_-|oxygen-dependent-coproporphyrinogen-oxidase
MKDKFYAYIQQLQDTITAKLEAVDGLAKFKEDLWERPEGGGGRSRVIENGAVFEKGGVNISAVHGALPKSMQNYFGVQDADFFACGLSLVIHPKNPMVPTVHANWRYFEMYDKQGHLVDQWFGGGQDLTPYYLFDEDASHFHKVCKDACDKHNPDFYNTYKTKCDDYFWNTHRNEARGVGGLFYDYCKATDKMSMEDWYNFETEVGNSFLEAYVPIVEKRKDLPYSKEQRDWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQWVYDHHPDKGSEEERLLKVLEKPKDWV
>NZ_CP022515.1|WP_093977853.1|1776536_1776923_-|Sec-C-motif-domain-protein
MDCPCGSHKPYADCCGKAHKDISTATTAEQLMRSRYSAFVLGNGNYLMDSHHSSTRPVKEKKAIEAWAKSVSWIRLEVLDREKGEINDQNGTVTFNAYFFENGKVAVIHEKSEFVKEKGLWMYLGLAK
>NZ_CP022515.1|WP_093977852.1|1775486_1776461_-|porphobilinogen-synthase
MYPLRRNRRLRSNEAIRSLVRETIISPNDFLVPLFVVEGKGVKEEIASMPNYYRYSLDLLEKEVKELWAMGLKSVLLFVKVPDHLKDNKGKEAVNPKGLMQRAIKTVKNTCPDMLVMTDVALDPYSSYGHDGIVEDGQIVNDDTVEVLASMSVSHAEAGADFVAPSDMMDGRILSIREALEDEGFIDTGIMSYSAKYASAFYGPFRDALDSAPGFGDKKTYQMDYANRFEAIKETEMDIDEGADIVMVKPGLCYLDIVREIKNEVDVPLAVYQVSGEYAMVKAAAEKGWLDHDAVMMEQLTAIKRAGANIIASYFAKDVVRVLG
>NZ_CP022515.1|WP_093977851.1|1774904_1775417_-|DinB-family-protein
MKDFLFILIVLFMTPLHSQDIVIPAFLEKWENSKSYLVAIAEAMPQEKYDFKPTERQKDFQDQLLHIKSNMDWLSSTYFGRQLSETGSGNNSPLTKRETIKLLVDGFDGVSAILKNTSADVLSEKVEFFAGEKTKLQILNLLQDHVTHHRGQLIVYLNLNNIEPPKYVGW
>NZ_CP022515.1|WP_093980504.1|1773577_1774894_-|serine-hydrolase
MKKRNYTAIILLSIIFNTQLLSAQSPNPEALSYENPSAVGMDSLFIHSKVDSIMTFAIKEEAFPGAQVLVAKNSKIIFHKAYGFHTYDSVQPVSITDIYDLASVTKIMGPLPALMKLHDEGKLDLDAPFSTLWPKWKNRKDKKKLTIREVFAHQAGLVPYIIFLQEVMKKNGSVKNRFVRHEPSRRFNTKAYDNIYIKDRFRNKIYRKINSSKVSDIKKYKYSGLTFLLYPEIISKFTNTDYETYVTQNFYAPIGATTMGFNPKTKNYQNNIVPTEIDTLFRHELTKDWVHDENAALLGGVSGNAGLFASATDLAKIMQMYMNYGSYDGKRYLSEATVKEFTKVQYPENENRRGLIFDKPDLNNHELTLADSYPAPSASPDSFGHSGFTGTFVWADPKTQLVYIFLSNRVYPSRAHANIYKYNIRSAVQQVFYDAIID
>NZ_CP022515.1|WP_093977850.1|1772407_1773529_-|HlyC/CorC-family-transporter
MGLLIFYALISILVSFLCSILEAVLLSVPQTFINLKKKEGKSFAQELEALKKDVDKPLIAILTLNTIAHTVGAILVGVQAKIAYSELYGNTENTLLGMQFSEAAMVGLVSTIMTILILVASEIIPKTIGATYWKQLAHASTTALKIMVWALRWTGILWILQLFTRLVGKKGVHGSVFSREDFSAMTDIAHEEGVFQESESTIIRNLLHFDEIKVKDIMTPRAVVKIASESATIKEFYNANPKMPFSRIPVFNKKMDNITGFVLKDMILEEIIKKNGSAPLSSIKREILVSNRQTPIPELFETFISKREHIALVVDEYGSVSGVVTMEDILETLLGLEIMDESDNVENLQHLARKNWNERAKRLGIIPGKREKE
>NZ_CP022515.1|WP_093977849.1|1771934_1772408_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
METVFIHTPLGIAKIEGDENGLTSITVFDSEEKVSDIVPELLEDAVYQLREYFEGCRKEFSLTLNPEGTDFQKRVWQALQHIPFGKTVSYLELSKTLGDAKAIRAVASANGQNPLWIVVPCHRVIGSDGSLTGYAGGLHRKKWLLEHESPVKQQTLF
>NZ_CP022515.1|WP_093977848.1|1770914_1771628_-|3'-5'-exonuclease
MLHKINLEHILFLDIETVPEEENFNKLDETKKELWEHKSHYQRKDEYTAEEYYDRAGIWAEFGKIITISVGYFNYKGTNRTFRVTSFYGEEPKILKDFKNLLDTHFNRPHHLLCGHNGKEFDFPYIARRMIINKVDLPNKLDLFGKKPWEIAHLDTMELWKFGDYKHYTSLKLMANILGIPSPKEDIDGSMVKTVYYEDKDLDRIVKYCELDVITTAQVFLRLRNDELLDESEIKRI
>NZ_CP022515.1|WP_093977847.1|1768683_1770888_+|S8-family-serine-peptidase
MAYANPTLLKISKCLLPVAFCLAAYSSFAQTEKQIHIIKDKYRSSKLGVFTNDLKKNFEKDNNSLLQAAKTNGWKLTERLADGNFSELTAIGDDGTPLYYSTFSTTINTATRANALHDNGLLDLGINGENMMVGIWDGGAVLTNHKEFGNRVETLDESEVVDSHATRVAGILVAEGLDTKSKGVAYRAKAVSNDWRRDKIEVAEMAANGMLLSNHSYGIMSDRVPDWYFGSYIQVSRDWDKIMYNAPYYLMVTAAGNSQKSKDNEAPIFGSASNGFDLMLGFATSKNGVTVAAADIETNDQGQLLRASVTSYSSFGPVDDGRIKPDIAAYGTNIYTTGIANDTKYETANGTSVAAPGVTGSMLLIQEYQEQMEGSFMRAASLKGLVLHTADDVDAPGPDYKMGWGVINSKSAVEAIANKGFSSIISEETLTEGETKTYKVVANGTEPLSASISWTDPATGAVNSGTLNDMSAALINDLDIRIIKDGKTFLPWKLNAAKADAPAVNADNRVDPFEKIDIQNAKGDYTITVTHKNTLSQGPQNFSIIVTGIALTDCVLVTPEDVELTTSDETGITLNWTANTEALFQIEYKKKGSSDWNVETTFDNFITLNNLVEGTDYSLRLKTFCSENISSEYSEEYEFTFEGSETKLLDYMEYETLTLEVQFSIFPNPVQTSMTINGDVSEDAMYKIVSLNGIVVKSGKAEQKQIYIADLTTGLYVLTLADLEGSKSIKFYKS
>NZ_CP022515.1|WP_093977856.1|1779680_1780430_-|EI24-domain-containing-protein
MIKNILSGIKAYSGTLKIISQLGLWKYFWVPIFISLATAILIFSSAYALSDNIGGFLSQLWIWDWGKHTVSGISSIFGGILIIVLGFILYKHIVLALSAPFMSPVSEKIEAHLLGNLAQNHRDTNFMEQLWRGIRINLRNLGMEILLTIPILLIGLIPVIGLASTILLFLVQGFYAGFGNMDYTLERHFKYSESINFVSRYKGVAIGNGIVFMLFLFIPVIGVILVLPLSVTAATVKTVELLKLEREIG
>NZ_CP022515.1|WP_031446247.1|1780604_1781636_-|uroporphyrinogen-decarboxylase
MSLKNDLFLRALKGETVERPPVWMMRQAGRYLPEFMAIREKYDFFTRCRTPELASEITVQPIRRYGMDAAILFSDILVIPQAMNIEVQMKPNFGPYLPKPVHDQKGVDEVIVPDVNVELDYVMQAIKATKELLNNDIPLIGFAGSPWTILCYVVQGQGSKTFDKAKEFCFTNPVAAHQLLQKITDTTIAYLKAKVKAGVNAVQVFDSWGGMLSPVDYQEFSFQYIQQIIDALKDEAPVIVFGKGCWFALGDMAKSGAAALGVDWTCSARNARYLSGGNITLQGNFDPARLLSPPAVIKKMVTQMINEFGKDKYVVNLGHGILPNVPLDNAKAFIDAVKEYGQK
>NZ_CP022515.1|WP_093977857.1|1781720_1782392_-|uroporphyrinogen-III-synthase
MTILSTKILTSSQKSILTNADIKVEEYDAITIDYLTTPIDPNFKNIIFTSQNTVKAFLQTMGAQNVKKANYSAFCVGEKTKSVLEKNDINVLEMTNYGAELAKILVNQYPNESFLFLCGDKRRNEIPSLLTKHKVTFKEQIVYQNNPNPITFSTDFDGILFFSPSGIESYTAKNNMKNSVAFCIGTTTASEAQKHAKRIIIAQKPTIESVLEKAVEYSRTNIN
>NZ_CP022515.1|WP_093977858.1|1782428_1783340_-|hydroxymethylbilane-synthase
MSKIIRIGTRDSQLALWQAHTVRYQLEALGYKTQIISVKSTGDLLLDKPLYELGITGIFTKTLDIAMINGKVDIAVHSMKDVPTRLPKGIVQSAVLPRANTQDILVYKDLDFLNSKGTIATGSLRRQAQWLNKHPSHKVVDLRGNVNTRLQKLQDNPWNGAIFAKAGLERIEVLPQNHIDLDWMVPAPAQGAMVVVSMENDAFSTEAVRKLNDSATDICTHVEREFLQVLEGGCTAPIGALANIEKDKLHFEGILLSLDGTQKLSIKKSISSQDYIDFGKLCALEILNNGGTEMMKKIKKELA
>NZ_CP022515.1|WP_093977859.1|1783336_1784593_-|glutamyl-tRNA-reductase
MKDYHISKHNSFYTIGLNYKKADAEVRGKFSLDDNAIDRILEQAKLIGLDGLLVTSTCNRTELHGFAQHPYQLIKLLCDNTHGTVEEFQEVAYVYKNNDSINHLFRMGTGLDSQILGDFEIISQLRQSFNRSKKQEIANPFLERLCNSVIQASKRIKNETDISSGATSVAFASVQYIINNIPDISEKNILLFGTGKIGRNTCENLIKHTKNSHITLINRTKDKAERIAGKFNLVVKNYGDLQTEIRNTDVLIVATGAQSPTISKELIYTKKPLLILDLSIPKNVSDNVTDLENVTVIHLDHLSQMTDDTLEKRKESVPQAEAIIEEVKEEFIKWLETRKFAPVIKALKKKLKTMKDEELDFQSKKLSDFNSVQADIISERIIQKITKQFANHLKDTEIDSDTSLELIQRVFQLELETK
>NZ_CP022515.1|WP_031446251.1|1784797_1785688_+|helix-turn-helix-transcriptional-regulator
MEEENIAQGSFEEVLIEDGFYVLKIQNDGIHNQTVTREIDSSFIQFHFCLKGSAKFVFNEGRYALEVNEDNSLLLYNTQVDLPLNLVLNSNSWMVSIIMTIRKFHSLFSKEADYIPFLSADNKDKKYYSQEAVSPAIAVVLSQVMNYNLHPSIKELYIKGKVYELISLYFNKSQDADVEQCPFLVDEDNVKRIRKAKEIIISRMAEPPSLQDLSEEIGLSLKKLKEGFKQIYGDSVYSFLFDYKMEYARKMLESGKHNVNEVGLKVGYSTSSHFIAAFKKKYSTTPKKYLMSLANG
>NZ_CP022515.1|WP_093977860.1|1785934_1786699_+|ThuA-domain-containing-protein
MIGCGSSKIQEEVTINPNLHNAPVKVPEKIISSNILAKDRVLVFSKTNGFRHKSIEKGVATFVKLGVANNFAVSHTEDSLQFNLENLKKFKLVVFLSTTMDVLGDEQQSAFEKYIQNGGSFMGVHAAADTEYEWPWYNKLVGAYFLSHPKQQTARIDVVDRNHPATKHLADIWTHFDEWYNYKNINPEVNVLMKLDESSYEGGKNGDNHPIAWYHEYDGGRAFYTGLGHTEEAFDDLNFRQHLVGGIEYCLKRD
>NZ_CP022515.1|WP_093977861.1|1787364_1788330_-|glycosylase
MTARFLVLTSIMVFLLSCKDHQKTKENANTEQLTVVSPKDSVPFPFELTHFQTPAENPVFTGTGMDTWDHKIRERGYIIKEEGTYHMWYTGLNDEKEPLALGYATSLDGIAWKRYNNNPVFNDSWTEDMMVIKEDGTYHMFAEGINDIAHRLTSTDRIHWTDHGSLDIRNADGSPLSEGPYGTPTVWRENNIWYLFYERNDLGIWLATSKDLKVWTNAQDEPVITMGPEAYDKYGVAVNQIIKYKGWYYAYYHGTPFEDWSLWSTNVAASKDLLLWKKYPQNPIMEENRSSGILVPDGDLFRLYTMHDKVEVHFPKSPEKN
>NZ_CP022515.1|WP_093977862.1|1788751_1789534_+|glycoside-hydrolase-family-16-protein
MKLTPVFLFLFVLGFAFAQRPAQGPMSKKRFNPEKMGYKLVWEDNFKGKTLNTTKWTVRGVGPRAIAYVSEEAVKVEKGYLKLYALKKGDSLLGSAVGTQGKFMSKYGYYECRAKLQKSQGVWAAFWLQSPQISQGEDPSKYGAEIDVMEFFKKLGTDIVSHNVHWAYGPNQQSTKGMQSYRRGVSLGFHTFGLEWFPDRYIFYVDGYKYYEVTVGISNIEEYMILSMEYPGKKEEILKTIFPDVFMVDYVKVYQKEEGY
>NZ_CP022515.1|WP_031446255.1|1789612_1790059_+|GNAT-family-N-acetyltransferase
MKIALLQESDVNPDMEQQLAGLFRQLNADIKQMNLKQVLDPENPICLVYCKEGDKVLGMALMCTYTVISGFKGWVEDVVVDVEHRGKGLGRKLMEKLVELGKEKGLTEILLFSADKRIEAINLYKSLGFKEKESRIYVLKTESLIKKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_2

1779467-1779546

Orphan

Consensus_repeat	Method
GGTTTTTGAAACCTTGCAGGTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_2

>merge|NZ_CP022515|2|1779467-1779546|CRISPRCasFinder
GGTTGTGGAAACCTTGCATGTCATGGTCTGGGTCCTGTTGATTGCGTAACCTGCAAGGTCTTGGCGACCTTGTAGGTTTT

>NZ_CP022515|2|2|1779467-1779546|CRISPRCasFinder
GGTTGTGGAAACCTTGCATGTCA	TGGTCTGGGTCCTGTTGATTGCGTAACCTGCAA
GGTCTTGGCGACCTTGTAGGTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093977853.1\|1776536_1776923_-\|Sec-C-motif-domain-protein	unknown	unknown	gnl\|CDD\|380015
NZ_CP022515.1\|WP_093977857.1\|1781720_1782392_-\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|119440
NZ_CP022515.1\|WP_093977847.1\|1768683_1770888_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173791
NZ_CP022515.1\|WP_093977860.1\|1785934_1786699_+\|ThuA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377643
NZ_CP022515.1\|WP_093977854.1\|1777162_1778065_-\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|376494
NZ_CP022515.1\|WP_093977858.1\|1782428_1783340_-\|hydroxymethylbilane-synthase	unknown	unknown	gnl\|CDD\|234612
NZ_CP022515.1\|WP_093977862.1\|1788751_1789534_+\|glycoside-hydrolase-family-16-protein	unknown	unknown	gnl\|CDD\|185683
NZ_CP022515.1\|WP_031446247.1\|1780604_1781636_-\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|238368
NZ_CP022515.1\|WP_093977848.1\|1770914_1771628_-\|3'-5'-exonuclease	unknown	unknown	gnl\|CDD\|99825
NZ_CP022515.1\|WP_093977850.1\|1772407_1773529_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP022515.1\|WP_031446255.1\|1789612_1790059_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP022515.1\|WP_093977856.1\|1779680_1780430_-\|EI24-domain-containing-protein	unknown	unknown	gnl\|CDD\|377798
NZ_CP022515.1\|WP_093980504.1\|1773577_1774894_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP022515.1\|WP_093977859.1\|1783336_1784593_-\|glutamyl-tRNA-reductase	unknown	unknown	gnl\|CDD\|234592
NZ_CP022515.1\|WP_093977861.1\|1787364_1788330_-\|glycosylase	unknown	unknown	gnl\|CDD\|350119
NZ_CP022515.1\|WP_093977851.1\|1774904_1775417_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP022515.1\|WP_031446251.1\|1784797_1785688_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP022515.1\|WP_093977849.1\|1771934_1772408_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|234860
NZ_CP022515.1\|WP_093977852.1\|1775486_1776461_-\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|236450
NZ_CP022515.1\|WP_093977855.1\|1778850_1779423_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376616

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093977853.1\|1776536_1776923_-\|Sec-C-motif-domain-protein	gnl\|CDD\|380015	pfam17775, UPF0225, UPF0225 domain. This entry represents an NTF2-like domain found in bacterial proteins.	1.59177e-45
NZ_CP022515.1\|WP_093977857.1\|1781720_1782392_-\|uroporphyrinogen-III-synthase	gnl\|CDD\|119440	cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease.	1.47756e-36
NZ_CP022515.1\|WP_093977847.1\|1768683_1770888_+\|S8-family-serine-peptidase	gnl\|CDD\|173791	cd04842, Peptidases_S8_Kp43_protease, Peptidase S8 family domain in Kp43 proteases. Kp43 proteases are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution). Kp43 is topologically similar to kexin and furin both of which are proprotein convertases, but differ in amino acids sequence and the position of its C-terminal barrel. Kp43 has 3 Ca2+ binding sites that differ from the corresponding sites in the other known subtilisin-like proteases. KP-43 protease is known to be an oxidation-resistant protease when compared with the other subtilisin-like proteases.	1.14817e-46
NZ_CP022515.1\|WP_093977860.1\|1785934_1786699_+\|ThuA-domain-containing-protein	gnl\|CDD\|377643	pfam06283, ThuA, Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.	4.91851e-109
NZ_CP022515.1\|WP_093977854.1\|1777162_1778065_-\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|376494	pfam01218, Coprogen_oxidas, Coproporphyrinogen III oxidase.	0
NZ_CP022515.1\|WP_093977858.1\|1782428_1783340_-\|hydroxymethylbilane-synthase	gnl\|CDD\|234612	PRK00072, hemC, porphobilinogen deaminase; Reviewed.	2.62801e-106
NZ_CP022515.1\|WP_093977862.1\|1788751_1789534_+\|glycoside-hydrolase-family-16-protein	gnl\|CDD\|185683	cd00413, Glyco_hydrolase_16, glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.	3.81526e-40
NZ_CP022515.1\|WP_031446247.1\|1780604_1781636_-\|uroporphyrinogen-decarboxylase	gnl\|CDD\|238368	cd00717, URO-D, Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction is located at the branching point of the tetrapyrrole biosynthetic pathway, leading to the biosynthesis of heme, chlorophyll or bacteriochlorophyll. URO-D deficiency is responsible for the human genetic diseases familial porphyria cutanea tarda (fPCT) and hepatoerythropoietic porphyria (HEP).	3.61166e-178
NZ_CP022515.1\|WP_093977848.1\|1770914_1771628_-\|3'-5'-exonuclease	gnl\|CDD\|99825	cd05782, DNA_polB_like1_exo, Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.	3.85174e-63
NZ_CP022515.1\|WP_093977850.1\|1772407_1773529_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.01444e-61
NZ_CP022515.1\|WP_031446255.1\|1789612_1790059_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.71819e-16
NZ_CP022515.1\|WP_093977856.1\|1779680_1780430_-\|EI24-domain-containing-protein	gnl\|CDD\|377798	pfam07264, EI24, Etoposide-induced protein 2.4 (EI24). This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.	1.78501e-16
NZ_CP022515.1\|WP_093980504.1\|1773577_1774894_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	4.21988e-42
NZ_CP022515.1\|WP_093977859.1\|1783336_1784593_-\|glutamyl-tRNA-reductase	gnl\|CDD\|234592	PRK00045, hemA, glutamyl-tRNA reductase; Reviewed.	1.11039e-103
NZ_CP022515.1\|WP_093977861.1\|1787364_1788330_-\|glycosylase	gnl\|CDD\|350119	cd18607, GH130, Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.	5.07068e-11
NZ_CP022515.1\|WP_093977851.1\|1774904_1775417_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.5317e-06
NZ_CP022515.1\|WP_031446251.1\|1784797_1785688_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.82935e-26
NZ_CP022515.1\|WP_093977849.1\|1771934_1772408_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|234860	PRK00901, PRK00901, methylated-DNA--protein-cysteine methyltransferase; Provisional.	1.43244e-59
NZ_CP022515.1\|WP_093977852.1\|1775486_1776461_-\|porphobilinogen-synthase	gnl\|CDD\|236450	PRK09283, PRK09283, porphobilinogen synthase.	0
NZ_CP022515.1\|WP_093977855.1\|1778850_1779423_-\|hypothetical-protein	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	0.000603081

>NZ_CP022515.1|WP_093977855.1|1778850_1779423_-|hypothetical-protein
MKLEKLEQDCYYHIYNRGINGGPIFRSDENKRYFLRLIKKHLSDKVSILAYCLMDNHYHMAIQVIQEEQKVTQSFSNLFNAYAKAYNKMHDRTGSLFEKHFKRIKIQDTKYLRNLIIYINTNPEYHGVNNDYKKFEYSSYQTTIIDSNDAVLMPIAKEEVINLFEDIENFEYLHQQKMNLNLDLNALDLD
>NZ_CP022515.1|WP_093977854.1|1777162_1778065_-|oxygen-dependent-coproporphyrinogen-oxidase
MKDKFYAYIQQLQDTITAKLEAVDGLAKFKEDLWERPEGGGGRSRVIENGAVFEKGGVNISAVHGALPKSMQNYFGVQDADFFACGLSLVIHPKNPMVPTVHANWRYFEMYDKQGHLVDQWFGGGQDLTPYYLFDEDASHFHKVCKDACDKHNPDFYNTYKTKCDDYFWNTHRNEARGVGGLFYDYCKATDKMSMEDWYNFETEVGNSFLEAYVPIVEKRKDLPYSKEQRDWQEIRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQWVYDHHPDKGSEEERLLKVLEKPKDWV
>NZ_CP022515.1|WP_093977853.1|1776536_1776923_-|Sec-C-motif-domain-protein
MDCPCGSHKPYADCCGKAHKDISTATTAEQLMRSRYSAFVLGNGNYLMDSHHSSTRPVKEKKAIEAWAKSVSWIRLEVLDREKGEINDQNGTVTFNAYFFENGKVAVIHEKSEFVKEKGLWMYLGLAK
>NZ_CP022515.1|WP_093977852.1|1775486_1776461_-|porphobilinogen-synthase
MYPLRRNRRLRSNEAIRSLVRETIISPNDFLVPLFVVEGKGVKEEIASMPNYYRYSLDLLEKEVKELWAMGLKSVLLFVKVPDHLKDNKGKEAVNPKGLMQRAIKTVKNTCPDMLVMTDVALDPYSSYGHDGIVEDGQIVNDDTVEVLASMSVSHAEAGADFVAPSDMMDGRILSIREALEDEGFIDTGIMSYSAKYASAFYGPFRDALDSAPGFGDKKTYQMDYANRFEAIKETEMDIDEGADIVMVKPGLCYLDIVREIKNEVDVPLAVYQVSGEYAMVKAAAEKGWLDHDAVMMEQLTAIKRAGANIIASYFAKDVVRVLG
>NZ_CP022515.1|WP_093977851.1|1774904_1775417_-|DinB-family-protein
MKDFLFILIVLFMTPLHSQDIVIPAFLEKWENSKSYLVAIAEAMPQEKYDFKPTERQKDFQDQLLHIKSNMDWLSSTYFGRQLSETGSGNNSPLTKRETIKLLVDGFDGVSAILKNTSADVLSEKVEFFAGEKTKLQILNLLQDHVTHHRGQLIVYLNLNNIEPPKYVGW
>NZ_CP022515.1|WP_093980504.1|1773577_1774894_-|serine-hydrolase
MKKRNYTAIILLSIIFNTQLLSAQSPNPEALSYENPSAVGMDSLFIHSKVDSIMTFAIKEEAFPGAQVLVAKNSKIIFHKAYGFHTYDSVQPVSITDIYDLASVTKIMGPLPALMKLHDEGKLDLDAPFSTLWPKWKNRKDKKKLTIREVFAHQAGLVPYIIFLQEVMKKNGSVKNRFVRHEPSRRFNTKAYDNIYIKDRFRNKIYRKINSSKVSDIKKYKYSGLTFLLYPEIISKFTNTDYETYVTQNFYAPIGATTMGFNPKTKNYQNNIVPTEIDTLFRHELTKDWVHDENAALLGGVSGNAGLFASATDLAKIMQMYMNYGSYDGKRYLSEATVKEFTKVQYPENENRRGLIFDKPDLNNHELTLADSYPAPSASPDSFGHSGFTGTFVWADPKTQLVYIFLSNRVYPSRAHANIYKYNIRSAVQQVFYDAIID
>NZ_CP022515.1|WP_093977850.1|1772407_1773529_-|HlyC/CorC-family-transporter
MGLLIFYALISILVSFLCSILEAVLLSVPQTFINLKKKEGKSFAQELEALKKDVDKPLIAILTLNTIAHTVGAILVGVQAKIAYSELYGNTENTLLGMQFSEAAMVGLVSTIMTILILVASEIIPKTIGATYWKQLAHASTTALKIMVWALRWTGILWILQLFTRLVGKKGVHGSVFSREDFSAMTDIAHEEGVFQESESTIIRNLLHFDEIKVKDIMTPRAVVKIASESATIKEFYNANPKMPFSRIPVFNKKMDNITGFVLKDMILEEIIKKNGSAPLSSIKREILVSNRQTPIPELFETFISKREHIALVVDEYGSVSGVVTMEDILETLLGLEIMDESDNVENLQHLARKNWNERAKRLGIIPGKREKE
>NZ_CP022515.1|WP_093977849.1|1771934_1772408_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
METVFIHTPLGIAKIEGDENGLTSITVFDSEEKVSDIVPELLEDAVYQLREYFEGCRKEFSLTLNPEGTDFQKRVWQALQHIPFGKTVSYLELSKTLGDAKAIRAVASANGQNPLWIVVPCHRVIGSDGSLTGYAGGLHRKKWLLEHESPVKQQTLF
>NZ_CP022515.1|WP_093977848.1|1770914_1771628_-|3'-5'-exonuclease
MLHKINLEHILFLDIETVPEEENFNKLDETKKELWEHKSHYQRKDEYTAEEYYDRAGIWAEFGKIITISVGYFNYKGTNRTFRVTSFYGEEPKILKDFKNLLDTHFNRPHHLLCGHNGKEFDFPYIARRMIINKVDLPNKLDLFGKKPWEIAHLDTMELWKFGDYKHYTSLKLMANILGIPSPKEDIDGSMVKTVYYEDKDLDRIVKYCELDVITTAQVFLRLRNDELLDESEIKRI
>NZ_CP022515.1|WP_093977847.1|1768683_1770888_+|S8-family-serine-peptidase
MAYANPTLLKISKCLLPVAFCLAAYSSFAQTEKQIHIIKDKYRSSKLGVFTNDLKKNFEKDNNSLLQAAKTNGWKLTERLADGNFSELTAIGDDGTPLYYSTFSTTINTATRANALHDNGLLDLGINGENMMVGIWDGGAVLTNHKEFGNRVETLDESEVVDSHATRVAGILVAEGLDTKSKGVAYRAKAVSNDWRRDKIEVAEMAANGMLLSNHSYGIMSDRVPDWYFGSYIQVSRDWDKIMYNAPYYLMVTAAGNSQKSKDNEAPIFGSASNGFDLMLGFATSKNGVTVAAADIETNDQGQLLRASVTSYSSFGPVDDGRIKPDIAAYGTNIYTTGIANDTKYETANGTSVAAPGVTGSMLLIQEYQEQMEGSFMRAASLKGLVLHTADDVDAPGPDYKMGWGVINSKSAVEAIANKGFSSIISEETLTEGETKTYKVVANGTEPLSASISWTDPATGAVNSGTLNDMSAALINDLDIRIIKDGKTFLPWKLNAAKADAPAVNADNRVDPFEKIDIQNAKGDYTITVTHKNTLSQGPQNFSIIVTGIALTDCVLVTPEDVELTTSDETGITLNWTANTEALFQIEYKKKGSSDWNVETTFDNFITLNNLVEGTDYSLRLKTFCSENISSEYSEEYEFTFEGSETKLLDYMEYETLTLEVQFSIFPNPVQTSMTINGDVSEDAMYKIVSLNGIVVKSGKAEQKQIYIADLTTGLYVLTLADLEGSKSIKFYKS
>NZ_CP022515.1|WP_093977856.1|1779680_1780430_-|EI24-domain-containing-protein
MIKNILSGIKAYSGTLKIISQLGLWKYFWVPIFISLATAILIFSSAYALSDNIGGFLSQLWIWDWGKHTVSGISSIFGGILIIVLGFILYKHIVLALSAPFMSPVSEKIEAHLLGNLAQNHRDTNFMEQLWRGIRINLRNLGMEILLTIPILLIGLIPVIGLASTILLFLVQGFYAGFGNMDYTLERHFKYSESINFVSRYKGVAIGNGIVFMLFLFIPVIGVILVLPLSVTAATVKTVELLKLEREIG
>NZ_CP022515.1|WP_031446247.1|1780604_1781636_-|uroporphyrinogen-decarboxylase
MSLKNDLFLRALKGETVERPPVWMMRQAGRYLPEFMAIREKYDFFTRCRTPELASEITVQPIRRYGMDAAILFSDILVIPQAMNIEVQMKPNFGPYLPKPVHDQKGVDEVIVPDVNVELDYVMQAIKATKELLNNDIPLIGFAGSPWTILCYVVQGQGSKTFDKAKEFCFTNPVAAHQLLQKITDTTIAYLKAKVKAGVNAVQVFDSWGGMLSPVDYQEFSFQYIQQIIDALKDEAPVIVFGKGCWFALGDMAKSGAAALGVDWTCSARNARYLSGGNITLQGNFDPARLLSPPAVIKKMVTQMINEFGKDKYVVNLGHGILPNVPLDNAKAFIDAVKEYGQK
>NZ_CP022515.1|WP_093977857.1|1781720_1782392_-|uroporphyrinogen-III-synthase
MTILSTKILTSSQKSILTNADIKVEEYDAITIDYLTTPIDPNFKNIIFTSQNTVKAFLQTMGAQNVKKANYSAFCVGEKTKSVLEKNDINVLEMTNYGAELAKILVNQYPNESFLFLCGDKRRNEIPSLLTKHKVTFKEQIVYQNNPNPITFSTDFDGILFFSPSGIESYTAKNNMKNSVAFCIGTTTASEAQKHAKRIIIAQKPTIESVLEKAVEYSRTNIN
>NZ_CP022515.1|WP_093977858.1|1782428_1783340_-|hydroxymethylbilane-synthase
MSKIIRIGTRDSQLALWQAHTVRYQLEALGYKTQIISVKSTGDLLLDKPLYELGITGIFTKTLDIAMINGKVDIAVHSMKDVPTRLPKGIVQSAVLPRANTQDILVYKDLDFLNSKGTIATGSLRRQAQWLNKHPSHKVVDLRGNVNTRLQKLQDNPWNGAIFAKAGLERIEVLPQNHIDLDWMVPAPAQGAMVVVSMENDAFSTEAVRKLNDSATDICTHVEREFLQVLEGGCTAPIGALANIEKDKLHFEGILLSLDGTQKLSIKKSISSQDYIDFGKLCALEILNNGGTEMMKKIKKELA
>NZ_CP022515.1|WP_093977859.1|1783336_1784593_-|glutamyl-tRNA-reductase
MKDYHISKHNSFYTIGLNYKKADAEVRGKFSLDDNAIDRILEQAKLIGLDGLLVTSTCNRTELHGFAQHPYQLIKLLCDNTHGTVEEFQEVAYVYKNNDSINHLFRMGTGLDSQILGDFEIISQLRQSFNRSKKQEIANPFLERLCNSVIQASKRIKNETDISSGATSVAFASVQYIINNIPDISEKNILLFGTGKIGRNTCENLIKHTKNSHITLINRTKDKAERIAGKFNLVVKNYGDLQTEIRNTDVLIVATGAQSPTISKELIYTKKPLLILDLSIPKNVSDNVTDLENVTVIHLDHLSQMTDDTLEKRKESVPQAEAIIEEVKEEFIKWLETRKFAPVIKALKKKLKTMKDEELDFQSKKLSDFNSVQADIISERIIQKITKQFANHLKDTEIDSDTSLELIQRVFQLELETK
>NZ_CP022515.1|WP_031446251.1|1784797_1785688_+|helix-turn-helix-transcriptional-regulator
MEEENIAQGSFEEVLIEDGFYVLKIQNDGIHNQTVTREIDSSFIQFHFCLKGSAKFVFNEGRYALEVNEDNSLLLYNTQVDLPLNLVLNSNSWMVSIIMTIRKFHSLFSKEADYIPFLSADNKDKKYYSQEAVSPAIAVVLSQVMNYNLHPSIKELYIKGKVYELISLYFNKSQDADVEQCPFLVDEDNVKRIRKAKEIIISRMAEPPSLQDLSEEIGLSLKKLKEGFKQIYGDSVYSFLFDYKMEYARKMLESGKHNVNEVGLKVGYSTSSHFIAAFKKKYSTTPKKYLMSLANG
>NZ_CP022515.1|WP_093977860.1|1785934_1786699_+|ThuA-domain-containing-protein
MIGCGSSKIQEEVTINPNLHNAPVKVPEKIISSNILAKDRVLVFSKTNGFRHKSIEKGVATFVKLGVANNFAVSHTEDSLQFNLENLKKFKLVVFLSTTMDVLGDEQQSAFEKYIQNGGSFMGVHAAADTEYEWPWYNKLVGAYFLSHPKQQTARIDVVDRNHPATKHLADIWTHFDEWYNYKNINPEVNVLMKLDESSYEGGKNGDNHPIAWYHEYDGGRAFYTGLGHTEEAFDDLNFRQHLVGGIEYCLKRD
>NZ_CP022515.1|WP_093977861.1|1787364_1788330_-|glycosylase
MTARFLVLTSIMVFLLSCKDHQKTKENANTEQLTVVSPKDSVPFPFELTHFQTPAENPVFTGTGMDTWDHKIRERGYIIKEEGTYHMWYTGLNDEKEPLALGYATSLDGIAWKRYNNNPVFNDSWTEDMMVIKEDGTYHMFAEGINDIAHRLTSTDRIHWTDHGSLDIRNADGSPLSEGPYGTPTVWRENNIWYLFYERNDLGIWLATSKDLKVWTNAQDEPVITMGPEAYDKYGVAVNQIIKYKGWYYAYYHGTPFEDWSLWSTNVAASKDLLLWKKYPQNPIMEENRSSGILVPDGDLFRLYTMHDKVEVHFPKSPEKN
>NZ_CP022515.1|WP_093977862.1|1788751_1789534_+|glycoside-hydrolase-family-16-protein
MKLTPVFLFLFVLGFAFAQRPAQGPMSKKRFNPEKMGYKLVWEDNFKGKTLNTTKWTVRGVGPRAIAYVSEEAVKVEKGYLKLYALKKGDSLLGSAVGTQGKFMSKYGYYECRAKLQKSQGVWAAFWLQSPQISQGEDPSKYGAEIDVMEFFKKLGTDIVSHNVHWAYGPNQQSTKGMQSYRRGVSLGFHTFGLEWFPDRYIFYVDGYKYYEVTVGISNIEEYMILSMEYPGKKEEILKTIFPDVFMVDYVKVYQKEEGY
>NZ_CP022515.1|WP_031446255.1|1789612_1790059_+|GNAT-family-N-acetyltransferase
MKIALLQESDVNPDMEQQLAGLFRQLNADIKQMNLKQVLDPENPICLVYCKEGDKVLGMALMCTYTVISGFKGWVEDVVVDVEHRGKGLGRKLMEKLVELGKEKGLTEILLFSADKRIEAINLYKSLGFKEKESRIYVLKTESLIKKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_4

2325812-2325886

Orphan

Consensus_repeat	Method
GGATCAGGAACAATTGTTGTGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_4

>merge|NZ_CP022515|4|2325812-2325886|CRISPRCasFinder
GGATCAGGAACAATTGTTGTGTTTCTACAAAAATTGGATTAATATAATTTGGGATCAAGAACAATTGTTGTGTTT

>NZ_CP022515|4|4|2325812-2325886|CRISPRCasFinder
GGATCAGGAACAATTGTTGTGTTT	CTACAAAAATTGGATTAATATAATTTG
GGATCAAGAACAATTGTTGTGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093978216.1\|2335847_2336573_-\|response-regulator	unknown	unknown	gnl\|CDD\|236956
NZ_CP022515.1\|WP_157730761.1\|2337623_2337968_-\|DUF4907-domain-containing-protein	unknown	unknown	gnl\|CDD\|374455
NZ_CP022515.1\|WP_093978205.1\|2318865_2319774_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978207.1\|2323820_2324207_+\|DUF2116-family-Zn-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|226554
NZ_CP022515.1\|WP_093978208.1\|2324333_2325542_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271185
NZ_CP022515.1\|WP_031442154.1\|2336553_2337615_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|377675
NZ_CP022515.1\|WP_093978211.1\|2327527_2328580_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239118
NZ_CP022515.1\|WP_093978203.1\|2316764_2317271_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225405
NZ_CP022515.1\|WP_093978202.1\|2315937_2316564_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978206.1\|2320964_2322041_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|282883
NZ_CP022515.1\|WP_093978214.1\|2331458_2333225_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225044
NZ_CP022515.1\|WP_093978210.1\|2326490_2327459_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|368185
NZ_CP022515.1\|WP_093978213.1\|2329816_2330776_-\|ornithine-cyclodeaminase-family-protein	unknown	unknown	gnl\|CDD\|180421
NZ_CP022515.1\|WP_157730757.1\|2328896_2329748_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093980538.1\|2322628_2323702_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271193
NZ_CP022515.1\|WP_157730759.1\|2330958_2331123_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730755.1\|2315022_2315745_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_075695332.1\|2320019_2320715_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978215.1\|2334210_2335797_+\|sulfatase	unknown	unknown	gnl\|CDD\|293755
NZ_CP022515.1\|WP_093978204.1\|2317996_2318863_-\|carboxypeptidase-like-regulatory-domain-containing-protein	unknown	unknown	gnl\|CDD\|372685

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093978216.1\|2335847_2336573_-\|response-regulator	gnl\|CDD\|236956	PRK11697, PRK11697, two-component system response regulator BtsR.	5.42477e-40
NZ_CP022515.1\|WP_157730761.1\|2337623_2337968_-\|DUF4907-domain-containing-protein	gnl\|CDD\|374455	pfam16250, DUF4907, Domain of unknown function (DUF4907). A family of uncharacterized proteins around 110 residues in length and found in various Bacteroides species. The function of this family is unknown.	4.03804e-21
NZ_CP022515.1\|WP_093978204.1\|2317996_2318863_-\|carboxypeptidase-like-regulatory-domain-containing-protein	gnl\|CDD\|372685	pfam13715, CarbopepD_reg_2, CarboxypepD_reg-like domain. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 90 amino acids in length. The family is found in association with pfam07715 and pfam00593.	2.68727e-19
NZ_CP022515.1\|WP_093978208.1\|2324333_2325542_-\|site-specific-integrase	gnl\|CDD\|271185	cd01185, INTN1_C_like, Integrase IntN1 of Bacteroides mobilizable transposon NBU1 and similar proteins, C-terminal catalytic domain. IntN1 is a tyrosine recombinase for the integration and excision of Bacteroides mobilizable transposon NBU1 from the host chromosome. IntN1 does not require strict homology between the recombining sites seen with other tyrosine recombinases. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.40115e-38
NZ_CP022515.1\|WP_031442154.1\|2336553_2337615_-\|histidine-kinase	gnl\|CDD\|377675	pfam06580, His_kinase, Histidine kinase. This family represents a region within bacterial histidine kinase enzymes. Two-component signal transduction systems such as those mediated by histidine kinase are integral parts of bacterial cellular regulatory processes, and are used to regulate the expression of genes involved in virulence. Members of this family often contain pfam02518 and/or pfam00672.	3.76909e-29
NZ_CP022515.1\|WP_093978203.1\|2316764_2317271_-\|hypothetical-protein	gnl\|CDD\|225405	COG2849, COG2849, Uncharacterized protein conserved in bacteria [Function unknown].	0.00282893
NZ_CP022515.1\|WP_093978213.1\|2329816_2330776_-\|ornithine-cyclodeaminase-family-protein	gnl\|CDD\|180421	PRK06141, PRK06141, ornithine cyclodeaminase family protein.	6.35299e-137
NZ_CP022515.1\|WP_093978210.1\|2326490_2327459_+\|amidohydrolase-family-protein	gnl\|CDD\|368185	pfam04909, Amidohydro_2, Amidohydrolase. These proteins are amidohydrolases that are related to pfam01979.	5.21212e-06
NZ_CP022515.1\|WP_093978206.1\|2320964_2322041_-\|hypothetical-protein	gnl\|CDD\|282883	pfam05085, DUF685, Protein of unknown function (DUF685). This family consists of several uncharacterized proteins from Borrelia burgdorferi (Lyme disease spirochete). There is some evidence to suggest that the proteins may be outer surface proteins.	0.00730509
NZ_CP022515.1\|WP_093980538.1\|2322628_2323702_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271193	cd01193, INT_IntI_C, Integron integrase and similar protiens, C-terminal catalytic domain. Integron integrases mediate site-specific DNA recombination between a proximal primary site (attI) and a secondary target site (attC) found within mobile gene cassettes encoding resistance or virulence factors. Unlike other site specific recombinases, the attC sites lack sequence conservation. Integron integrase exhibits broader DNA specificity by recognizing the non-conserved attC sites. The structure shows that DNA target site recognition are not dependent on canonical DNA but on the position of two flipped-out bases that interact in cis and in trans with the integrase. Integron-integrases are present in many natural occurring mobile elements, including transposons and conjugative plasmids. Vibrio, Shewanella, Xanthomonas, and Pseudomonas species harbor chromosomal super-integrons. All integron-integrases carry large inserts unlike the TnpF ermF-like proteins also seen in this group.	2.32166e-68
NZ_CP022515.1\|WP_093978214.1\|2331458_2333225_+\|c-type-cytochrome	gnl\|CDD\|225044	COG2133, COG2133, Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism].	1.13442e-38
NZ_CP022515.1\|WP_093978211.1\|2327527_2328580_-\|hypothetical-protein	gnl\|CDD\|239118	cd02652, nuc_hydro_2, NH_2: A subgroup of nucleoside hydrolases. This group contains eukaryotic and bacterial proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. .	9.68594e-31
NZ_CP022515.1\|WP_093978215.1\|2334210_2335797_+\|sulfatase	gnl\|CDD\|293755	cd16031, G6S_like, unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.	0
NZ_CP022515.1\|WP_093978207.1\|2323820_2324207_+\|DUF2116-family-Zn-ribbon-domain-containing-protein	gnl\|CDD\|226554	COG4068, COG4068, Uncharacterized protein containing a Zn-ribbon [Function unknown].	0.000240147

>NZ_CP022515.1|WP_093978208.1|2324333_2325542_-|site-specific-integrase
MSSIKIVLRKKGLADGTYPVCLRITKDRKTKYFNTIFKSSEREWDSPSGCFNKNNVNYIQNNRLLLKIKARALKVYADLEFEKESFNLDEFGQRFRVDSNPANDNVFPFWEEIVSELKLAGRMGNATMYEETMKSVKNFCGHRKIKFQDITNTFLNKYEAWLRSRGGTDGGISIKQRTLRALYNKAIERSIIRDTNHPFKTYKISKLKGQGIKKALDFEQVTKIINFDLSEYSYLTDARNYFVFSFYTRGMNYTDMMVLKWQDIDATTVSYIRNKTKGRFIITILPPVQEILDYYQQHSLPTKYVFPIILKDGLTPSQIEHRKKKTLAKYNRDLKEIARLCGINKSLSSYVARHSFANCLKQKGVATDVIGESLGHKDLTTTQVYLKELGSNVLDKAVELLL
>NZ_CP022515.1|WP_093978207.1|2323820_2324207_+|DUF2116-family-Zn-ribbon-domain-containing-protein
MNNDRSCPVCGIVVKGRSDKIFCSPKCRSIDQYEQRQKTETFYIRVDRQLKINRKLLKKYNRSGITTIRKSELIMEGFDPQFFTHYWKNQKGDVYLFVYEYGFLNKRHNGKDKYILVIWQDYMESSQK
>NZ_CP022515.1|WP_093980538.1|2322628_2323702_-|tyrosine-type-recombinase/integrase
MIGIKFLPDKLIQGLVKGLPNPKWSKEHNMAYIPNTKTNLSIIFNTFKGIVWINYNRFLLNKPINTHNDKVDVEWFRKRNPIPEYRLCPEEYLLKLELKRYANSTVRTYVSFFEMFINHYKDKELSAINESDIRAFLQKLVHRNVSNSYLNQCINAIKFYYEVVLGMPNRFYEIERPRKESKLPTVISKEEVLSIIGSTNNIKHKCIIKLLYSSGLRRSELLNLKLADVDSKRMLIRVQGSKGNKDRHTLLSQTVLEDLRIYFREWKPREYLFEGQRGGRYSAQSVLKIVKEAAIKAKIKQSVTPHVLRHSFATHLLESGVDLRQIQVLLGHGSSKTTEIYTHVATNTFRNIKNPLD
>NZ_CP022515.1|WP_093978206.1|2320964_2322041_-|hypothetical-protein
MFFKKKIKTSLSDFISALNSGRNNILNILAIKENIFRTESYEQILENPSDIAAGVVGVKTKFDIKAFEIFDNMLIKEHDNGDVKYIFYTSTRNFDKINEIADTIHSILGESLYNPEIHSSFTEKDKVLNLTRGTYQSLTDELVDVWVLEDITVLLQYRIDPMFEFSLFVTKHLPKEINREPRKNWTIAKHLKNDFSSIFSTQEDSKIEVQSEDGTIASVKYFYQLESKEFGIFDELEVQQGGNEKDFSFQKPTHLTFTSSTDITLVNMVEVVEKLIKMYGPDNGGTEELEVHELDILEDRRYWTGRSWGFNEVHGIYDVENPNDKMSYSVWVSYDDLGTGFTLTILSYDSLIEYFVAE
>NZ_CP022515.1|WP_075695332.1|2320019_2320715_-|hypothetical-protein
MRNLIPIIVLIFLSSCAARKNSLTDLSKIGLLGNVKYLKFINQNNEEKEADDSDEEIGFIDNEYFFNKNGMITEQRQYSSNELSQIFVFSYDKKNFLISKDYYNSEREIVTKSIFENKLNNKRKLYRQMEFRAWERSLSDSIKVRYRIFPEEIIEFLYDKNGNLIQQNLYQRNTSFKNVIEYQDGKMIKGKTVSLLDNSIWSSIQYDCIKFDQNQNCIKYEDTDVTIEYYK
>NZ_CP022515.1|WP_093978205.1|2318865_2319774_-|hypothetical-protein
MKKISLKNVLEILKYLGIYYLSAKMICFAIPKILFMQFRVLHWESYVPLVEVSKFHHMWSFFGRSYNYNLFIGITEFLIGGLILFKRTRLIALLLALGLCTNILILNIEFDIRFAISHITLDLAITIILLSSYLNDLYKFFIKLGGKLDGSNIQPKRKFTKLFPYAFLIILSVSYFIYSFYLKSKYIVDENVIGSYKIKKIKVNDSVVELNKGNLGKNPMMFIEYNNQFVLSIEDTLYMGRYILDTENIKIYLDNPTKFGMTSLIGSLEIDTIRGKIDKERSIEMFYEKIDGSKNYLNDLYK
>NZ_CP022515.1|WP_093978204.1|2317996_2318863_-|carboxypeptidase-like-regulatory-domain-containing-protein
MRIRNIPLFIVVNFFITGFAFCQVSGRVIDESNGQPIPYVNVWVKNTRIGATTGENGKYSIEGAKIGDTILISSLGYANIQFSAENENNVAMKAKINKLDEVVVIPMKNLAEFSVISFKKVKKNRNWYNNGHYSLARFFNYKHEYDKTPFLSQISLIALNAKMDNVVFRIRLVEVSPNGEPSDNGLTDNIIIESQKGINEIIVNILKEKVLFPKNGFFIVVDRLNLEENYSFNKTAKMDILQPSIGMERTEQEKNTWFGFGGKWIPPLEMKKFLGTNGNIAVNIKLTN
>NZ_CP022515.1|WP_093978203.1|2316764_2317271_-|hypothetical-protein
MKNFWLIIFLCSLNQLFGQEVVLLKDLYVDNFLFYKVSDNQLFSGNAQKIRKNGHLVYEEFIENGILKKSVSYYNRTEKPIPALITEYHANSFDRKKEIRYDLSHQWRESRFYDINKNKTLVEEYENDKLIYRCEYMNNKKHGTEFCYDKQGNEIKIQYKNGKKETTQ
>NZ_CP022515.1|WP_093978202.1|2315937_2316564_-|hypothetical-protein
MNTFVTHLLTILKWDFRPAGEVRNREIRVWRQNGWNGMFYPIFKFDLNKDGHLINISDRINPVGQIMYFLFCVVFSIPWLNWIFDDFDPLFHWIEILGWVIFLGIFLIIGFKVYRMEKKIQLQQIYEILDIEIENKEAEKEWGWKKIMVRSITYPLSIFLIFVCIFAAIPQGKYFLTLCILSIIGVYLYTDLKIILGKKTTGNNNYNK
>NZ_CP022515.1|WP_157730755.1|2315022_2315745_-|hypothetical-protein
MIRFLALLFLLSFVMCKTESKDVSNLSECITENYYPNGKLKSTGVTFGENQPIGEWSYYDSTGLLKRKAEYLKIDGKAYLNQDWYFNKVGDTLRSKGSHFDIVFEKDTIFLNEPIKAKINLNAPLFKNKNSEILIVIPKDYSINFNKDFSNLKEVELDTTFNLNLEKEIRAAIGITTDFGKYAIFGRYFNSIGNKKFRGIIVEYFYQDSITSDSVRLNYFENKKYFEKDIYVVDSLDTRE
>NZ_CP022515.1|WP_093978210.1|2326490_2327459_+|amidohydrolase-family-protein
MRFDAHVHFNTLNESFLNYGMENGMRFLSIVTDMPFFPSIKDQLTTILKIKKIYPDQIDFATTFSCNGWGGSNWLSKSLDNIDRSMNLGAVGVKVWKNIGMSLKDDKGNYVMIDHPSFEPIFQFLEDNDILLLGHNGEPKNCWLPTKDMTVESDKAYFMAHPEYHMFHHPEVPNYEAQLRARNNLLKRHPNLRFVGLHLASQEWDTNEVGAFLDQFPNAMVDLAERICHLQYQTIDHWKKIYDFFITYQDRIIYGSDIVVDNSLTDDVLIQHMNERYQNHRKYFTENEWMTVQKVNGKFKGLGLPVSVVDKVYSATALKTYK
>NZ_CP022515.1|WP_093978211.1|2327527_2328580_-|hypothetical-protein
MKSTSYAPFKKACFFLFPLISSLCFGQIKIIYETDMETDCEDAVALAMLHAFQDNGEVHLLAVMHNTSDDYSVGYIDAVNTYYGHPNLPIGSYKKDDTYSRDIAILLNCCTDYTQPIVKDTRFAHDVDTRKDVPDAVDLYKEILQQQPDNSVVIISVGYLLNLKNLIKDDQGMELVRKKVKDLIIIGRTWFPKDTMLPLSMNLGGQQINHTAAMASMEVFEHWPRPIHVAGNFIPRPYHRGKELMNTPENNPVREAYRIYRERYGDWDHHLADLETVYYAIYRDQKPEYFTLGTDGTPKIGLHSEPNGIRYFYNLWDTSEDSQHLYWLTKEDKFAEISERIGELIVQPPK
>NZ_CP022515.1|WP_157730757.1|2328896_2329748_-|hypothetical-protein
MALNKSTVVLLFLAMTVSGKLKAQKLPLPARANDAISGSTFKNQIYTLSVEDRENQIYQEILNGNIPTFLRDLVPISFSKTIKDSAYVVTYYVLPDYLAVGSDADYFIIPTTPILAQKIAKAIGFTLPTKKMVDQIWSNASVKLPPSPIPPSAQMTTIPVMWEHNTRLKGQRKETLKQAPMGDLVAGHKKDVIISNKIYEKSSKPVVIYGWHYQNGTPIQPVYAGHGETYADYSHGIRLVQDSVLINNKVHLITEVLQDTQKSSLFSDEGVIEKPFYPVDKIE
>NZ_CP022515.1|WP_093978213.1|2329816_2330776_-|ornithine-cyclodeaminase-family-protein
MNDITQIPASFIEQNTNFPDLINALRTAFSAQDTLVPMRHHHDFPNPEVEEDSTLLLMPAWKPGKQAGVKIATVSPKNGQFNLPAIQGTYIYLDALKGSILALLEAKSLTVKRTAAASALASQYLSRENSSSLLMIGTGALAPNLILAHASVRPIKTVYVWGRDHSKALSLSQKFKNASFHVQPIKVIEDKISDVDIISSATLSKTPLVLGKYLQPGQHVDLVGAYKLDMREADDEAVKKAEVYVDTYQGGLKESGDIVIPLKSGILKETDIKADLFELASQFKGGRKSAAEITMFKSVGHALEDLAAATYYYNMYQAV
>NZ_CP022515.1|WP_157730759.1|2330958_2331123_-|hypothetical-protein
MKCHKGILVYEKGNVPLRQNESHLKHILASLPKRYSGELSNLAGKAFNVDPCSK
>NZ_CP022515.1|WP_093978214.1|2331458_2333225_+|c-type-cytochrome
MAVLLRIYNILIILLFSGIMMQCTKSLPPGDPDNGGLVLPEGFEAVVVVDSIGPARHLAVNDNGDVYIKMRFAHPEGENIGLRDTDNDGKADQIERFGVFDQRGYYATGMRIYKDYLYYSTASTVYRQKLTRGKLVPEGEPEVMLTDDYQNSPYGYSHIAKPLTFDGDGHMYVPFGSPGDVCQSKEQNRMPGALGQDPCPELEWHAGIWQFDANKPGQTQKDGYRYATGIRSVVGMDWNPYDNTLYALQHGRDNLNRNWPEYYSPWQSAMLPSEEFLKVEEGANAGWPYYYYDHMQGKKLLNPEYGGDGKKEGDGAKYEQPIIGFPGHWAPNDLHFYQGDQFPEHYKNGAFIAFHGSTIRAPFPQAGYFIAFVPFKNGQAGEWEVFADGFTQVDKIVDTDDAGYRPMGIAMGPDGSLYISESEHGKIWRVMYKGDKKSFGKDQLSKMEKLKKLPHIKTPDETKDDLTPLRAEAGAILYNKYCGACHMGNGMGDGSRFPPIAGSEWVKGDQKRLIDVVLSGLSGPIEVNGKTYDGVMPAVDYLEDEEIAQILTYIRKEFGDNSPPVGSYYVKEGRYYARKKKEALKSGD
>NZ_CP022515.1|WP_093978215.1|2334210_2335797_+|sulfatase
MKMKFFVTVLGLALLTITSCKNRTEDKKVVSTERPNILFIMSDDHTAQAWGIYGGILKDYVHNPNIKRLAAEGCVLENCLVSNSICTPSRATILTGQYSHVNGVTTLGAGLSPNHNNIAKELQKGGYATSVIGKWHLKQEPAGFDYYVVLPGQGDYWNPRLKTADNWEDYYGGGKVVEGFSTDIIADKTMEWIENRDKSKPFIAMCHFKATHEPYDYPERFSHLYRDEEIPVPDSFYDQGAETTGRVFKGQSIDNLQKRYLAATADPELRKDYMAYPELPFSVDGLSADEARMKTYQKFVKDFMRCGAAIDDNIGRLLDYLEKSGLAENTIVIYTADQGYFLGEHGWFDKRLIYEESIHMPFVIRYPKEIPAGTRNADIIENADFSALFADYAGIDYPDTMQGHSFRENLKGNTPADWRKHGYYRYWDHSKDRPGHFGIRGERYKLAFYYGNGLKVNGYSEEEQPEKYWEFFDLEEDPNELYNAYADSDYQDVISEMKAEILRQRKMLGDLDEGNEEIHQIIADHWND
>NZ_CP022515.1|WP_093978216.1|2335847_2336573_-|response-regulator
MNCIIIDDEPLAIDVLTDYCKKIDFTDVVGTYTNPLDAITVIKEKKVDLIFCDIEMPQISGLDFINALENRPLFVFTTAYTQYAVEGFELNAVDYLVKPIPYHRFIKAISRTKEILAQKLKPTEANIFPSFGGSNDNQKFIFVKSEHENIKINLDDIEYIQGLKDYLKIHIAGTNKTILTLLSFKDLMEKLPHYQFIRVHKSFVVNVNVIKTIQRNRIVINDTRIPIGESHKTQFFAFLGL
>NZ_CP022515.1|WP_031442154.1|2336553_2337615_-|histidine-kinase
MAFDKKNIPQWLVHTLLWSTLSILLFFPFLSESRTIPYGLGAKLLLAIALFYLNYYYLAPKLLLKDRMWTYIGLSVLLLLATGILSNLVHPPMGPDDLPRRAARMRPFTDNGPGAFRFLLMTTIIFAVPYIFGTMLKVYTEWQKNEDLRKLVEKEKIQSELQFLKTQLNPHFLFNSLNTIYSLSVKQSPDTSEAVINLSELMRYMLYEADKRLVPLAKELEYIKSYVALQRLRLSNSEDVSLKISGEERGKFVPPLLFISFIENAFKYGTDYNGKTFVKINLSINNESIHLQVTNIIGTFKAQSKSSGVGLENVKNRLNYLYPHAHVLLIADDGKTYEVNLTLNFKNYELHNN
>NZ_CP022515.1|WP_157730761.1|2337623_2337968_-|DUF4907-domain-containing-protein
MKRILVLYILIAVVSGLLFLNFTDYTLGSTKSKNPLHSETFKVGNGYGYQIALEDKVLIRQEYIPILEGNKPFTSAEDAERTANRVITKLLRKESPILTLLELKELQIPEFNSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_5

2740429-2740529

Orphan

Consensus_repeat	Method
TCCATTTTTGAATGATCCATTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_5

>merge|NZ_CP022515|5|2740429-2740529|CRISPRCasFinder
TTCATCTTACTATGATCCATTTTTGAATGATCCATTTTACTGTGGTCCATCTTACTATGGTCGGTCGATTTTGGGTCTTCCATTTTTGAATGATCCATTTT

>NZ_CP022515|5|5|2740429-2740529|CRISPRCasFinder
TTCATCTTACTATGATCCATTTT	TGAATGATCCATTTTACTGTGGTCCATCTTACTATGGTCGGTCGATTTTGGGTCT
TCCATTTTTGAATGATCCATTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093978439.1\|2748117_2749131_-\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240659
NZ_CP022515.1\|WP_093978431.1\|2740606_2740900_-\|phosphoribosylpyrophosphate-synthetase	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730775.1\|2732926_2733103_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730773.1\|2729633_2729978_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978429.1\|2737227_2738436_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP022515.1\|WP_093978435.1\|2745561_2745816_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978425.1\|2730649_2731498_-\|DUF1080-domain-containing-protein	unknown	unknown	gnl\|CDD\|368908
NZ_CP022515.1\|WP_093978423.1\|2728840_2729476_-\|protein-SanA	unknown	unknown	gnl\|CDD\|225500
NZ_CP022515.1\|WP_093980561.1\|2742455_2743958_-\|thymidine-phosphorylase-family-protein	unknown	unknown	gnl\|CDD\|235289
NZ_CP022515.1\|WP_093980560.1\|2727557_2728808_-\|divalent-metal-cation-transporter	unknown	unknown	gnl\|CDD\|224826
NZ_CP022515.1\|WP_093978433.1\|2741553_2742447_-\|ribose-phosphate-pyrophosphokinase	unknown	unknown	gnl\|CDD\|235960
NZ_CP022515.1\|WP_093978432.1\|2740906_2741557_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730779.1\|2735933_2737052_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236888
NZ_CP022515.1\|WP_093978427.1\|2734148_2734328_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225186
NZ_CP022515.1\|WP_093978436.1\|2745854_2746694_-\|ATPase	unknown	unknown	gnl\|CDD\|377053
NZ_CP022515.1\|WP_093978438.1\|2747256_2748087_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_CP022515.1\|WP_093978437.1\|2746686_2747241_-\|two-pore-domain-potassium-channel-family-protein	unknown	unknown	gnl\|CDD\|369572
NZ_CP022515.1\|WP_157730777.1\|2733198_2733360_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978434.1\|2743988_2745365_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293853
NZ_CP022515.1\|WP_093980559.1\|2727046_2727238_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093978433.1\|2741553_2742447_-\|ribose-phosphate-pyrophosphokinase	gnl\|CDD\|235960	PRK07199, PRK07199, ribose-phosphate diphosphokinase.	7.44218e-151
NZ_CP022515.1\|WP_093978429.1\|2737227_2738436_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.62713e-57
NZ_CP022515.1\|WP_093978425.1\|2730649_2731498_-\|DUF1080-domain-containing-protein	gnl\|CDD\|368908	pfam06439, DUF1080, Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.	3.33736e-34
NZ_CP022515.1\|WP_093978423.1\|2728840_2729476_-\|protein-SanA	gnl\|CDD\|225500	COG2949, SanA, Uncharacterized membrane protein [Function unknown].	6.59471e-82
NZ_CP022515.1\|WP_093980561.1\|2742455_2743958_-\|thymidine-phosphorylase-family-protein	gnl\|CDD\|235289	PRK04350, PRK04350, thymidine phosphorylase; Provisional.	0
NZ_CP022515.1\|WP_093980560.1\|2727557_2728808_-\|divalent-metal-cation-transporter	gnl\|CDD\|224826	COG1914, MntH, Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism].	2.19033e-19
NZ_CP022515.1\|WP_093978439.1\|2748117_2749131_-\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240659	cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains. D-Lactate dehydrogenase (LDH) catalyzes the interconversion of pyruvate and lactate, and is a member of the 2-hydroxyacid dehydrogenase family. LDH is homologous to D-2-hydroxyisocaproic acid dehydrogenase (D-HicDH) and shares the 2-domain structure of formate dehydrogenase. D-2-hydroxyisocaproate dehydrogenase-like (HicDH) proteins are NAD-dependent members of the hydroxycarboxylate dehydrogenase family, and share the Rossmann fold typical of many NAD binding proteins. HicDH from Lactobacillus casei forms a monomer and catalyzes the reaction R-CO-COO(-) + NADH + H+ to R-COH-COO(-) + NAD+. D-HicDH, like the structurally distinct L-HicDH, exhibits low side-chain R specificity, accepting a wide range of 2-oxocarboxylic acid side chains. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain.	0
NZ_CP022515.1\|WP_157730779.1\|2735933_2737052_-\|hypothetical-protein	gnl\|CDD\|236888	PRK11263, PRK11263, cardiolipin synthase ClsB.	2.39363e-69
NZ_CP022515.1\|WP_093978427.1\|2734148_2734328_-\|hypothetical-protein	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	5.99663e-07
NZ_CP022515.1\|WP_093978436.1\|2745854_2746694_-\|ATPase	gnl\|CDD\|377053	pfam03477, ATP-cone, ATP cone domain.	0.00023598
NZ_CP022515.1\|WP_093978438.1\|2747256_2748087_-\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	4.20351e-22
NZ_CP022515.1\|WP_093978434.1\|2743988_2745365_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293853	cd16295, TTHA0252-CPSF-like_MBL-fold, Thermus thermophilus TTHA0252 and related cleavage and polyadenylation specificity factors; MBL-fold metallo-hydrolase domain. Includes the archaeal cleavage and polyadenylation specificity factors (CPSFs) such as Methanothermobacter thermautotrophicus MTH1203, and Pyrococcus horikoshii PH1404. In addition to the MBL-fold metallo-hydrolase nuclease and the beta-CASP domains, members of this subgroup contain two contiguous KH domains. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. .	7.73103e-102
NZ_CP022515.1\|WP_093978437.1\|2746686_2747241_-\|two-pore-domain-potassium-channel-family-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	5.42621e-07

>NZ_CP022515.1|WP_093978429.1|2737227_2738436_-|MFS-transporter
MDKKEKLNRIFLILLSLFVVMLGYGILLPILPYYTERLALKDDLDPDLINYHIGMLTSIYPLFQLIFVIVWGRLSDKYGRKSIILVGLIGFITMNLLTGLATSLTMLYVARILGGVFTSSVIPVSNAYLSDITSEKRRTKIMAWSGVAISSGLIFGPVLGGLLSQTNVHLKYSFGLFHLDRFSVPFLFAAVLGLIVLFIIIKWLNSTAIVAKIRKKETKLSVSFSRYFIVLLTLSFVMQFVVTLFETVFSIYGKNELEFNSSQVGIGFMLCGSVMAALQPVFATYGEKIMTTKQQITVGLLITGISLVVFPFLRNELSVYGLIILFASGGAMVTPNLLSSVSLISKEDTGRNISIQSSTNSIGQILGPVLGTWLLAGGFYYPFIIAGSVVLIVIGLVYYLRQ
>NZ_CP022515.1|WP_157730779.1|2735933_2737052_-|hypothetical-protein
MGEMHHEEEYIELVHSGEDYFYRLGKIIENAKKEIHLQTYIFENDSTGNRIAALLKEAAQRKVKVYVLLDAYGSAALPDSYVNDLVQYGISLRFFSPLFSWNNFYLGRRMHHKIVVADEKTALIGGINIADKYHGTPESEPWLDYAVQLDCPAATHLQRLCADYFFKQGSSKKIKPVMHLMDKARVGILQNDWLKNKTEVCDAYTNAILHAEKEIVIVGSYFLPGSIITKALKKACKRGIKTTVILAGISDVPLVCRATQHLYSSFLNHHMRIYEWNRSVVHGKASVVDKKWSTVGSFNLNSLSCYGSIEMNVEIHSVEFAENLRTDFEKVINECSEITKERLRQRAGIFSRALKSRFIQNASVDHKFEQGI
>NZ_CP022515.1|WP_093978427.1|2734148_2734328_-|hypothetical-protein
MNGFLKDLTMKKFYNNEEEQSYDAIVVGTSISGGWVAKELCENGLQTLVLEREKMVRHI
>NZ_CP022515.1|WP_157730777.1|2733198_2733360_+|hypothetical-protein
MVVEFALFMYKTYLKSIIEVNCPDTEMVVHDISSQLILVVAHPVWEAIGFGLH
>NZ_CP022515.1|WP_157730775.1|2732926_2733103_-|hypothetical-protein
MKNYFVNKVAIPTISKNSVLKELVNGVFSGLWMNEDEKIESIMKFNIRYENNRFYVQM
>NZ_CP022515.1|WP_093978425.1|2730649_2731498_-|DUF1080-domain-containing-protein
MKAKPNKALFTLLLIIGLGLISSDCSAQKNIKWQQLFNGKDLNDWQIKIRHHKLNDNFGNTFQVNDGNIQVRYDQYSKFDEQFGHLFYKQPYSSYIIGVEYRFVGDQVNEGPGWAYRNSGIMIHGQDPATMTVDQDFPNSIEVQLLGGNGKDERSTANLCTPGTQYVKDGKIVKQHCTNSSSKTYHGDQWVRSEVLVLGDSLIVHYVNGEEVMRYNKPQLDPIKGSEEGELLKSGSISLQSESHPVDFRKVEIIDLEKYADKPKKLKKVIAKLMAQKRVALQ
>NZ_CP022515.1|WP_157730773.1|2729633_2729978_-|hypothetical-protein
MSSVSNSKISGKVTFTKNEDGSTTILLEINGSSTDIHPAFIYFGDAGGNGEVAITLEPIDCDCESSSTIITTLDDGTPITYDQLMKFDGHIKIHQNEDHLEIIITEGNIGANAN
>NZ_CP022515.1|WP_093978423.1|2728840_2729476_-|protein-SanA
MIKKFGILFLIGLVGVYLILASCDSIIEKATQNRTYWNLKEVPKNKVGLVLGTSNRLVGGGSNPYYTNRINATLKLFKAGKIDFVLVSGDNSTLYYNEPTVFKKDLILGGIPTEKIFLDYAGFRTLDSMVRAKYIFGLDSVTVISQKFHNERAIYLAKQKGLYAIGYNAEDLSIKHALKVHIREYFARVKVFIDLALNTQPKFFGEKIEIK
>NZ_CP022515.1|WP_093980560.1|2727557_2728808_-|divalent-metal-cation-transporter
MASIQKLIKNLGPGLLFASTAIGTSHLVLSTKAGAQYGWIMVIPILLANIFKYPFFEFGVRYTNITNKTLIEGYLNRGKAYLIFYAIITLFSTFTILAALYVVTSGLLINLFQLTNTPVSVVAGGLFILICALLIIGRYKLLEISLKYVISILFLALLVTTILVIASGKVTEVENFKTPNIFNEVGILFLIGLMGWMPTAVEASSWISLWSIEKFKNSKHKPTLKEALQEFKFGYFTTAILAIFFMIIGWFTLYGTNTELSNNAVVFADQLVQLFTTNIGSWAYILIAIAAFATMFSTCITAHDALSRVSVDILSLLFPKRELIKNRGFTIGVLLLAVMNFMVISTFSANMGVLVAMATFVSFVMAPIIGYMNLKNVMSQEIPEMHRPDRNLQILTYLGILFLTLFSVYYCWMLFF
>NZ_CP022515.1|WP_093980559.1|2727046_2727238_-|hypothetical-protein
MKLIRIKRNTRNEKRYNSKMGILYTRVTYIKEVVFGIPIRTLHKYRETYYGEIKDCSECNLAR
>NZ_CP022515.1|WP_093978431.1|2740606_2740900_-|phosphoribosylpyrophosphate-synthetase
MKSYDTLSEAIQDLQRRGYGNDFNLKPHCLECVSLKLEIHPEDFYVDEMHRFEGMSSTDDNSILYAISSKNGIKGTLVDAYGVYAENISEQMRKKLR
>NZ_CP022515.1|WP_093978432.1|2740906_2741557_-|hypothetical-protein
MKRTIYILTVLLVSLSVRAQKEMLIGQLVNRSVVRENFDKNGVFLNKQTFKSGMLKELNGYYEIEVLTELFDENKKLNDTYTTNYRCRPEESSIMVMAFPFSNPKAKETEINTNSKNFKELYDLDNLEDIELEMSFDSGLLDFFGSKSKIKIYDRIVEPNGNSRNIKSKINIKAYAIGIRFKQLDYVVNETLNDKGLLSSQKFTEKDGSYFTMTYK
>NZ_CP022515.1|WP_093978433.1|2741553_2742447_-|ribose-phosphate-pyrophosphokinase
MKTILFSLPGNQELTAQLAKKMNAEIGECKLRKFPDGESYTRILSDVKGKCVVMVCTLHEPDEKLLPLYFLSHTAKSLGAMCTCLVAPYLAYMRQDKVFHEGEGVTSTFFGKLISGFADSITTIDPHLHRISSLGEVYDIPNRVIHAADAISKYIKENIHNPVLIGPDSESEQWVSDVAKKAGVPFTVLQKVRHGDRDVEVSVPDVEKYKESTPVLVDDIISTARTMIETTEHLKNAGMKPAICIGIHAVFSGNAYQDLWDAYVENIITCNTIPHQSNGIDLSDIIAKEVTELMHHT
>NZ_CP022515.1|WP_093980561.1|2742455_2743958_-|thymidine-phosphorylase-family-protein
MEEKSNILKYKPLGIYTQNENVVYMREDCHVCISEGFEALTRIRVSNNSTSIIASLHIITSDVLRPGEMGLSQIAAKKLKVSDGETLYVSHLEPIESLSFVRSKIYNQRLDYKAYKDIITDIIEGDYSNIHLSAFITACAGDRMDIDEISDLTKAMITSGKQLDWKKEIVVDKHCIGGLPGNRTTPIVVAIAAAYGLTMPKTSSRAITSPAGTADTMEVLTNVTLNGEEIKQVVEKEGGCLVWGGTAELSPADDILIKVEKALDIDSEGQLIASVLSKKAAAGATHVVIDIPVGETAKVRSEKAAKKLKEHMEVVGDSVGLKIKVVITDGSQPVGRGIGPNLEAVDVLSVLQNREDAPQDLKERALLLAGHLLELSEKVKPKKGHETAKELLESGKAYQKFEAICKAQGRFSKTYIAPYQFEVHAPRCGAVKKINNRKIAKLAKLSGAPQSKLAGISMNVCLGDVIEKGELLYKLHAETNGELNYALAYYENHDDIITIQ
>NZ_CP022515.1|WP_093978434.1|2743988_2745365_-|MBL-fold-metallo-hydrolase
METDTIKIHFLGAAGSVTGSKYLLDTGDRKILVDCGLFQGLKELRLKNWEYPPVNVNDIDVILLTHGHMDHTGYLPRLVKQGFKGPIYGTYPTLDIAKIILNDSAKIQEQEAQRANKEGYSKHSPAEPLYDLKDVEQTIPHFKAIPQSQWIPLFDGIKARFQYNGHILGATFIELDVHGKRFVFSGDIGRTNDLLLYPPLKPKKADVLFMESTYGGRFHPEEAEAIPQIEKLVNETIDKGGSLFIPSFSVERAQLMMLIFWRLLKENKIPKVQMIMDSPMGANVLELFHRTRDWHRLEDNECDEMCSHFTVVSSYRETMELRTDNKPKIVIAGSGMLTGGRMLNYLETQAQNPNNTLLLVGYQAEGTRGRKLLEGEKELKVYGKTVTFKMQLAEIEGLSAHADHAELLDWLSDVKEPPEKLFIVHGEKEGAEALKQGIKETYGWESEIPQLYGIEEIK
>NZ_CP022515.1|WP_093978435.1|2745561_2745816_-|hypothetical-protein
MKTKELQKQKSIELEPFYQAMEDEPMLLEEAFEILLEMVNSEPKSAKKLALLIKEDFHDLYKEIETLCKSNQDKGNTPSCCGGL
>NZ_CP022515.1|WP_093978436.1|2745854_2746694_-|ATPase
MDKIYIIKASGEKALFEIEKVINSLERAGADKLLIKEIVQDINKEVHDGMTTKKIYQMAFNLLKRKSRASASKYKLKKALMELGPSGYPFEKFVGKVFDHEGFDTRVGVIVQGNCVQHEVDVIAQKDHKHYMIECKYHSDQGRFCNVKIPLYIQSRFLDVQKQWEKQQGHKTKFHQGGVCTNTRFTSDAIQYGTCAGLMLTSWDYPKGHGLKERIDRLGLHPLTSLTTLTKAEKSKLLDKGIVLCKEINENPSLLEQIGIPKQRQKNILEDSRELCTAH
>NZ_CP022515.1|WP_093978437.1|2746686_2747241_-|two-pore-domain-potassium-channel-family-protein
MSGSLNQIREKPFYKLLLGRTTLPLVTILGIGTLYAVLMSMVDHKSLPFHIIIVTAALGKTIVITMTTLKRLSKLIKICHSLERLLWVFGLIIIISVFSFATDYACLFQFNNSTFVGVPDYSNSYLYNLYHFFYFSVITFSTVGYGDIIPTSDVARFVVMLEIFLSFFLIVFALANIKKIHING
>NZ_CP022515.1|WP_093978438.1|2747256_2748087_-|universal-stress-protein
MKNILVPTDFSENCNKAAELGIKMAKLYNAEVHFYHLIHTPVDWVKLDKLKEKRYPETLRKIGAAKSALRELEKRAEKEGLECRTFLEYQVETTKILKHSGHFHHDFIITGSSGTKGAVRELFGSNVEQIVRKSDVPVIVVKEEEVSFPFKNIVFVSDFDEDISEAFKHVISIAKKCNAHTRLLRVNTKTDTNSIEAGLNPIKTFVDKFPELKNYSMYVNNEPSVETGINTFLTYEPADLIAMCTHGNTGFLSLFSKSIAEGVANHSTLPVMTIKI
>NZ_CP022515.1|WP_093978439.1|2748117_2749131_-|2-hydroxyacid-dehydrogenase
MKTTVFSTHQFEKPYLESANNDTHELKLLELRLTENTAPLAEGSEAISLFTSDDASERVLEKLSALGVKYIALRTAGYNNVAIEKAKELGITVSRVPAYSPYAIAEHTVALILALNRKLIRAHNRVRDMNFSLNGLTGFDMNGKTVGVMGTGKIGKVLIKILHGFGCKILAYDLEEVEELKEKYGVRFTDCPTLCSKADIISLHVPFTPETKHIIDAEHIRVMKKGVMLINTSRGALVDTKAVINGLKSGKIGYFGIDVYEEEEGLFFEDHSDEILQDDVIARLMTFSNVLITSHQAFLTDTALTNIADTTIYNLDCFEKGIASENEIPIKSPPNMH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_6

3462909-3463016

Orphan

Consensus_repeat	Method
TTTCAGTTCTTTAATTTTAGGGATTATTCACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_6

>merge|NZ_CP022515|6|3462909-3463016|CRISPRCasFinder
TTTCAGTTCTTTAATTTTAGGGATTATTCACAGTAGGGTGAAGATCATTTGTGTCCCCCATTCGTTGTGAATTGCTTTCAGTTCTTTAATTTTAAGGATTATTCACAG

>NZ_CP022515|6|6|3462909-3463016|CRISPRCasFinder
TTTCAGTTCTTTAATTTTAGGGATTATTCACAG	TAGGGTGAAGATCATTTGTGTCCCCCATTCGTTGTGAATTGC
TTTCAGTTCTTTAATTTTAAGGATTATTCACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093978902.1\|3467818_3468490_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730818.1\|3465553_3465721_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978892.1\|3454128_3455313_-\|VCBS-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379232
NZ_CP022515.1\|WP_093978900.1\|3465824_3466433_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP022515.1\|WP_093980598.1\|3446726_3448181_+\|alpha-L-fucosidase	unknown	unknown	gnl\|CDD\|376461
NZ_CP022515.1\|WP_093978903.1\|3468608_3468899_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP022515.1\|WP_093980599.1\|3452000_3453854_+\|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein	unknown	unknown	gnl\|CDD\|372283
NZ_CP022515.1\|WP_093978896.1\|3461521_3462769_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271185
NZ_CP022515.1\|WP_093978904.1\|3469167_3469464_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730816.1\|3464891_3465035_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978898.1\|3463840_3464263_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730814.1\|3463622_3463784_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093978895.1\|3459031_3460954_-\|VCBS-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379232
NZ_CP022515.1\|WP_093978893.1\|3455367_3458202_-\|dehydrogenase	unknown	unknown	gnl\|CDD\|274225
NZ_CP022515.1\|WP_093978890.1\|3444435_3446679_+\|DUF4838-domain-containing-protein	unknown	unknown	gnl\|CDD\|374379
NZ_CP022515.1\|WP_093978894.1\|3458297_3458936_-\|DUF1080-domain-containing-protein	unknown	unknown	gnl\|CDD\|368908
NZ_CP022515.1\|WP_093978901.1\|3466433_3467435_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP022515.1\|WP_093978889.1\|3442176_3444417_+\|glycoside-hydrolase-family-92-protein	unknown	unknown	gnl\|CDD\|377950
NZ_CP022515.1\|WP_157730812.1\|3463105_3463462_+\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|211578
NZ_CP022515.1\|WP_093978891.1\|3448589_3451982_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274948

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093978892.1\|3454128_3455313_-\|VCBS-repeat-containing-protein	gnl\|CDD\|379232	pfam13517, VCBS, Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).	2.50508e-07
NZ_CP022515.1\|WP_093978900.1\|3465824_3466433_+\|hypothetical-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	0.0038298
NZ_CP022515.1\|WP_093980598.1\|3446726_3448181_+\|alpha-L-fucosidase	gnl\|CDD\|376461	pfam01120, Alpha_L_fucos, Alpha-L-fucosidase.	1.27177e-119
NZ_CP022515.1\|WP_093978903.1\|3468608_3468899_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00080158
NZ_CP022515.1\|WP_093980599.1\|3452000_3453854_+\|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein	gnl\|CDD\|372283	pfam12741, SusD-like, Susd and RagB outer membrane lipoprotein. This is a family of SusD-like proteins, one member of which, BT1043, is an outer membrane lipoprotein involved in host glycan metabolism. The structures of this and SusD-homologs in the family are dominated by tetratrico peptide repeats that may facilitate association with outer membrane beta-barrel transporters required for glycan uptake. The structure of BT1043 complexed with N-acetyllactosamine reveals that recognition is mediated via hydrogen bonding interactions with the reducing end of beta-N-acetylglucosamine, suggesting a role in binding glycans liberated from the mucin polypeptide. Mammalian distal gut bacteria have an expanded capacity to utilize glycans. In the absence of dietary sources, some species rely on host-derived mucosal glycans. The ability of Bacteroides thetaiotaomicron, a prominent human gut symbiont, to forage host glycans contributes to both its ability to persist within an individual host and its ability to be transmitted naturally to new hosts at birth.	4.87455e-20
NZ_CP022515.1\|WP_093978896.1\|3461521_3462769_+\|site-specific-integrase	gnl\|CDD\|271185	cd01185, INTN1_C_like, Integrase IntN1 of Bacteroides mobilizable transposon NBU1 and similar proteins, C-terminal catalytic domain. IntN1 is a tyrosine recombinase for the integration and excision of Bacteroides mobilizable transposon NBU1 from the host chromosome. IntN1 does not require strict homology between the recombining sites seen with other tyrosine recombinases. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.43011e-56
NZ_CP022515.1\|WP_093978895.1\|3459031_3460954_-\|VCBS-repeat-containing-protein	gnl\|CDD\|379232	pfam13517, VCBS, Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).	6.1124e-05
NZ_CP022515.1\|WP_093978893.1\|3455367_3458202_-\|dehydrogenase	gnl\|CDD\|274225	TIGR02604, Piru_Ver_Nterm, putative membrane-bound dehydrogenase domain. All proteins that score above the trusted cutoff score of 45 to this model are large proteins of either Pirellula sp. 1 or Verrucomicrobium spinosum. These proteins all contain, in addition to this domain, several hundred residues of highly variable sequence, and then a well-conserved C-terminal domain (TIGR02603) that features a putative cytochrome c-type heme binding motif CXXCH. The membrane-bound L-sorbosone dehydrogenase from Acetobacter liquefaciens (Gluconacetobacter liquefaciens) (SP\|Q44091) is homologous to this domain but lacks additional sequence regions shared by members of this family and belongs to a different clade of the larger family of homologs. It and its closely related homologs are excluded from the this model by scoring between the trusted (45) and noise (18) cutoffs.	4.70508e-79
NZ_CP022515.1\|WP_093978890.1\|3444435_3446679_+\|DUF4838-domain-containing-protein	gnl\|CDD\|374379	pfam16126, DUF4838, Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.	5.11067e-106
NZ_CP022515.1\|WP_093978894.1\|3458297_3458936_-\|DUF1080-domain-containing-protein	gnl\|CDD\|368908	pfam06439, DUF1080, Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.	1.83224e-38
NZ_CP022515.1\|WP_093978901.1\|3466433_3467435_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	5.54609e-23
NZ_CP022515.1\|WP_093978889.1\|3442176_3444417_+\|glycoside-hydrolase-family-92-protein	gnl\|CDD\|377950	pfam07971, Glyco_hydro_92, Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.	0
NZ_CP022515.1\|WP_157730812.1\|3463105_3463462_+\|N-6-DNA-methylase	gnl\|CDD\|211578	TIGR00497, hsdM, type I restriction system adenine methylase (hsdM). Function: methylation of specific adenine residues; required for both restriction and modification activities. The ECOR124/3 I enzyme recognizes 5'GAA(N7)RTCG. for E.coli see (J. Mol. Biol. 257: 960-969 (1996)). [DNA metabolism, Restriction/modification].	2.36956e-09
NZ_CP022515.1\|WP_093978891.1\|3448589_3451982_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	6.77338e-155

>NZ_CP022515.1|WP_093978896.1|3461521_3462769_+|site-specific-integrase
MLENSRLSVVFVTRKLNLENGNIKLYARVTVDGKRAEFSLNRELPVSLWDEKRKRGKGFSKYVISLNKYMDQVFTGLHEAHRQLLQEEVDITSAGIKARYLGEDDRGKSLLDLISYHNTSMISVLRKGTMKNYYSTERCIKEFLNEKMGVEDIPLKKLNYGFIVDFEQYIRKYKPATRMGCTNNGAMKHMERLKKMSRLAVKLEWLEKDPFINYKLRFEKTERQFLTERELQLIEDTTFTIPSTQHIKDLFIFACYTGLSFIDVSGLKSDHLVKGMDGNDWLYTKRTKTDEPLKIPLLPKAKEIIDKYRDNDSLLKSGRLLPLYSNQMINRTLRDIATACGIRKKITFHVARHTFATAITLSNGVPIETVSKLLGHTKLSTTQIYARVVEKKVGEDMQNLMATMKLKKVRAEEAS
>NZ_CP022515.1|WP_093978895.1|3459031_3460954_-|VCBS-repeat-containing-protein
MMLKRLIIFMFLTCTTVSYSQSANETLIRLQYKDTTTTKDLAVGLWANPLPMDYDQDGDIDLIISCTDVPFNGTFLFKNSTKDQNGNPIFDAPIKIGDGMRNVAISYVDGEPRVLGVGLEYDNFRRYGYTRPIGLYQASELLDLYKERFSDWKYVDYDNDGDLDLIVGIDDWSEYGWDNAFNEKGEWTNGDLRGYLYLLTNDQGKYRNDGKILAGNQPIDVYGNTTPNMADFDGDGDLDIICGEFVDRFTYFENTGSRENPSYAKGRFLENASGILEMDLEMMRPVALDWNNDNHIDLVVGDEDGRVVFIENTGTVKENMPIFKSPIYIQQKSQNLKFGALVTPFSVDWDDDGDEDLICGNSAGYIGFIENLDGGTNPDFKEPVYLEADGEVIRIMAGNSGSIQGPAERKWGYTTLTVADWDGDGLKDIVLNSIFGKVEWYKNIGTTGAPKLMKMGGIKVAWEKNKVPKPAWNWWNPEKEELATQWRTTPYAIDWNKDGLMDLVMLDHEGYLTFFERFKKRGKLYLKPGQRIFKNADGTMGNDLLRLTEREAGGSGRRKIQFTDWDGDGDLDLLANSENIEWYENIGETNGNTIFKKRGNLVNTKLAGHTTSPTVVDWDKDGKPNLLIGAEDGHFYYLMH
>NZ_CP022515.1|WP_093978894.1|3458297_3458936_-|DUF1080-domain-containing-protein
MNRLLLASFALLLLIIACKNTSDKKAISLFDGKTFAGWEGDTLTTWRIKNGTIVGGSLDQTVPHNDFLCTERSYANFILKLKIKLTGHEGFINSGIQFRSKRLIDPPYEMTGYQADWGENYWASLYDESRRNKTLMAPDSTKVLEWIKLDDWNDYEIRAENRRIRLYINGHMTVDYTEADTNIPQSGLIGLQIHGAGKALVAFKDIIIVELK
>NZ_CP022515.1|WP_093978893.1|3455367_3458202_-|dehydrogenase
MAFTIGCKTKNEKETADKIVLDSTIIDRDYALEATMLGYFAQDGTRNPTLRANQGDRVRITITNGETMTHDIAMEKLGIKSGTLLEKGSSTSISFWAKNNDTYFCTVPGHRAAGMVGKFEVVEGDLSGPTIAGVLPSKNEKPINLGFEAGSLLDWTATGDAFKTPLYNQDPSPIHEADAKISFDGNYFLSSGGNTNYKLTGTLNSIPFKVSHPYASFRISGGALADTRVELVLAETKKVIFSSTGQGRATLQPVVVELEPYLEKEIFIRIIDNETGISQIPYIKDDKWAHINFDDFRFYPSRPYFPNELNKDDIIVLPPLDPILNSGLSGEEAAKAMTMPEGFKISLAASEPDVVRPISFTLDARGRLWVVEAHTYPTPAPEGQGRDRILIFEDTNGDGTLDKRKVFTEGLNLVSGIEVGMGGVWLGAAPYLLYIPIDSEKDKPAGPPQKLLDGWGLDDTHEVLNNLRWGPDGWLYGVQGVFTHSNVGKPGASDKNRTKINAGVWRYHPTRHEFEVFAEGSSNPWGIDFNDYGHPFITVCVIPHLYHVIQGARYQRQAGEHFNPYTYDDIKTIGDHVHWLGDRGPHAGNFRSAAAGGGHAHAGAMIYLGGDSWPKKYRNTIFMNNINGSKLNNDQLTRSGSGYVGSHNQDFLAMNDSWSQWLNFKYDPSGSVFAIDWYDQNQCHSSNPDVHDKTLGRIFKISHDNDRWVQVNLYKASDLELVNYQLHPNEFYVRQARTILQERGANPEVHATLKKILANNVDITRKLRALWTLHVTQGINEKELNHLLSNDNEYLRSWAIQLLTEDKKISPTTLDRFVDLAKNDASAIVRLYLSSALLRLEPATRWRVLEALVQKSEDVADHNLPLMLWYATEPLIPLDVKRALELAGKAKIPNILSYTLQRIDALNTVDSKNLLKKYKEQLTAGDKEENQAHIMLIDNLLSEQ
>NZ_CP022515.1|WP_093978892.1|3454128_3455313_-|VCBS-repeat-containing-protein
MKRKTTKTIGQLLGGLILYMGCIVGAYGQTETSKDFKKTVLTRDFISEGVAVADLNKDGQMDIVAGYYWFEAPDWTRHEMAPSRTFDPWKEYCESFLNLGMDVNLDGWEDVIIIDYPGKPGFWFENPKNNSGVWKKHIIAEGMGISNESPGFVDIDGDGRLDILCGDVEKKQIVWLQAPLNPGETQWKRFPISAENVPGTERFSHGIGLGDVNNDGIDDVLIAEGWFKGKTDKTSGNWEFQPTKISEPCSHMQVLDINGDGNNDVVTASAHALGIWWHERQEGENFNTHLISTTTAQTHATIMADLNGDGNKELITGKRYLAHNGNDAGDSDAPILLYLEFTPDNAPYFQEHIIDNDSGAGLNIVVEDMNKDHRPDVVIANKNGVFLFENMMGK
>NZ_CP022515.1|WP_093980599.1|3452000_3453854_+|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein
MKETYKIVLILLAVFIAGCDKEDFAELNSDPSTLAEPDLRYSAAKVINDMYTNDYVIWFYTNFDYVYPWSQITGTGIGNPETFVEMAAQGGSQNVYNIIPNAKDIRAKIEALPEDEKATMQGIVGVTYVAQVATALTQTDYTGSMVYTEAGLAPYTSPPLITPVYDQQELLFDTWLEELDQALVDLTAADQFSLGTQDIIYGGDYGKWAKFCNLLKLRIAARLVNANRSKALSIAEEVASSPAGYMNALDEDFIYTRGVEYRGTGNGTQPGTGGLNLIDFLRDNKDPRVRFLFDKNDFNAEVVQAFIDAGTPLPSYVEQYVVLDGSGNFESWSGPGEPWIRYHGAPVSPDKQQDGAYDDYFKQASQNRITLDGVEKTYSSTSSFAEKNTRTSIDYTYPTKPGGRLIQKNGNHPPLEVILGSSAETNLYLAEFKLLGANVPGSAQAYFNQGVELSIRRMDALAKNTGTYYYESDPVYMDETMAELASTKLKDGEIADLLALPDYDLSTDGLEKVYIQQYVNFAITPHDTYTTVRRSGVPMVGSSVLAWEPIVAAGAPLTIPRRFEIGTPTEDNVNFANAKKSVEEQGFTTGTNDPSILNSQRIWFDVNNPNYGEGPKN
>NZ_CP022515.1|WP_093978891.1|3448589_3451982_+|SusC/RagA-family-TonB-linked-outer-membrane-protein
MIKKFHYYLLLASFLFVQGITAQNKTVSGTVKDDVGTPLPGVNVVEKGTTNGTSTDFDGNYSISISNSGTLVFSSLGFTTIERSVSGVSTINVSMEEDSEQLGEVVVTALGIKREAKAIGYAMTEVQGEELARINVVNPVQSLQGKSPGVSIGASDGGLFGNSKIQIRGVSTLNSSNNQPIFVIDGVILENATSGASADWNASSNDYGNILKNLNPDDYKSVSILKGAAATALYGSRGINGVVLITTKDGSGTRGIGVSVRQSVGFDIVYKGPALQNEYGPGALAGYTDYGNQDGEGNYYQWDTQQFYYNSEGQPSLVNHPWGGLSFGPKFDGRLIEDYDGNMVPYLAQKNNMLDAYQTGINTNTSVALSGGNDKGNFYLSDSYNDRTGTLPNNSFTRNSLMFRGSYNLAPWLRASASVSFTDSNSHNPRNDISQSFFDGTFERIYNTEKYKQNQYWQAPHGGVPNANYGDEFTNVPNRGLWFAYENNNNYNKETVVRPIVTLAADVTDWLTITAEGNMNHYTTEYENKELGSGYANEGGYYELRHNKDVSKTGKLTFNFSKDITEDLSGNLLLGGEIWEQEKSYTRSWTDGGLIVPGRFYLGNSLRTQRGEGGVSDTKQLNSAYFLANLSYKDQLFLDITGRNDWTSALVYTDGTGNNSYFYPSVSGSWVFSEATGTSNWFTFGKLRASWAQVGSDTSPYTINKGYGQGSIDNGGNFVYTNTVNTTLVDRSIKPELKDSFEVGADIRFFGNRLGFDVAYYDETISEQIGNVPLPSESGYNNLLTNIGTLTNSGLELTVMGTPIKGNNFSWNTTFNYWNNTTKIDDVHPDFGDYKSLGGDISYGNFRVGSVAFEGGEYGILYSDSAPKKFESSDPNHPNNGMNQLIWVDSRRGAYFERSGEAEEVGKVQPDFEGSWNNEFNIGNFNMSILLDARYGGHMASYSSRYGTAYGYTESSLYGRDPEHGGVTWTSGYADVQGTQFSDGVIPDGVFAEGQMVTAPNGTSVDVGGMTYQQAYDAGHVEPTHATYYTYRLNSWGNGVINDNWFAEVKYIALRNISLGYNLPKMAASKMGARNIYLGINARNVAYLYNSLPNDINPESFRGTTSSDSFRERSFSPYLASYTFSIAIDF
>NZ_CP022515.1|WP_093980598.1|3446726_3448181_+|alpha-L-fucosidase
MPLTLTFICQLVGAQAIYEDERYVPETDPLVLEKLEQWQDLKFGLLMHWGTYSQWGIVESWSLCPEEYGWCERTKGSNPSDYNTYKKEYEGLQKTFNPVKFDPDKWAKAAKNAGMKYVVFTTKHHDGFSMFDSKYTDYKITDPKTPFSTNPKANITKEIFNSFREQGLWAGAYFSKPDWNTPTYWDPYYPPRDRNVNYEPEANPEKWQSYIDFTHNQILELLTDYGKVDILWLDGGWVAKTPKSEITNWYEQQLVNNDNGYLKNRIVNQDIKMDELVVKAREKQPGLIVVDRAVHGKNQNYLTPENRVPEKPLPYPWESCIIAGGGWSYSFDAKYMSGREAIHTLVDIVAKGGNLLLNVAPSSEGEWDEGAYKLLNEIGNWMSVNKEAIYGTRSMAPFKFDNVCVTAKPDGSVYLTYLVEKGQTSLPTEIVFPDFKPKRSVKAQLLGTKQKLKWTQKEDGMVIQLPNDMSVKLLDTEAFVIKIK
>NZ_CP022515.1|WP_093978890.1|3444435_3446679_+|DUF4838-domain-containing-protein
MKIFKSNFRILSLLIILLIFTSCNRDGIELVHDGQTDYEIVFMGNATESQYKSAEILQRYLKEISGVELELVDESSQDLNKNKIYVGNIKGEDLKQQEIAIRTENKDLYILGGSDKATKYAVYEFLERYLNCRWYAPEVEKIPVSKIIDLPALDYVYTPDITTRTVHSRLFYDNPDYAEQQKVTQESFPTYVPSARVHTFHKFLPEEKFYKSHPEYFALRGDQRLPTQLCLTNPEVLAIVKDSVASLFEQYPQSKVISVSQDDNRQHCQCDNCSKIDEEEGSASGTMIRFVNEVAANFPDKMISTLAYQYTRKPCKTKPLENVLITLTSIECDRSAPIEEKCADFANDLVGWGKLTQNIRIWDYTTQFTNFFAPFPNIHTLQPNIQLFRDNNAKWVFEQHSNNPSELFELRSYITAKLLWNPDQNFDALLTDFASGYYEEAGIYIKEYIDEIHAKLMEDKDFFLFLYGDPSEAFSSYLSPEMLSKYSQLFDDAEKAVAKKPEILARVKVARLGVDFAELEASRKNFTDRYRLLIPNDEGKKIINPLVTTLLDNFKAITAKNNITLMNEMGFTVTEYLANYMSALEVIRMPNVAMGKKVVTITKPKKYAKEDPMALTDGALGGSSFYANWLGYEGNDMEVVVDLGEPMDINTISLAFLQVTNHVVFFPEKVTYSGSLDNEHFENFGTINNPFPLTKDSKVNDIQFFKLNFEKRNTRYIKVRATNKKTPYWHHAAGLPSWIFADEIIIN
>NZ_CP022515.1|WP_093978889.1|3442176_3444417_+|glycoside-hydrolase-family-92-protein
MTLQRILLLILTVFTLGAYAQKQPVDFVNPFIGTSNFGTTNPGPIAVRGMVSVSPFNVAGPKNLPLEKDSRWLSTPYVQENTFLTGFSHVNLSGVGCPELGVILAMPTAGDLEVDYLKYGTSYSDEVSKVGYYSNTLDDYNIKVEATATTRVGVSKYFFPKGDANILINLGLGLTNEQGASIRVVSPTEVEGVRSVGSFCYYKPEEAYPVYFVARFSRPADEFGVWKKPTTHKGAEAEWMGYNGKTRVMPGYAMEVVGDSIGSYMRYNFKEPTVVEMKVGISYVSIENARENLEKETSTRSFDQILEESKKNWNQYLSKIEVEGGAEEDKIKFYSALYHTLIHPSTLNDYNGDYPKMKTRETLRTQDTRYTVFSLWDTYRNLHQLMSLVYPRQQSNMVKSMLQIYDESGWLPKWELNATETTTMVGDPAGIVIADTYLKGIRDFDVEKAYAAMVKSADQIQDNPLRPGLMDYLEKGYLTTKTTNSGSVSTTQEYNISDYAIAQLARALGKKEDYKRFSQRSISYRNLFDKEFNLLRPRNDDGSWLTPYNPEAGANFVKNLGFIEGNAWQYSFMVTHDAKGLMKLMGGAKPFTNRLQDVFDKGHFDMANEPDIAYPYLFNYVKGEERRTQQMVSDLLDTYYKNSPDGLPGNDDTGTMSAWAVFSMMGIYPISPANAIYTITTPRFNKITIHLDSDYYQQEKITIISNFSEQNRFIESIKIEGKPHKGYFIGHDELVNGKTLELKLNK
>NZ_CP022515.1|WP_157730812.1|3463105_3463462_+|N-6-DNA-methylase
MVGNYKKSRLGQFFTPKSSCDVMSGLTIKGEDWDNKVNDCACGSGRLLLSANKFTKDMYHIGQDIDMICAKMAAINLCMHQMKGEVHCMDTLRMTTPRKNFLINPKFHEHKTLLIICK
>NZ_CP022515.1|WP_157730814.1|3463622_3463784_-|hypothetical-protein
MGDKVDDLTKFDWKALFIGTIATLVISLGIPPESNGMLWEWIKSAFNGLKLKG
>NZ_CP022515.1|WP_093978898.1|3463840_3464263_-|hypothetical-protein
MRITNLQRRQLSDVFNNKNLNLLDFEVSGNYQEFKIKFRFDYFSFIVFKKNAEQYQVTVMSVDNTNAGTTVMKWDGVLHRFKLWVTQIKEELDTPSGWETFQSSNYLNSDLEDLNQFFSEDEKKSARQSLTEIKEKLKRN
>NZ_CP022515.1|WP_157730816.1|3464891_3465035_+|hypothetical-protein
MTDAEKKLITEQLPENFDWQQVKCTPMGNFSKVLYQDQLIGYIMYQL
>NZ_CP022515.1|WP_157730818.1|3465553_3465721_+|hypothetical-protein
MKKIFENIANWLVVLNGSKDKIYWNINAFMRRGYNGLIVGPVVFGTIVVLPSFNL
>NZ_CP022515.1|WP_093978900.1|3465824_3466433_+|hypothetical-protein
MLVPTEKLIKNAILNHKRGKIFFPNNFVKFGSSTAIRQALIRLEEKGLLVRLAQGIYLYPKEHKQLGLLYPSLEEIALAISKRDKARIIPTGIQALNKLGLSTQVPMNLVYLTDGSPRTVKIKNNTIKYKIASPKILSAKSETNILVIQALREIGQKNLDGNQLEKIKDVLKTVDKDLIKHDMKLAPVWISKIMEEILKNNE
>NZ_CP022515.1|WP_093978901.1|3466433_3467435_+|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MKEWFSLSVSDRREAIIQTSIDKGLPAAAIEKDWWVVTVLRAIFSTTYAEHLVFKGGTSLSKAWGVIERFSEDIDLAMDRSFFGFSGTLNRTKVSHLRKASCKFASEVFPGELAKTLHAQNVGEFSIEVREFVLSDTDPLAIEIHYKSLVEHIDYLVPRILVEISSRSLRDPFENKGIISFIGAKYNGQPFADEIIYVPTVLPTRTFLEKLFLLHEEFQKSENREIFSERMTRHLYDVSRLMDTPFGESALIDSHLYSNIIQHRKIFTKVSWVDYSKHAKRTLDFIPPDRAMKDWERDYVAMQESMFYGKTEPFDELMNKLRGLRDRINKMEG
>NZ_CP022515.1|WP_093978902.1|3467818_3468490_+|hypothetical-protein
MKKIIENIANWLVTVKGRKDKIHQNINAFMRGGYNGLIFGLILFGILMVYFSFDLYETYENLWLALLPIWFSVILIFGILVSDAYKEKVKYQSRSTRMKLVGFNMDFNERVLRRIYGSLTQYEYLDENLTSFSNFYEVMVLNFDEHDSVLHFNCTQPQLKYILDKFKQLKKGISLKSFERSQKIYHKGNLISAEILSKKYNEFPPNYEFEQQIDSFFDFLGDI
>NZ_CP022515.1|WP_093978903.1|3468608_3468899_+|helix-turn-helix-domain-containing-protein
MEIENDMVDLLRDIKGLLSHQKKVMNVDDLVAYTGLSKSKIYKLTQLRLIPMGGNKHIRQKFFDKDIIDAWLLGEPNLSDDFLDQEFNKQLPRKKK
>NZ_CP022515.1|WP_093978904.1|3469167_3469464_+|hypothetical-protein
MKKEFVQFRCSLYEKKLLRVKADRSGLSISEYCRRAAFDDRIIERLTQEQIEMYKMLSRYETNFKLIGNMFRKRNPKLADEVVHLASEIRRHLLSFRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_7

4327645-4327765

Orphan

Consensus_repeat	Method
AGTGGCGCAAAACGAACCGAAAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP022515_7

>merge|NZ_CP022515|7|4327645-4327765|CRISPRCasFinder
AGTGGCGCAAAACGAACCGAAATGACTCCTGGATTGGCAGAAGTGGCACAAAACGAACCGAAATCACTGGCGCAAAACGAACCGAAATCCCTCAGGGAAGTGGCGCAGTTTGAACCGAAAT

>NZ_CP022515|7|7|4327645-4327765|CRISPRCasFinder
AGTGGCGCAAAACGAACCGAAAT	GACTCCTGGATTGGCAGA
AGTGGCACAAAACGAACCGAAAT	CACTGGCGCAAAACGAACCGAAATCCCTCAGGGA
AGTGGCGCAGTTTGAACCGAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093979451.1\|4318766_4320017_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP022515.1\|WP_157730649.1\|4326046_4327600_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP022515.1\|WP_093976857.1\|4334458_4335454_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP022515.1\|WP_093979448.1\|4314397_4314730_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|377579
NZ_CP022515.1\|WP_093979447.1\|4314053_4314386_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP022515.1\|WP_093979457.1\|4333522_4333948_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093976857.1\|4322404_4323400_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP022515.1\|WP_093979456.1\|4328643_4329129_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979453.1\|4321315_4321543_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093980646.1\|4335571_4335874_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP022515.1\|WP_093979460.1\|4337896_4338142_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979458.1\|4335884_4336166_-\|plasmid-maintenance-system-killer-family-protein	unknown	unknown	gnl\|CDD\|226079
NZ_CP022515.1\|WP_093979454.1\|4327931_4328219_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NZ_CP022515.1\|WP_093979459.1\|4336403_4337720_-\|pectate-lyase	unknown	unknown	gnl\|CDD\|226384
NZ_CP022515.1\|WP_093979450.1\|4316197_4317268_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369882
NZ_CP022515.1\|WP_157730894.1\|4315109_4316042_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377824
NZ_CP022515.1\|WP_093979455.1\|4328205_4328451_-\|CopG-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274227
NZ_CP022515.1\|WP_069859434.1\|4331623_4332874_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP022515.1\|WP_093979452.1\|4320733_4321300_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093977252.1\|4325282_4326023_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093979451.1\|4318766_4320017_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.77657e-163
NZ_CP022515.1\|WP_157730649.1\|4326046_4327600_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.93063e-15
NZ_CP022515.1\|WP_093976857.1\|4334458_4335454_+\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	7.28516e-21
NZ_CP022515.1\|WP_093979448.1\|4314397_4314730_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	2.76747e-14
NZ_CP022515.1\|WP_093979447.1\|4314053_4314386_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.88067e-11
NZ_CP022515.1\|WP_093976857.1\|4322404_4323400_+\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	7.28516e-21
NZ_CP022515.1\|WP_093979459.1\|4336403_4337720_-\|pectate-lyase	gnl\|CDD\|226384	COG3866, PelB, Pectate lyase [Carbohydrate transport and metabolism].	1.05048e-05
NZ_CP022515.1\|WP_093979455.1\|4328205_4328451_-\|CopG-family-transcriptional-regulator	gnl\|CDD\|274227	TIGR02606, Antitoxin_ParD, putative addiction module antidote protein, CC2985 family. This bacterial protein family has a very similar seed alignment to that of pfam03693 but is a more stringent model with higher cutoff scores. Proteins that score above the trusted cutoff to this model almost invariably are found adjacent to a ParE family protein (pfam05016), where ParE is the killing partner of an addiction module for plasmid stabilization. Members of this family, therefore, are putative addiction module antidote proteins. Some are encoded on plasmids or in prophage regions, but others appear chromosomal. A genome may contain several identical copies, such as the four in Magnetococcus sp. MC-1. This family is named for one member, CC2985 of Caulobacter crescentus CB15. [Cellular processes, Other, Mobile and extrachromosomal element functions, Plasmid functions].	0.000214501
NZ_CP022515.1\|WP_093979454.1\|4327931_4328219_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	2.76457e-10
NZ_CP022515.1\|WP_093979450.1\|4316197_4317268_-\|hypothetical-protein	gnl\|CDD\|369882	pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.	4.12635e-15
NZ_CP022515.1\|WP_157730894.1\|4315109_4316042_-\|hypothetical-protein	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	1.32212e-12
NZ_CP022515.1\|WP_093979458.1\|4335884_4336166_-\|plasmid-maintenance-system-killer-family-protein	gnl\|CDD\|226079	COG3549, HigB, Plasmid maintenance system killer protein [General function prediction only].	2.06852e-28
NZ_CP022515.1\|WP_069859434.1\|4331623_4332874_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	3.24974e-163
NZ_CP022515.1\|WP_093980646.1\|4335571_4335874_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	1.20811e-35
NZ_CP022515.1\|WP_093977252.1\|4325282_4326023_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	1.96801e-54

>NZ_CP022515.1|WP_157730649.1|4326046_4327600_-|IS21-family-transposase
MANTLDPMDLKQIISLHLDGLSNRKISATLGIARNTVNGYMQAFKASDHTLKELLACDNAVLEALFTSHSTIDNRRFDQLTRYFERMNKARDHPGFTYLFHYQEYVQQVDDPYGYTQFMEHYHRKYAKLKGSMKLEHDPGHELFIDFAGKKLQIVDRSSGEIVDVEVFVAILPNSHYTYVEACRSQKREDLIKCCANALQFYGGVPKAIVSDNLKSAVKRASRYEADINRSFKDFAHHYNCVINPARGYSPQDKALCENAVNLAYQRIYYPLRNMTFFSLQDLNREIRRLLGSYNDLLFKRKQASRLELFQMVEREYLKPLPTSAYELKDYRRAKVQKMGYVYFSPDKSYYSVPYRYIGKETTIHYTASMVEVYFYHERIALHNRNPSKGSYNTNADHLSSTHRFYSDWSPEFFKKKAGIHGKHVLGCIEEILKTGDYPEIGYKRAMGVIQLHKAYGSKRLDDACKRALRADAATYGRIKNILKNNLDKSSLFYQDLEEDKPHIPEHGNLRGASAYK
>NZ_CP022515.1|WP_093977252.1|4325282_4326023_-|ATP-binding-protein
MNNNQTIEKLKQMRLGAMAELHLQHVKSNRLSDMTADEYLALLIDHQWEDRQNSKIGRLLKQAGFRQQASLADVNYTHDRDLDKNMFLRLGTLDFIERKENIIICGLCGCGKSYLSQALGHQACMMEYKTVYANTARLLKKLKLSKVDGTYLKELAKLLKADLLILDDFGLQAFDNHAREALMDIIDDRYNRASTIISTQIPVSAWYEIIGGDGTQADALLDRIVNSSHRINLQGESLRKGTLKSI
>NZ_CP022515.1|WP_093976857.1|4322404_4323400_+|IS110-family-transposase
MKIKDVIGIDASKLTLDCCLHKSGAQEVFENTPEAIVFLVDWSIKISGLAKNELLFVFEHTGLYTHQLVRYLSEQGYYFLLVPGLEIKRSLGIARGKDDRADAKRIALYGYRIREEARPYQMPKESLISLKRLMSMRRKLVSQRAGHIATLGEQIRVLNNELGPILLQVQRDIIGVLDVQITKIEKELDRLIEQDPELQIIYRLLVSIKGIGAVTARFMIVHTVGFTAFKSWRKFASYCGIAPFPNRSGTSIRGRTKVSQLANKEGKTLLNLCAGSAIQCNPEMKAYYTRRIDAGKNKMSTLNIIRNKLLARAFAVVVRGTPYVNTMGYIS
>NZ_CP022515.1|WP_093979453.1|4321315_4321543_-|hypothetical-protein
MIKFFRKIRQNLLSEGKTGKYLKYAIGEIILVVIGILIALSINNWNDNQKKIKQETTHLQNIKNDLKAQIKTLDN
>NZ_CP022515.1|WP_093979452.1|4320733_4321300_-|hypothetical-protein
MIIEDSKNIIHHYENNGGFNKMDSIYPMLNDLIVRTTFINKNISLTEIINSSEINILKNKVLIRKLLEFNQSVLTFMNTTQNNNTNLIDLLIVPTLAKNSDYATFGYTNGMNNFLEKTGGRENITYLKNNNLKNGLNQTFNDPKLSLELMNKVVIRYELASLQKIGNENLKEQAEDILIAITKELDEK
>NZ_CP022515.1|WP_093979451.1|4318766_4320017_-|group-II-intron-reverse-transcriptase/maturase
MIELEKTKSLPITKEMVWEAYLEVRRKGKSAGVDDLSMSQYDLQRHRHLYKVWNRLASGSYFPPPVLQVEIPKKNGSIRQLGIPTISDRVAQTVIKNQMEERLEQIFHPQSYGYRPKRSAHQALEQVRKNCWKYDWVIDLDIKNFFDDIDHDKLLKALGKHVEEKWMLGYIERWLKAPLQTRKGEIIARTNGTPQGGVISPLLANLFLHYTLDVWLGRLNPTIEIVRYADDIIIHCQTQSQAEQSLQQIKERVENCGLTLHPDKTKIVYCKDFRRQQKYQKVQFDFLGYTFQPRTSKSKKTGRLFLGFDCAISIQSRSRLFEQVRKMEIPRMRCDSIVGIAHHLNPKLRGWIRYFGKYRGYSLSKVFYILRIKLVRWARYRYKRYRNNLTKTYKWLDTVRKQYPSLFYHWHLGYSN
>NZ_CP022515.1|WP_093979450.1|4316197_4317268_-|hypothetical-protein
MKINICSLILFVITIVSCNSPKSDKYTGEAEKSIDNFPYITYNEQNLFPGDGSLLRVEDGVSLEDGRVVVVDQANGLRIIEKDGSNRPFGNYKDAGFINKPPNQIAGPNGLVLEHDGNHLLMCDVSDGKIYRTNIASEKTELIYDHNYGINAIYSDKTGAIWFTQCAENTNMGEMFMALNLSVPTGAIFRMADLKSFPIKIADSLYFSNGITMDKDEKTLYVSETMMDRVKSFNVDVTTGKAEYSGVVTNVATPDNILIDDHGNLIVASPANNQVIAFDFKNHSQHIIFDASTKENQEIANEWFRRSHLGIPRAELVTPNLFSPLPGLLTGMFFSKDGQTLYIANLGNDLVKLEYK
>NZ_CP022515.1|WP_157730894.1|4315109_4316042_-|hypothetical-protein
MKKTLSTVILTLVVVSSLFFSCQSKSNNTKKTEKVVEGHKENTWNPEELELIALVEKLLFAVGNSDFQTLESIVSDKANLASAIIRDGASKNSVITIREYFESQKNRERKPFYEPVDEYKILINKSQIAFVWADATLHKYGVPRTNNIDNFTLIKEDGEWKFINISFTNTALPEELQKFDIEIFAKSYAQVWCSQRPNFVSSFFSEDGVLQINEGEPAEGTEAITNVAKGFMDAFPDMVVSMDSLITKSEKTRFYWTLTGTNKGTNGTGNKVNISGFEEWTLNDDGLIQESKGYFDEKEYQRQLEFETDK
>NZ_CP022515.1|WP_093979448.1|4314397_4314730_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MEKRFEVIFLEQAIDFMSKVDKKARMKIFYNLDKAKFGLDPKLFKKLTDDIWEFRTKYGGLQYRLFAFWDRTGKTETLVISTHGMIKKTDKVPKAEIEKAKQIRTDYFEQ
>NZ_CP022515.1|WP_093979447.1|4314053_4314386_-|helix-turn-helix-transcriptional-regulator
MAAKNKKMKMMTLDQMKDKDIGKIGTADRDKYEFDLRMEVLGEMIKSVRKERKLTQEQLGELIGVQKSQISKLERSAKNVTIETILKVFNALKANIKFSVQINDSEFKVA
>NZ_CP022515.1|WP_093979454.1|4327931_4328219_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MTKYRSSNEAKNDLICIHHYGVKKFGMTQADKYFESFFEYFDIIAERPFSFESVDYIKKGYRRCVCGVDSIYYKVNENIVEIMTIVGRQDLNEKI
>NZ_CP022515.1|WP_093979455.1|4328205_4328451_-|CopG-family-transcriptional-regulator
MSRQSISFTKPNDEWLKTQVDNKEYSSKSELVNDLIRQARKQQVQIDWIRAKIEKAENSGFTNDSKESILAQSKSLLNDQI
>NZ_CP022515.1|WP_093979456.1|4328643_4329129_-|hypothetical-protein
MVKKLISTDQNRDSGKLGKWNATVFYVARKKCWLLTNGPTKYNVILTDIKLADLKNIESLFKESFYGQLIYDGIITDFNNVDSIIGKLDFLPTDNDRITTGFQNHRLQDLDWWKHEFGSLENMPMKDLTHRLNNSPIHIGKGHKMSDYTDSITEIKKLLTE
>NZ_CP022515.1|WP_069859434.1|4331623_4332874_-|group-II-intron-reverse-transcriptase/maturase
MIELEKTKSLPITKEMVWEAYLEVRRKGKSAGVDDLSMSQYDLQRHRHLYKVWNRLASGSYFPPPVLQVEIPKKNGSIRQLGIPTISDRVAQTVIKNQMEERLEQIFHPQSYGYRPKRSAHQALEQVRKNCWKYDWVIDLDIKNFFDDIDHDKLLKALGKHVEEKWMLGYIERWLKAPLQTRKGEIIARTNGTPQGGVISPLLANLFLHYTLDVWLGRLNPTIEIVRYADDIIIHCQTQSQAEQSLQQIKERVENCGLTLHPDKTKIVYCKDFRRQQKYQKVQFDFLGYTFQPRTSKSKKTGRLFLGFDCAISIQSRSRLFEQVRKMEIPRMRCDSIVGIAHHLNPKLRGWIRYFGKYRGYSLSKVFYILRIKLVRWARYRYKRYRNNLTKAYKWLDTVRKQYPSLFYHWHLGYSN
>NZ_CP022515.1|WP_093979457.1|4333522_4333948_-|hypothetical-protein
MKRFLTAIFLISTLTLCSQTDKIIGEYFLELGNEKHQIKYRLNLNSDWTFDFHSYTNHQNGIPPIVHKYGKGTWSVDGKVVSFITNEEKDFDEKYTLDFNASKARFITKPSRDKTDRIIKTRLKFYESEIFWIEGLDIFKT
>NZ_CP022515.1|WP_093976857.1|4334458_4335454_+|IS110-family-transposase
MKIKDVIGIDASKLTLDCCLHKSGAQEVFENTPEAIVFLVDWSIKISGLAKNELLFVFEHTGLYTHQLVRYLSEQGYYFLLVPGLEIKRSLGIARGKDDRADAKRIALYGYRIREEARPYQMPKESLISLKRLMSMRRKLVSQRAGHIATLGEQIRVLNNELGPILLQVQRDIIGVLDVQITKIEKELDRLIEQDPELQIIYRLLVSIKGIGAVTARFMIVHTVGFTAFKSWRKFASYCGIAPFPNRSGTSIRGRTKVSQLANKEGKTLLNLCAGSAIQCNPEMKAYYTRRIDAGKNKMSTLNIIRNKLLARAFAVVVRGTPYVNTMGYIS
>NZ_CP022515.1|WP_093980646.1|4335571_4335874_-|HigA-family-addiction-module-antidote-protein
MEKLANVHPGEILYYEFLEPLEITAYRLSKDLKIPQTRISEIVKGNRRITADTALRLSKYFGNSAKFWLGLQDDYDIEVEKETKESELNEIKHFENKNVA
>NZ_CP022515.1|WP_093979458.1|4335884_4336166_-|plasmid-maintenance-system-killer-family-protein
MISSFGSKATEQIWNGIRVKKIPIEVQNVGRRKLRMLNNSQDISDLRIPPSNRLEKLSGKLSDYYSIRINKQWRIMFLWDKGNASEVEIIDYH
>NZ_CP022515.1|WP_093979459.1|4336403_4337720_-|pectate-lyase
MRKLFLTGVISILTFFYAMSQQLAFPTAEGYGKYTVGGRGGSVFEVANLNDSGEGSLRAALEAKGPRTVVFRVSGTITGNFSIKNDSITIAGQSAPGDGICIKGNLSTDADNIIIRYIRVRFDPSTGENDGIGGRYHKNIIFDHISASWSTDETMTLYHNENTTVQWCIIAQACPKGSSDDHRFGGIWGNKYGSWHHNLFAHNASRNPRWASGSGFNDYRNNVIYNWEYASSYGGEAHQKGDRRNPPIEHSTINMIANYYKPGPATDSKVRSCIVDPSSRDEDADAGKWWVSENIVDGYPKVTDNNLLGVTKTSAAYKLNQPWPAMEINQQTAEEAYKAVLKYAGCSLPTRDKVDADIIDDVLHGTAKYGNKGIIDIPSDVGGWPELKSSPAPIDTDHDGMPDYWEIKNKLDKQNPDDRNVVASDGYTMLEKYLNNIN
>NZ_CP022515.1|WP_093979460.1|4337896_4338142_+|hypothetical-protein
MDRTELFKIIEWLVDNNHVKLLTPGINILDHIDSLNNSMSEGERQPVGNNEQGVSKCIPLFHNSAIKYYGQCSKCGQATEM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022515_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022515_8

5110743-5110822

Orphan

Consensus_repeat	Method
TCATGATGAGCGTTCGGGCGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022515_8

>merge|NZ_CP022515|8|5110743-5110822|CRISPRCasFinder
TCATGATGAGCGTTCGGGCGGGCCCGACCGTACCGAATAGGGATATCTGCCCGAAGATCATGGTGAGCGTTCGGGCGGGC

>NZ_CP022515|8|8|5110743-5110822|CRISPRCasFinder
TCATGATGAGCGTTCGGGCGGGC	CCGACCGTACCGAATAGGGATATCTGCCCGAAGA
TCATGGTGAGCGTTCGGGCGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022515.1\|WP_093979974.1\|5104659_5106234_-\|CHRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|214804
NZ_CP022515.1\|WP_093979973.1\|5102633_5103416_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979972.1\|5101350_5102430_+\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277344
NZ_CP022515.1\|WP_093979978.1\|5108077_5108497_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730950.1\|5119760_5119898_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223157
NZ_CP022515.1\|WP_093979980.1\|5108851_5110585_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227903
NZ_CP022515.1\|WP_093980693.1\|5095446_5097678_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP022515.1\|WP_093979970.1\|5099017_5101144_-\|DNA-helicase-RecQ	unknown	unknown	gnl\|CDD\|223588
NZ_CP022515.1\|WP_093979984.1\|5121382_5122600_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|182528
NZ_CP022515.1\|WP_031444223.1\|5104124_5104463_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_157730948.1\|5108580_5108754_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979986.1\|5123357_5124575_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP022515.1\|WP_157730952.1\|5126232_5126958_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227001
NZ_CP022515.1\|WP_093979985.1\|5122609_5123356_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP022515.1\|WP_093979983.1\|5119967_5120858_-\|histidinol-phosphate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223157
NZ_CP022515.1\|WP_093979976.1\|5106995_5107856_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187554
NZ_CP022515.1\|WP_093980694.1\|5113714_5119276_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979982.1\|5112609_5113539_-\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|187678
NZ_CP022515.1\|WP_093979981.1\|5111794_5112394_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022515.1\|WP_093979987.1\|5124778_5126221_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366721

Protein	Function_ID	Function_description	E-value
NZ_CP022515.1\|WP_093979972.1\|5101350_5102430_+\|serine/threonine-protein-phosphatase	gnl\|CDD\|277344	cd07399, MPP_YvnB, Bacillus subtilis YvnB and related proteins, metallophosphatase domain. YvnB (BSU35040) is an uncharacterized Bacillus subtilis protein with a metallophosphatase domain. This family includes bacterial and eukaryotic proteins similar to YvnB. YvnB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	3.04052e-15
NZ_CP022515.1\|WP_093980693.1\|5095446_5097678_+\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	2.52669e-34
NZ_CP022515.1\|WP_093979980.1\|5108851_5110585_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227903	COG5616, COG5616, Predicted integral membrane protein [Function unknown].	1.21899e-42
NZ_CP022515.1\|WP_093979970.1\|5099017_5101144_-\|DNA-helicase-RecQ	gnl\|CDD\|223588	COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair].	0
NZ_CP022515.1\|WP_093979984.1\|5121382_5122600_-\|FtsX-like-permease-family-protein	gnl\|CDD\|182528	PRK10535, PRK10535, macrolide ABC transporter ATP-binding protein/permease MacB.	1.43584e-73
NZ_CP022515.1\|WP_157730950.1\|5119760_5119898_-\|hypothetical-protein	gnl\|CDD\|223157	COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism].	0.000773888
NZ_CP022515.1\|WP_093979974.1\|5104659_5106234_-\|CHRD-domain-containing-protein	gnl\|CDD\|214804	smart00754, CHRD, A domain in the BMP inhibitor chordin and in microbial proteins.	0.00124974
NZ_CP022515.1\|WP_093979986.1\|5123357_5124575_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	2.24467e-47
NZ_CP022515.1\|WP_157730952.1\|5126232_5126958_+\|hypothetical-protein	gnl\|CDD\|227001	COG4654, COG4654, Cytochrome c551/c552 [Energy production and conversion].	4.64312e-15
NZ_CP022515.1\|WP_093979987.1\|5124778_5126221_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	3.13033e-43
NZ_CP022515.1\|WP_093979976.1\|5106995_5107856_-\|SDR-family-oxidoreductase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.77697e-61
NZ_CP022515.1\|WP_093979983.1\|5119967_5120858_-\|histidinol-phosphate-aminotransferase-family-protein	gnl\|CDD\|223157	COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism].	2.79098e-66
NZ_CP022515.1\|WP_093979982.1\|5112609_5113539_-\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|187678	cd09620, CBM9_like_3, DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.	1.25985e-58
NZ_CP022515.1\|WP_093979985.1\|5122609_5123356_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	3.93222e-106

>NZ_CP022515.1|WP_093979980.1|5108851_5110585_-|helix-turn-helix-domain-containing-protein
MSNDIDNEYFCDGITEEIINALTKIDKLKVIARTSSFAFKGKDIDIRKIGGQLGVSTILEGSIKKSRERVRITAQLIDVEDGTHYWSKKFDRRLIDIFDLEDEISLTIAEEVRNNFGHFEIQEHLIEQPTSSVDAYQMYLKGRSFQLKWTPEGLNQAINYYNKAIALDKNYAKAYYANLQCYGLSAMWGYIPYDEAMESAINNLLMAKELDASLPEYPLSYVGKFLWGEWDFKNAYIHIKKVLAINPNHIDGLEALTELFIALGFFDMALPYANKLLEVDPLSANNHYTLAHIHYFQGLYDKALENVDYALTLNPELELAHHLKCFCLIWLNKKQQFQEFIHNTSLIEEKNLLFSLVNEKHIDVPHQIIEKWSRLSKDQTMLVPYDVFILASSHQTSTAFSLLKEMIDQRRGQIINYRQDPFLRPLHKINGFTDLHRSNLSSADIKSTKKDEEKGTANVLDKDQIKKLKGKLLSYFKEDEPFLNPQLNLQFVAQVLELNNNKISFLINQAFDVNFNDFVNSYRLEHFKLIALDSNNSHLTILGLAYDSGFNSKTVFNTYFKKIEGVTSRAWMKANSL
>NZ_CP022515.1|WP_157730948.1|5108580_5108754_-|hypothetical-protein
MNASILGPKTYLGNILNSMIGFVPEHDATIVLLSHRQDDTVSQRNTLIRQLLTKEFN
>NZ_CP022515.1|WP_093979978.1|5108077_5108497_-|hypothetical-protein
MYGQETSKQAFEIKVITSVESIIPSGLGRSRLISSNEERDYKQFTSSRTEENNTRNKSKRKDIRLKNFEETKLLNFYNLGGIRFQNIAANDALISSKLTEMLSKGWDLMFITSAVESDAGKNDDNGIFITRYILKRKFN
>NZ_CP022515.1|WP_093979976.1|5106995_5107856_-|SDR-family-oxidoreductase
MKDTNILLAGATGYLGKYLLKELLEKKNQVIAIVRNPDKLQNSNENYLEIKQAEVTKPETLRDICKGINTVISTVGITKQKNGLTYMDVDYRANMNLLEEAKKSGVAQFVYVSAINGDKYRDLKIFEAKEKFVAALKASGLNYTIVRPNGFFSDMGHFLQIAKSGRVFLFGSGNQKFNPIHGADLARAIVDILDDENKELTIGGPDVLSLNDIAKLALTALNKPIKIVHLPDWSRKLSIRCLRSFTSVKTYGPIEFFLTLMAEDNIAPTYGHEHLKDFYIEEAKNL
>NZ_CP022515.1|WP_093979974.1|5104659_5106234_-|CHRD-domain-containing-protein
MKKLMYLFIAATTMIVSSCSEDDSNDQPPGVFDGDSKTYQLQSRADASVSGTATVVENEDGTATVNLKLTGTSAGSFPAHIHANSAAETGDILIDLNEVDGASGESTTIISATKAGTAITYEQILELDAYINVHQSANDLGTLIAQGDIGVNELTADSREYELKSAADANISGTATIHKRVSGASLLEISLENTPADGEHPAHIHMNSAAESGDIAISLSPVVGANGKSFTHIEEDDAGTALNYEALLELDGYINVHQSANELDVLVAQGDIGVNVLTGDSKEFALHSVLVPTINGTATVHKRLSGASLLEISLEGTPADGEHPAHIHANTAAEGGDIVISLNTVNGANGKSWTHIEADDDGTSVSYEQLLEFDGYINVHKSIAELNVLVAQGDIGQNELTGNEVSYDLAAVSNAAIFGTATFSERVNKETLVTLELVGTTAGGIHPAHIHTGAVADAPGAVIVTLGNVIGDNGISVTNVTQANSGGALDYDALLAIDGYINVHLSAEDLDTLVAQGNVGANLN
>NZ_CP022515.1|WP_031444223.1|5104124_5104463_+|hypothetical-protein
METTPKISRNLISRPSNSACILKLERTNNDLCQLERKMTSYVCEPNTYNLFIKSETLRQTLQSLKNTNAELIKALKREKDLKIDLFEKTMAQIRSYLEIQKSVEEYSNMLRY
>NZ_CP022515.1|WP_093979973.1|5102633_5103416_+|hypothetical-protein
MKTFNYLVLSFGFILISACSNDAMNGLNDESMTPEQVKSQMQVNSVSDGLDELVSELLINDKAGKSNKTNTECATLAFTENSITVAYNQCIIQGKTISGTIVLTGNNGSTDGTKGSFEVSFTDFTYNDYLLNGTKTFAFDFSDSNSPTFTIVTDATFEDENGDIVIWKGNKVLSWHLDQINAEGADLTCTGDWDITVDGITYEFTVTEPLGANLGCAFITSGVMQLEVNDMTASLDFGAGTCDQTGTVTFPNGESEEISW
>NZ_CP022515.1|WP_093979972.1|5101350_5102430_+|serine/threonine-protein-phosphatase
MNLKHRYCLFVLAIFTLATAVKAQETYAPPKLSNPDSWSIILVPDTQTYAKFERNKGTLETMTAWISENIDALNIKMVLCTGDLVEQNELLVPDKINGNMPSREQWRAVSHAFERLDGKVPYILAAGNHDFGYKNVETRKSNYSQYFPVHRNLLNAKALRAAGKNIDGLPSAENATYELVSPQQRKFLFLNLEFAPRDTILQWANNEISQEMYKDHTVVMLTHSYLNAQNEHMEKENYPIEDANYGKAIWEKLVAPSKNVQMVFSGHIGSPDNFKAHTAFRVDRNAAGKKVNQITFNAQAIGGGWHGNGGDGWLRIMEFLPDGKTVISTTFSPYFAISPTTQKMAYQRDDYNNFSFQMD
>NZ_CP022515.1|WP_093979970.1|5099017_5101144_-|DNA-helicase-RecQ
MPDIQNKLFPYLKKYFGYDRFRNQQEAIITAVLNKEDCLVIMPTGGGKSICFQLPSLLFDGTTLVISPLIALMKDQVDGLIANGIPAAFFNSSQSAEEQRDILDRTHKGELKLLYVAPESLQGLSPILKEEFVSCVAVDEAHCISSWGHDFRPSYQQLGFLKASLPQTPIIALTATADKATRQDIMAQLKIPRAKQFLASFDRKNISLEVRAAHDRVSQILQFIDQRPNESGIIYCLSRKSTETLVEKIRNNGIKAAAYHAGLDFDSRNKVQEDFIFDKTQIVCATIAFGMGIDKSNVRWVIHYNMPKNIEGYYQEIGRSGRDGLAAHALLFHSYADVIQLQRFASGATNEEVQLAKLERMKQFSEASSCRRKILLSYFGEYLQTDCGNCDVCKNPPQFFDGTVIAQKILSTIARLKESEATGTVIDVLRGAQNANILDKNYHEIKTYGIGKDISWNHWQHYTIQLINQGLCEIAFHKNNVLRLTDLAKAVLFNNAKVQLSQPLSKEEQMAVRKESKSKPVNENSLFEKLRQLRFKISLQENIPAYLVFNDATLKEMESKKPVTSEAFKEINGVGQRKLEVYGEMFINEIKAFVEAKPKKKKKKTRKSDTALETYELFKTGVTVKDIAETRGLKPNTILAHLEKLYHDGKDIDIYRLISKDDVAKVAKAKKELKDPEGLKPYFEHFEEKMEYSTIRLALRVIEKEAIL
>NZ_CP022515.1|WP_093980693.1|5095446_5097678_+|TonB-dependent-receptor
MIKNTLGILLLLLSGALNAHTISGTITNQDSTPLSGVGVYNKNTGNYTYSNNSGAFSLANVSVNDHIYFYSLGFKNKELLITENQLDTTLEIVLEEAAVSLDQVVLVSNINAMSSFVNVDVKSDPVKSSQEILRKVPGLIIGQHAGGGKAEQIFLRGFDIDHGTDIAINVDGLPVNMVSHAHGQGYADMHFIIPETIDNIYFGKGPYYAEKGNFNTAGYVDLTTKKTLDKNVISMEAGKYNTLRGLGMLKLLESDDDNAYIASEYLISDGVFESPQNFNRINIMGRYNHKDDAGNELNLTASHFQSKWDASGQIPQRAVDNGSIGRFGAIDDTEGGNTSRTNLLVNHNKQLDQHSRFKSKFFISKYDFELYSNFTFFLEDPVNGDQIKQKENRTLIGGETSYDKTIHLDQNNSQFRFNMGIGFRYDDINEVELSHTLNRKTTLDRLTYGNIDELNAYGFFNINYKIKKWNINPGVRLDYLKFDYENLLSTTYDQKSENKLVVSPKLNTIYQASQDLQLYAKTGIGFHSNDTRVVTANNGESILPLAFGADVGTIYKPKDRLVLNLALWHLFLEQEFVYVGDAGIVEPSGRTKRFGVDLGARYQLTDWLYAYGDVNYTYARSSEDPSGEDYIPLAPDLTSSGGISFKGLKNFSGGVNYRFIKDRPAKEDNSIIAEGYFVTDFNLNYTWKNWSFGLIVENLFDTEWNETQFATTSRLFNEAEAVEEIHFTPGTPFFARGKVSVSF
>NZ_CP022515.1|WP_093979981.1|5111794_5112394_-|hypothetical-protein
MLEKRRQLPQEHPIDVEKFIFCLEGVRDMETAKLTETQENLEQLAMQYGVASIYKTCDTIEGLEASLNALVMDDHHFKDYEIIYLVMTGEANSICLNDYYYSLQEIAEIFEGRLKGKILHFSNAKVLDLDEEEAQYFLDITNAKAVSGYGNEFNGLSSSNLDKAFFNLFKEDDNMLDVVEELHQRHYHVCKLLDFRLYY
>NZ_CP022515.1|WP_093979982.1|5112609_5113539_-|polyhydroxyalkanoate-depolymerase
MNKLNFLPALCIFCSFWSSAQLTAGDVLKYPPCKEEEIPHYNAYKVSNPPQIDGRLDDLVWQTAPTSPRFRDLISGSKAIHDTRAAVLWDDEYLYIAYWIEEPNVQATMTERDALIYNDNDVEFFIAGKDGYYEFEINSFGTIYEVFFIWEDSDSYKNGAYDSIPEFSSDQPGRKPFSGVGYKPHPRGGRIGYWNWDFPGLRSAVHIDGTINDDSDRDRGWTVELAIPWSGMSALALGDNRSLPPKDEDIWRMDFSRFNQYKEATPAEDSGGWVWSPHGVWDSHVPECFTYIHFSQQDVSHVKKEAERK
>NZ_CP022515.1|WP_093980694.1|5113714_5119276_-|hypothetical-protein
MERVSANGKLVPLDGSAITDQYTGHFLKVSYTQQISGHAIFSKDRADVEANGRFRLYVPKKELLANDLVTIEVYAPDGELLGRQGYTHGALKTAEIPIGADDDSQTLDIEVNPKKITFNQSSPAEQASKKLSGRVIDISGDSKTSGLQVLVMVSNEAAAAFDVAKFEAIFTATTDAKGYFYGQVINKSVQQAFGVIAGNEGHPISIPLENNKLPKNIILVADLSSLSDEDGCGCGEKVPVLPDGDDLVNSNAFSQDIGGKCVDFTIPNRTLEEFSFYHTVRTTEPEIRGLTINSKQSRNIKNELLDISDHAFKLIGRLNNSFTSLSMVPYTIEGDTAVEKRQESDISFEDGNNKETVTAFPNYLLKIDTGVNSKFAIKTNDLISATNKLRPFDIVKLASEQIKKKKKLYDLHQKLAAAYCGKTGVQAAKSYCEELAAKGSLDREELRSTLGHVEQIKSQLNLAANVNKQYNSAILELDKLIEGNSVDKKLLTSAMKKVETLIQGIDSADLNGQLKENMLGYLRRIMVELARAGEGSNLDFEPCPPANKPDTMGILCLIQKFNDLKETLKNKSIFTLAEILEIRAYYTIFLHSISTFLDLLDEFHTFYTTNLSFATELDDDYFFENYDEIKSTLTTLRRQIYSAIRRVEELERAYIQNHPGRVDLSVENSIDWDETPTIYENTTIAHGHILHFKQKWKAAGYSLGDLLYSLPLAPCQEKQIAIVDWDRSEVGARTEAQIVSEELEAQISRDRDITEIMNSSFGESITASSTNKTKSTSAGIGGGVGGFISGVVFGVAGGISHSGASSKSTANQNSSRNLSANTLNSLQDNTSQSASSLRSQRSTVIQTVGQNESVNVQTEVIKNNNHCHAVTVEYFEVLKHYAIEQELVDVQECLFVPMPLGHFDFKKVLRWKNTLSRAVYGRKLRRGFDAIERIESNYADSDLPIGSYADEMIQEFTGHFTISFELERPFIKEIDEATKTEEYDLNIPFPWFFGKMVFHLEREVPLTEAEKDAIFEQQYAPDIVRGFIDTMLFYAIADNGTEVALDFDVTLLSNYRKGVPLRVSINMSSIPNITRRQIKYLRFRANTIVKPTSKIILRSTYLQYRTNHLSEYIVQNNRISNDIINTLTINLGGLGVVTDAALMFTPMNSREERNPRKEDRDAARALVSFLNEYLEMSHKIIWSSIDSSRLFGLLDGYISPHSGGRSVASVVENRVMGIVGNNLVLKVIPGERLDPVFKSVENLLEYYQPTTKPDPYRVSVPTKGVYAESVMGQCNSCEEIDETRHWRFSDEPCGSSPTAIEPVSTASRRSDPGNLQAKDFPGSIINMQNAPAAPDPTGLAAAYGLLGKGDAFKDFTGLAGTQANALGALQTTSKSVTDLASISKDFASLAVMANQKEDGAKQIEQIKKLNKEGFLNDTEASNQIKKVLDSYTDAADSVVGKKDSSNAQPLTSSPEIKKAITDASQSENGKVNVSRTTPLGNESVSVSKGDSEGTPRIIENPDLNAASRSFNPATPAAPGSGNKTGETKFSVRVSNMPAGGSVRWSVPPSNSGDFIIKNGPAVIVGESVTVQGIKPGLSNIDVEVRDVNDTVVQSMKLPLSIPQFVTIREDAAAFDQVLADLSLTALKNDLISKTKVVCDALLVDANVRTIWQLGSFMEVTPAHIPANMITVATIKNRLAAGNRTFGQTNQAPGEVGNIVPNRTIDVFPGAYDEPMGGGAFSDTELDTETQALMIQLESQGVGGDPALESFAVDVYGRLIGETLAHEIVHALLWDIVIQDGHNDPSINNDIMNSGSQRTFTQRTGFVDDAHQSPVVPANFSDNGIAAINRLQALNLSRMDANFPVPGTRVSAFK
>NZ_CP022515.1|WP_157730950.1|5119760_5119898_-|hypothetical-protein
MMDMKNKGILIGTRDYLGKKWCRVSMGTVEEIKEFTKVLTELWKA
>NZ_CP022515.1|WP_093979983.1|5119967_5120858_-|histidinol-phosphate-aminotransferase-family-protein
MNRRNWLSKATLGSTGVVILPYLGIAMPKTNLGDTYLRLASNENPYGCSEQVKKSFLTSVTAINRYAFPSIPQLKIALAKRFQLTAENILLGAGSSGILEAVAHFMLQREGDVTTATPTFDILPSMLEKFGRKAHYIPLKQDHTLDLDAMLAKTQEHPGLVYIVNPNNPIGTVVASQELRQFITEATKYSYVLIDEAYLEFCDNPESMIDMVINPRVMVIKTFSKVYGLAGLRIGYGFAHAAWVNELEKFMIFAGLPISSPSFSVATVALDDENFVDFVVQKNTESKVIVVETLSK
>NZ_CP022515.1|WP_093979984.1|5121382_5122600_-|FtsX-like-permease-family-protein
MKQLLKTFKVAFRSIYKNKTRSLLTALGIIIGVAAVIMTISAGQGATQEVQSQISGLGTNLLMISTKTEHRGGIDVRMGRPIDEKDLLMLQKNSVWMPRLSPLVANGVRAIGPQGNKSTTIYGVSSDYFDILNREIVSGDGFTEEDVKAARKVCVIGETIKKELFSSADPVGRQIRIDKVPFTIVGILKEEGKGTMGQDQDDMLIAPYTTIQNRLYGRRRGYNMIMASALSEDHIQDAEIEATELLRETHRILEGEEDDFEIMTQVELQEITGNVTGILTLILGAIASISLIVGGIGIMNIMLVSVTERTREIGTRLAIGARESDILTQFLIEAIALSLAGGVLGIVLGVLGNQIIYKTTNFYIPTAMDSILIGFGFSVLVGIVFGYFPARKAARLNPIDALRYE
>NZ_CP022515.1|WP_093979985.1|5122609_5123356_-|ABC-transporter-ATP-binding-protein
MVPKKKVIETKKISRVFKTGDIEVRALTDIDIVIEEGEFVVIMGSSGSGKSTLLHILGCLDKPTSGEYYLDGVHVNKLNKNQLADIRNQKIGFIFQSYNLLSRTTALENVELPLVYDRSGRFSNSSEIAKKALEQVGLGNRIHHKTNELSGGQQQRVAIARALVNNPALILSDEATGNLDSKSSIDIADLFVRLNNEGKTILMITHEPEIAQFAKRMIYLRDGRVLTDELIKNRSTKESALRDLEQTT
>NZ_CP022515.1|WP_093979986.1|5123357_5124575_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MKQLKWIIPALLTIAIVGYLIMKPKLDAKNLDFTYIPLEKGHIEAVVSSTGTLEAINTVEIGTQISGTIKKIYVDYNDEVTAGQLLAEMDLNLLQTNLISAQANLAVAQAQLNQVRDTYNRNQALYKKSVISEQEYKDSQYSYEQALSAKEASLAAVKNIKVSIEYAHIKSPINGTVTERSVEEGQTVAASFATPKMFVIAEDLSKMQILADVDESDIGYISNGLQVRFTVQTYPEKVFYGKVSQIRLQPIQVNNVVNYQVVVDVDNHEGRLLPGMTASLEFITQSAKDVLLINNSALRFRPNEQMLNEVKPILEQKAKMLLPDSIQPGFISALDIEEQFTPANFKKSLPGNINGFFYRDSAGKLDFNFIETGIKTGMQSQIIRFLDGSESSEPTKAINGIKSKK
>NZ_CP022515.1|WP_093979987.1|5124778_5126221_+|FAD-dependent-oxidoreductase
MKNVVTAGVGATVLPINTLTANDVREKSGYDWPKPTAAPKKIIVGGAGIGGLCCAYELVKKGHEVVVLEASGRHGGHVYTTRDELSDGLYGDFGQEHIVKPGYERYWEYLKEFNITALPYPRRKNLRRRINGKFYTEQMLQDPVELKNFGFNKIEIDYLSTHPWSDLKSLYTKPYLDTFKDEYQPFQVGYDALDKVPMSDIYKKGGASPAALAFLGGNNSSALYELWYAAILKMRGVATYPTEVFRLKGGNQMLPNAFAKRLGSRVWLNCPITSITNGETGVRVTYERQKEVKEISADYFVNCIPLPTLKNIPITPALSEKKQYINENITYDSYQRFVFQASSKFWEDDGFENINMSLDHPDLWEVWQSAEEVDTHRVIVLGTGPGGVSPQRALAAFREVYPGKADTIELAVGRDWTKQKYSPNCERTAFPIGELNKFWPHIMAAEGRIHFAGAYADNLNWGTEAATRSANRVAETIHHL
>NZ_CP022515.1|WP_157730952.1|5126232_5126958_+|hypothetical-protein
MRQIIIVGILLIACFYFLFSFSNRQVQENRPPEIRITAPLPNSTFKWNSILPYEIQVSDFEDGNSEYDEINPNEVLLIVQYLRDSSELKPYLKLKSNTNYETLIQMGSSTCFNCHRAKGKLIGPSFTDIAAKYDRDPKTIELLAKKIMTGSSSVWGDEKMPPHPDLMAGQVRELVRWILENNSDSNRDYLAGLRGSIKTREKIEDKEKGILVMTAIYRDHGSDNQGQSSIQAQNTLILKKH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP022515_7	7.1\|4327668\|18\|NZ_CP022515\|CRISPRCasFinder	4327668-4327685	18	NZ_CP022515.1	771527-771544	1.0
NZ_CP022515_7	7.1\|4327668\|18\|NZ_CP022515\|CRISPRCasFinder	4327668-4327685	18	NZ_CP022515.1	2213082-2213099	1.0
NZ_CP022515_7	7.2\|4327709\|34\|NZ_CP022515\|CRISPRCasFinder	4327709-4327742	34	NZ_CP022515.1	771470-771503	1.0
NZ_CP022515_7	7.2\|4327709\|34\|NZ_CP022515\|CRISPRCasFinder	4327709-4327742	34	NZ_CP022515.1	2213025-2213058	1.0

1. spacer 7.1|4327668|18|NZ_CP022515|CRISPRCasFinder matches to position: 771527-771544, mismatch: 0, identity: 1.0

gactcctggattggcaga	CRISPR spacer
gactcctggattggcaga	Protospacer
******************

2. spacer 7.1|4327668|18|NZ_CP022515|CRISPRCasFinder matches to position: 2213082-2213099, mismatch: 0, identity: 1.0

gactcctggattggcaga	CRISPR spacer
gactcctggattggcaga	Protospacer
******************

3. spacer 7.2|4327709|34|NZ_CP022515|CRISPRCasFinder matches to position: 771470-771503, mismatch: 0, identity: 1.0

cactggcgcaaaacgaaccgaaatccctcaggga	CRISPR spacer
cactggcgcaaaacgaaccgaaatccctcaggga	Protospacer
**********************************

4. spacer 7.2|4327709|34|NZ_CP022515|CRISPRCasFinder matches to position: 2213025-2213058, mismatch: 0, identity: 1.0

cactggcgcaaaacgaaccgaaatccctcaggga	CRISPR spacer
cactggcgcaaaacgaaccgaaatccctcaggga	Protospacer
**********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NZ_CP054832	Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence	19109-19135	5	0.815
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	CP003185	Thermoanaerobacterium saccharolyticum JW/SL-YS485 plasmid pMU3262, complete genome	87823-87849	5	0.815
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	2432-2458	5	0.815
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NZ_CP054008	Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3	19897-19923	5	0.815
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NC_019956	Thermoanaerobacterium thermosaccharolyticum M0795 plasmid pTHETHE01, complete sequence	37171-37197	5	0.815
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	89652-89678	6	0.778
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	AP018321	Nostoc sp. HK-01 plasmid plasmid3 DNA, complete genome	25821-25847	6	0.778
NZ_CP022515_3	3.1\|1779627\|27\|NZ_CP022515\|CRISPRCasFinder	1779627-1779653	27	NZ_CP010270	Paenibacillus polymyxa strain Sb3-1 plasmid pSb31l, complete sequence	26136-26162	7	0.741
NZ_CP022515_4	4.1\|2325836\|27\|NZ_CP022515\|CRISPRCasFinder	2325836-2325862	27	NZ_CP006904	Clostridium botulinum 202F plasmid pCBI, complete sequence	15691-15717	8	0.704

1. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NZ_CP054832 (Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence) position: , mismatch: 5, identity: 0.815

ctacaaaaattggattaatataatttg	CRISPR spacer
ttacaaaaaatggattaaaataattac	Protospacer
.******** ******** ******

2. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to CP003185 (Thermoanaerobacterium saccharolyticum JW/SL-YS485 plasmid pMU3262, complete genome) position: , mismatch: 5, identity: 0.815

ctacaaaaattggattaatataatttg	CRISPR spacer
tcacaaaaattggcttaatataatatt	Protospacer
..*********** ********** *

3. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

ctacaaaaattggattaatataatttg	CRISPR spacer
ttacaaaaaatggattaaaataattac	Protospacer
.******** ******** ******

4. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NZ_CP054008 (Staphylococcus hominis strain FDAARGOS_762 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

ctacaaaaattggattaatataatttg	CRISPR spacer
ttacaaaaaatggattaaaataattac	Protospacer
.******** ******** ******

5. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NC_019956 (Thermoanaerobacterium thermosaccharolyticum M0795 plasmid pTHETHE01, complete sequence) position: , mismatch: 5, identity: 0.815

ctacaaaaattggattaatataatttg	CRISPR spacer
tcacaaaaattggcttaatataatatt	Protospacer
..*********** ********** *

6. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 6, identity: 0.778

ctacaaaaattggattaatataatttg	CRISPR spacer
ttacaaaaattggattaatatgtgtca	Protospacer
.********************.  *..

7. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to AP018321 (Nostoc sp. HK-01 plasmid plasmid3 DNA, complete genome) position: , mismatch: 6, identity: 0.778

ctacaaaaattggattaatataatttg	CRISPR spacer
aaacaaaatttggattaatattattaa	Protospacer
  ****** ************ *** .

8. spacer 3.1|1779627|27|NZ_CP022515|CRISPRCasFinder matches to NZ_CP010270 (Paenibacillus polymyxa strain Sb3-1 plasmid pSb31l, complete sequence) position: , mismatch: 7, identity: 0.741

tgcctcctctcaacctggcgcgtcctg	CRISPR spacer
tgcctcctctcaagctggcgctcaaga	Protospacer
************* ******* .   .

9. spacer 4.1|2325836|27|NZ_CP022515|CRISPRCasFinder matches to NZ_CP006904 (Clostridium botulinum 202F plasmid pCBI, complete sequence) position: , mismatch: 8, identity: 0.704

ctacaaaaattggattaatataatttg	CRISPR spacer
ggttaaaaattggattaatataaccac	Protospacer
   .*******************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2208054 : 2278996

Escherichia_phage(16.67%)

integrase,transposase

attL 2256217:2256263|attR 2279134:2279180

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_093980408.1\|2208054_2208948_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_093978120.1\|2209101_2209881_+	hypothetical protein	NA	NA	NA	NA
WP_093978121.1\|2209870_2210353_+	hypothetical protein	NA	NA	NA	NA
WP_093978122.1\|2210773_2211712_+	hydroxyacid dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	8.9e-33	31.0
WP_093978123.1\|2211816_2212203_+	VOC family protein	NA	NA	NA	NA
WP_093978124.1\|2212256_2212757_+	NINE protein	NA	NA	NA	NA
WP_157730649.1\|2213166_2214720_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	3.9e-09	25.2
WP_093977252.1\|2214743_2215484_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.6e-19	27.1
WP_093978125.1\|2215575_2216004_+	N-acetyltransferase	NA	NA	NA	NA
WP_093978126.1\|2216045_2217869_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_093978127.1\|2217955_2219206_-	aspartate kinase	NA	NA	NA	NA
WP_093978128.1\|2219202_2219682_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_093978129.1\|2219795_2220803_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	7.2e-65	43.3
WP_031442108.1\|2220850_2221273_-	TerB family tellurite resistance protein	NA	NA	NA	NA
WP_093978130.1\|2221727_2223770_+	response regulator	A0A1V0SGX0	Hokovirus	9.5e-48	33.0
WP_093978131.1\|2224127_2224988_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	1.3e-43	40.1
WP_093978132.1\|2225025_2226021_+	glycosyl transferase	NA	NA	NA	NA
WP_093978133.1\|2226035_2227397_+	beta-glucosidase	NA	NA	NA	NA
WP_093978134.1\|2227690_2228203_+	heme-binding domain-containing protein	NA	NA	NA	NA
WP_093978135.1\|2228503_2229655_+	FecR family protein	NA	NA	NA	NA
WP_157730743.1\|2229847_2233360_+	SusC/RagA family TonB-linked outer membrane protein	NA	NA	NA	NA
WP_093978137.1\|2233372_2235109_+	SusD/RagB family nutrient-binding outer membrane lipoprotein	NA	NA	NA	NA
WP_093978138.1\|2235301_2235892_-	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_093978139.1\|2237120_2240492_+	SusC/RagA family TonB-linked outer membrane protein	NA	NA	NA	NA
WP_093978140.1\|2240503_2242237_+	SusD/RagB family nutrient-binding outer membrane lipoprotein	NA	NA	NA	NA
WP_157730745.1\|2242577_2243576_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_031442118.1\|2243734_2244913_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_093978142.1\|2244986_2245700_-	methyltransferase	NA	NA	NA	NA
WP_093978143.1\|2245731_2247159_-	sulfatase	A0A2P0VMN7	Tetraselmis_virus	1.3e-43	30.9
WP_031442121.1\|2247273_2247861_-	SET domain-containing protein	NA	NA	NA	NA
WP_093978144.1\|2248078_2248606_-	16S rRNA processing protein RimM	NA	NA	NA	NA
WP_093978145.1\|2248619_2249180_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_093978146.1\|2249465_2249918_+	PA2169 family four-helix-bundle protein	NA	NA	NA	NA
WP_093978147.1\|2250072_2254509_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	3.8e-182	34.4
WP_093978148.1\|2254669_2254987_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.6e-18	46.7
WP_093978149.1\|2255184_2256114_+	DUF58 domain-containing protein	NA	NA	NA	NA
2256217:2256263	attL	NA	NA	NA	NA
WP_093978150.1\|2256538_2256688_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_093978151.1\|2256746_2257316_-	recombinase family protein	Q71TD8	Escherichia_phage	6.4e-26	36.9
WP_093978152.1\|2257600_2258485_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.3e-30	31.8
WP_093978153.1\|2258481_2259600_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_093978154.1\|2259614_2259818_+	hypothetical protein	NA	NA	NA	NA
WP_093978155.1\|2259963_2260908_+	hypothetical protein	NA	NA	NA	NA
WP_093980535.1\|2261301_2261622_+	hypothetical protein	NA	NA	NA	NA
WP_093978156.1\|2261962_2265139_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_157730992.1\|2266581_2267754_+	CDP-glycerol glycerophosphotransferase	NA	NA	NA	NA
WP_157730747.1\|2268071_2268212_-	hypothetical protein	NA	NA	NA	NA
WP_093978158.1\|2268873_2270025_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_093978159.1\|2270024_2270591_+	DUF4411 family protein	NA	NA	NA	NA
WP_093978160.1\|2270807_2271365_+	hypothetical protein	NA	NA	NA	NA
WP_085496332.1\|2271589_2271832_+	hypothetical protein	NA	NA	NA	NA
WP_093978162.1\|2272332_2272623_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_093978163.1\|2272615_2272891_-	hypothetical protein	NA	NA	NA	NA
WP_157730749.1\|2273639_2274026_+	hypothetical protein	NA	NA	NA	NA
WP_093978166.1\|2274022_2276323_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_093978167.1\|2276489_2277686_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.9e-24	26.7
WP_093978168.1\|2277757_2278996_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
2279134:2279180	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2594557 : 2708369

unidentified_phage(20.0%)

integrase,tRNA,transposase,protease

attL 2622704:2622718|attR 2706391:2706406

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031442357.1\|2594557_2594998_-\|protease	clan AA aspartic protease	NA	NA	NA	NA
WP_093978364.1\|2595037_2595805_+	TatD family hydrolase	NA	NA	NA	NA
WP_051891976.1\|2595964_2596942_+	type I asparaginase	NA	NA	NA	NA
WP_031442360.1\|2597175_2597925_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_093978365.1\|2597951_2598395_+	hypothetical protein	NA	NA	NA	NA
WP_093978366.1\|2598409_2599030_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_031442363.1\|2599055_2599538_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_093978367.1\|2599626_2600319_+	PorT family protein	NA	NA	NA	NA
WP_093978368.1\|2600313_2600919_-	hypothetical protein	NA	NA	NA	NA
WP_031442366.1\|2600918_2602376_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_093978369.1\|2602416_2603850_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	9.2e-82	39.1
WP_031442368.1\|2603955_2606355_-	MMPL family transporter	NA	NA	NA	NA
WP_031442369.1\|2606582_2607137_-	ribosome recycling factor	NA	NA	NA	NA
WP_031442370.1\|2607178_2607886_-	UMP kinase	NA	NA	NA	NA
WP_093978370.1\|2608129_2610022_+	peptidase M61	NA	NA	NA	NA
WP_093978371.1\|2610229_2611054_-	elongation factor Ts	NA	NA	NA	NA
WP_031442373.1\|2611149_2612196_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_031442374.1\|2612470_2612857_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_031442375.1\|2612856_2613312_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_093978372.1\|2615186_2615669_+	hypothetical protein	NA	NA	NA	NA
WP_093978373.1\|2615753_2618597_-	DNA polymerase I	F8WQ35	Bacillus_phage	2.7e-69	30.4
WP_031442378.1\|2618641_2619637_-	N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase	NA	NA	NA	NA
WP_093980555.1\|2619679_2620408_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_093978374.1\|2620459_2621689_+	metallophosphoesterase	NA	NA	NA	NA
WP_031442381.1\|2621780_2622077_+	thioredoxin family protein	NA	NA	NA	NA
WP_093980556.1\|2622136_2625469_-	DUF2723 domain-containing protein	NA	NA	NA	NA
2622704:2622718	attL	NA	NA	NA	NA
WP_093978375.1\|2625939_2626926_-\|transposase	DDE transposase	NA	NA	NA	NA
2622704:2622718	attL	NA	NA	NA	NA
WP_031443165.1\|2626906_2627266_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_093978376.1\|2627428_2627677_-\|transposase	transposase	NA	NA	NA	NA
WP_093978378.1\|2628595_2629912_+	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	9.9e-06	26.4
WP_093980557.1\|2629973_2630675_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_093978379.1\|2630729_2631443_-	VIT family protein	NA	NA	NA	NA
WP_093978380.1\|2631482_2632862_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_093978381.1\|2633765_2635082_+	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	9.9e-06	26.4
WP_036147316.1\|2635136_2635967_-	4,5-DOPA dioxygenase extradiol	NA	NA	NA	NA
WP_027066622.1\|2636025_2636895_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_036146809.1\|2637015_2637381_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_093978382.1\|2639488_2640244_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	1.0e-15	34.5
WP_093978383.1\|2640246_2641389_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_034257708.1\|2641710_2642091_-	DoxX family membrane protein	NA	NA	NA	NA
WP_051957448.1\|2642204_2642579_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_093978384.1\|2643018_2643774_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	9.3e-25	35.0
WP_093978385.1\|2643776_2644937_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_093978386.1\|2645211_2646084_-	carboxypeptidase-like regulatory domain-containing protein	NA	NA	NA	NA
WP_157730767.1\|2646240_2646531_-	hypothetical protein	NA	NA	NA	NA
WP_093978153.1\|2646458_2647577_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_093978152.1\|2647573_2648458_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.3e-30	31.8
2648065:2648079	attR	NA	NA	NA	NA
WP_093978387.1\|2648590_2649718_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	2.0e-31	34.4
2648065:2648079	attR	NA	NA	NA	NA
WP_093978388.1\|2649812_2650193_+	hypothetical protein	NA	NA	NA	NA
WP_157730749.1\|2650775_2651162_+	hypothetical protein	NA	NA	NA	NA
WP_093978389.1\|2651158_2653459_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_093978390.1\|2653650_2654874_-\|integrase	tyrosine-type recombinase/integrase	H7BUI8	unidentified_phage	1.4e-09	23.3
WP_031442383.1\|2655377_2655839_+	ribosome assembly cofactor RimP	NA	NA	NA	NA
WP_031442384.1\|2655852_2657085_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_093978391.1\|2657128_2659936_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	4.2e-22	24.1
WP_093978392.1\|2660583_2661912_+	c-type cytochrome	NA	NA	NA	NA
WP_093978393.1\|2661947_2665064_+	TAT-variant-translocated molybdopterin oxidoreductase	NA	NA	NA	NA
WP_083260612.1\|2665097_2666846_+	polysulfide reductase NrfD	NA	NA	NA	NA
WP_031442390.1\|2666848_2667370_+	DUF3341 domain-containing protein	NA	NA	NA	NA
WP_031442391.1\|2667381_2667942_+	cytochrome c	NA	NA	NA	NA
WP_031442392.1\|2667960_2669274_+	hypothetical protein	NA	NA	NA	NA
WP_093978394.1\|2669308_2670367_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_031442394.1\|2670413_2672234_+	cytochrome-c oxidase	R9VX24	Flavobacterium_phage	5.9e-65	69.4
WP_157730769.1\|2672432_2673257_+	DUF2807 domain-containing protein	NA	NA	NA	NA
WP_093978396.1\|2673253_2675518_-	acyl-CoA oxidase	A0A2K9L4A3	Tupanvirus	1.2e-72	31.4
WP_031442397.1\|2675669_2676692_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	31.6
WP_093978397.1\|2676739_2678071_+	cytochrome P450	I6WI04	Cotesia_sesamiae_Mombasa_bracovirus	8.4e-29	24.9
WP_093978398.1\|2678076_2678997_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_031442401.1\|2680395_2682690_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_031442402.1\|2682747_2683329_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_093978400.1\|2690735_2691116_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_157730771.1\|2691153_2691510_+	hypothetical protein	NA	NA	NA	NA
WP_093978401.1\|2691752_2692463_+	energy transducer TonB	NA	NA	NA	NA
WP_031442407.1\|2692683_2693583_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_093978402.1\|2693588_2694170_+	cytochrome oxidase subunit III	NA	NA	NA	NA
WP_031442409.1\|2694318_2695293_+	cytochrome oxidase subunit III	NA	NA	NA	NA
WP_031442410.1\|2695349_2695733_+	cytochrome C oxidase subunit IV family protein	NA	NA	NA	NA
WP_093978403.1\|2695868_2696501_+	hypothetical protein	NA	NA	NA	NA
WP_093978404.1\|2696500_2697229_+	SCO family protein	NA	NA	NA	NA
WP_093978405.1\|2697228_2697762_+	DUF420 domain-containing protein	NA	NA	NA	NA
WP_093978406.1\|2697799_2698012_+	hypothetical protein	NA	NA	NA	NA
WP_093978407.1\|2698100_2699348_+	ABC transporter permease	NA	NA	NA	NA
WP_093978408.1\|2699375_2700635_+	ABC transporter permease	NA	NA	NA	NA
WP_093978409.1\|2700717_2701830_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_031442418.1\|2701928_2702630_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-35	40.7
WP_093978410.1\|2702622_2703852_+	ABC transporter permease	NA	NA	NA	NA
WP_031442420.1\|2703853_2705116_+	ABC transporter permease	NA	NA	NA	NA
WP_031442421.1\|2705147_2706296_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_093978411.1\|2706337_2707678_+	TolC family protein	NA	NA	NA	NA
WP_093978412.1\|2707697_2708369_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA

DBSCAN-SWA_3

2969961 : 3052434

Streptococcus_phage(20.0%)

integrase,transposase

attL 2969175:2969191|attR 3056175:3056191

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2969175:2969191	attL	NA	NA	NA	NA
WP_093978590.1\|2969961_2970462_-\|transposase	transposase	NA	NA	NA	NA
WP_093978591.1\|2970474_2970792_-\|transposase	transposase	NA	NA	NA	NA
WP_093978592.1\|2970875_2971100_-	DUF4372 domain-containing protein	NA	NA	NA	NA
WP_093978593.1\|2971202_2971382_-	hypothetical protein	NA	NA	NA	NA
WP_093978594.1\|2971510_2973565_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_093978595.1\|2974373_2976779_+	peptidoglycan glycosyltransferase	NA	NA	NA	NA
WP_093978596.1\|2979590_2980013_+	response regulator	NA	NA	NA	NA
WP_093978597.1\|2980221_2983395_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-44	22.4
WP_093978598.1\|2983402_2984611_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_093980574.1\|2984623_2986006_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_093978599.1\|2986342_2987872_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_093978600.1\|2988323_2988608_-	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_157730790.1\|2988800_2988944_+	hypothetical protein	NA	NA	NA	NA
WP_157730792.1\|2989146_2989290_+	hypothetical protein	NA	NA	NA	NA
WP_093978601.1\|2989464_2989971_-	hypothetical protein	NA	NA	NA	NA
WP_157730794.1\|2989985_2994317_-	hypothetical protein	NA	NA	NA	NA
WP_093978603.1\|2994352_2998627_-	hypothetical protein	NA	NA	NA	NA
WP_093978604.1\|2998902_2999337_-	hypothetical protein	NA	NA	NA	NA
WP_093980575.1\|2999451_2999871_-	response regulator transcription factor	NA	NA	NA	NA
WP_157730796.1\|3001721_3002066_-	hypothetical protein	NA	NA	NA	NA
WP_093978607.1\|3002087_3002441_-	hypothetical protein	NA	NA	NA	NA
WP_093978608.1\|3002456_3002915_-	hypothetical protein	NA	NA	NA	NA
WP_093978609.1\|3003062_3003281_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_093978610.1\|3003718_3006454_+	Plug domain-containing protein	NA	NA	NA	NA
WP_093978611.1\|3007029_3007401_+	hypothetical protein	NA	NA	NA	NA
WP_093978612.1\|3007517_3011918_+	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_093980576.1\|3011934_3013194_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_047418561.1\|3013309_3013648_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_093978613.1\|3013663_3014086_+	transcriptional repressor	NA	NA	NA	NA
WP_093978614.1\|3014130_3014493_+	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_157730798.1\|3014633_3014873_+	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_093978616.1\|3014883_3015426_+	hypothetical protein	NA	NA	NA	NA
WP_093978617.1\|3015451_3016117_+	hypothetical protein	NA	NA	NA	NA
WP_093978618.1\|3016129_3018661_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.5e-132	43.9
WP_093978619.1\|3018698_3019175_+	transcriptional repressor	NA	NA	NA	NA
WP_093978620.1\|3019503_3019860_+	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_093980577.1\|3020020_3021919_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.5e-100	33.1
WP_093978622.1\|3022657_3023881_-	hypothetical protein	NA	NA	NA	NA
WP_093978623.1\|3023877_3024312_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_093978624.1\|3024315_3025515_-	thiol oxidoreductase	NA	NA	NA	NA
WP_093978625.1\|3025618_3026275_+	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_093978626.1\|3026620_3027235_+	recombinase family protein	A0A219Y912	Aeromonas_phage	3.4e-33	41.7
WP_093978627.1\|3027446_3027758_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_093978628.1\|3027763_3030484_+	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	1.4e-62	31.8
WP_093978629.1\|3030483_3032463_+	site-specific DNA-methyltransferase	A0A2K5B255	Erysipelothrix_phage	4.3e-77	34.9
WP_093978630.1\|3032465_3033737_+	hypothetical protein	NA	NA	NA	NA
WP_093978631.1\|3033729_3035436_+	ATP-binding protein	NA	NA	NA	NA
WP_093978632.1\|3035833_3036052_+	hypothetical protein	NA	NA	NA	NA
WP_093978633.1\|3036041_3036263_+	hypothetical protein	NA	NA	NA	NA
WP_093978634.1\|3036338_3036560_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	3.9e-16	56.8
WP_093978635.1\|3036591_3040200_+	hypothetical protein	NA	NA	NA	NA
WP_093978636.1\|3040281_3041355_+	hypothetical protein	NA	NA	NA	NA
WP_093978637.1\|3041371_3044611_+	hypothetical protein	NA	NA	NA	NA
WP_093978638.1\|3045090_3046638_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_093978639.1\|3046645_3047488_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	4.4e-31	34.0
WP_093978640.1\|3047470_3048190_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.9e-39	37.6
WP_093980578.1\|3048214_3049759_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_093978642.1\|3050572_3050815_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_093978643.1\|3050801_3051095_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_093978644.1\|3051210_3052434_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	6.8e-41	41.9
3056175:3056191	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP022515.1|WP_085496332.1|2271589_2271832_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP022515.1|WP_085496332.1|2271589_2271832_+|hypothetical-protein

2271589_2271832_+

80 aa aa

2208054-2278996

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP022515_7	Orphan	7.1\|4327668\|18\|NZ_CP022515\|CRISPRCasFinder	4327668-4327685	18	2213099-2213082	0
NZ_CP022515_7	Orphan	7.2\|4327709\|34\|NZ_CP022515\|CRISPRCasFinder	4327709-4327742	34	2213058-2213025	0

1. spacer 7.1|4327668|18|NZ_CP022515|CRISPRCasFinder matches to NZ_CP022515 position: 2213099-2213082, mismatch: 0

gactcctggattggcaga	CRISPR spacer
gactcctggattggcaga	Protospacer
******************

2. spacer 7.2|4327709|34|NZ_CP022515|CRISPRCasFinder matches to NZ_CP022515 position: 2213058-2213025, mismatch: 0

cactggcgcaaaacgaaccgaaatccctcaggga	CRISPR spacer
cactggcgcaaaacgaaccgaaatccctcaggga	Protospacer
**********************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022515

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information