CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022477	Bacillus licheniformis strain BL-010 chromosome, complete genome	2 crisprs	DEDDh,csa3,cas3,DinG,WYL	6	17	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022477_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022477_1

1991725-1991831

Unclear

Consensus_repeat	Method
TCCTTTTTGCAGTAATCGTAATCCTT	CRISPRCasFinder

1 spacers

cas3,DinG

The CRISPR arrays of NZ_CP022477_1

>merge|NZ_CP022477|1|1991725-1991831|CRISPRCasFinder
TCCTTTTTGCAGTAATCGTAATCCTTTTTGCAAGGCTTGTGGTAATCGTAGTCTTTTTTGTAATCCTCATGGTAGTCATAATCCTTTTTGCAATAATCGTAATCCTT

>NZ_CP022477|1|1|1991725-1991831|CRISPRCasFinder
TCCTTTTTGCAGTAATCGTAATCCTT	TTTGCAAGGCTTGTGGTAATCGTAGTCTTTTTTGTAATCCTCATGGTAGTCATAA
TCCTTTTTGCAATAATCGTAATCCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022477.1\|WP_003182854.1\|2004580_2004850_+\|YpbS-family-protein	unknown	unknown	gnl\|CDD\|313867
NZ_CP022477.1\|WP_003182880.1\|1983425_1983845_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP022477.1\|WP_003182867.1\|1994594_1996100_+\|carboxypeptidase-M32	unknown	unknown	gnl\|CDD\|341054
NZ_CP022477.1\|WP_011198064.1\|1982583_1982784_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|290882
NZ_CP022477.1\|WP_071583619.1\|2000942_2004506_+\|dynamin	unknown	unknown	gnl\|CDD\|206739
NZ_CP022477.1\|WP_016886704.1\|1992564_1994484_+\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
NZ_CP022477.1\|WP_003182877.1\|1986909_1988223_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225895
NZ_CP022477.1\|WP_003182882.1\|1982963_1983407_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372950
NZ_CP022477.1\|WP_003182862.1\|1998438_1998990_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP022477.1\|WP_003182879.1\|1984020_1984527_+\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376324
NZ_CP022477.1\|WP_003182872.1\|1990312_1991464_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
NZ_CP022477.1\|WP_003182859.1\|2000136_2000640_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224669
NZ_CP022477.1\|WP_003182874.1\|1988849_1989401_+\|DUF1273-domain-containing-protein	unknown	unknown	gnl\|CDD\|237461
NZ_CP022477.1\|WP_003182873.1\|1989481_1989778_+\|cell-division-regulator-GpsB	unknown	unknown	gnl\|CDD\|237616
NZ_CP022477.1\|WP_003182875.1\|1988464_1988734_+\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|371387
NZ_CP022477.1\|WP_075218327.1\|1999031_2000129_+\|type-III-polyketide-synthase	unknown	unknown	gnl\|CDD\|225958
NZ_CP022477.1\|WP_009328010.1\|1984627_1986904_+\|DEAD/DEAH-box-helicase	cas3	mkCas0139_cas3_CAS-I	gnl\|CDD\|224126
NZ_CP022477.1\|WP_003182865.1\|1996456_1997041_+\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|181705
NZ_CP022477.1\|WP_009328016.1\|1997037_1998354_+\|purine-permease	unknown	unknown	gnl\|CDD\|274468
NZ_CP022477.1\|WP_003182857.1\|2000703_2000799_+\|Fur-regulated-basic-protein-FbpC	unknown	unknown	gnl\|CDD\|380216

Protein	Function_ID	Function_description	E-value
NZ_CP022477.1\|WP_003182854.1\|2004580_2004850_+\|YpbS-family-protein	gnl\|CDD\|313867	pfam10752, DUF2533, Protein of unknown function (DUF2533). This family of proteins with unknown function appears to be restricted to Bacillus spp.	1.35699e-40
NZ_CP022477.1\|WP_003182880.1\|1983425_1983845_-\|hypothetical-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	8.58059e-07
NZ_CP022477.1\|WP_003182867.1\|1994594_1996100_+\|carboxypeptidase-M32	gnl\|CDD\|341054	cd06460, M32_Taq, Peptidase family M32, which includes thermostable carboxypeptidases TaqCP, PfuCP and FisCP. Peptidase family M32 is a subclass of metallocarboxypeptidases, distributed mainly in bacteria and archaea, whose members contain a HEXXH motif that participates in coordinating a divalent cation such as Zn2+ or Co2+. It includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). The keratin-degrading extremophilic eubacterium Fervidobacterium islandicum M32 carboxypeptidase (FisCP) plays an important role in cellular metabolism, and significantly enhances the degradation of native chicken feathers. It has been shown to mainly cleave the C-termini of peptides with a basic amino acid sequence. Novel M32 peptidases from some eukaryotes: protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, have been identified, thus making these enzymes an attractive potential target for drug development against these organisms.	0
NZ_CP022477.1\|WP_011198064.1\|1982583_1982784_-\|hypothetical-protein	gnl\|CDD\|290882	pfam14178, YppF, YppF-like protein. The YppF-like protein family includes the B. subtilis YppF protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved LLDF sequence motif.	8.01632e-25
NZ_CP022477.1\|WP_071583619.1\|2000942_2004506_+\|dynamin	gnl\|CDD\|206739	cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. This family also includes bacterial DLPs. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes mitofusins (MFN1 and MFN2 in mammals) that are involved in mitochondrial fusion. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.	1.10545e-46
NZ_CP022477.1\|WP_016886704.1\|1992564_1994484_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	3.82373e-125
NZ_CP022477.1\|WP_003182877.1\|1986909_1988223_+\|hypothetical-protein	gnl\|CDD\|225895	COG3359, COG3359, Predicted exonuclease [DNA replication, recombination, and repair].	5.46715e-98
NZ_CP022477.1\|WP_003182882.1\|1982963_1983407_+\|hypothetical-protein	gnl\|CDD\|372950	pfam14179, YppG, YppG-like protein. The YppG-like protein family includes the B. subtilis YppG protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 115 and 181 amino acids in length. There are two completely conserved residues (F and G) that may be functionally important.	1.37994e-16
NZ_CP022477.1\|WP_003182862.1\|1998438_1998990_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	7.35941e-15
NZ_CP022477.1\|WP_003182879.1\|1984020_1984527_+\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|376324	pfam00358, PTS_EIIA_1, phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1.	4.10065e-68
NZ_CP022477.1\|WP_003182872.1\|1990312_1991464_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	0
NZ_CP022477.1\|WP_003182859.1\|2000136_2000640_+\|hypothetical-protein	gnl\|CDD\|224669	COG1755, COG1755, Uncharacterized protein conserved in bacteria [Function unknown].	4.59386e-51
NZ_CP022477.1\|WP_003182874.1\|1988849_1989401_+\|DUF1273-domain-containing-protein	gnl\|CDD\|237461	PRK13660, PRK13660, hypothetical protein; Provisional.	3.27348e-100
NZ_CP022477.1\|WP_003182873.1\|1989481_1989778_+\|cell-division-regulator-GpsB	gnl\|CDD\|237616	PRK14127, PRK14127, cell division regulator GpsB.	2.30627e-48
NZ_CP022477.1\|WP_003182875.1\|1988464_1988734_+\|spore-coat-protein-CotH	gnl\|CDD\|371387	pfam11122, Spore-coat_CotD, Inner spore coat protein D. This family is conserved in the Enterobacteriaceae family. CotD is an inner spore coat protein that is expressed in the middle phase of mother cell gene expression. Along with CotD, CotH, CotS and CotT it is assumed to assemble into the loose skeleton of the matrix, between the shells of SpoIVA and CotE. Coat proteins do not share much sequence similarity between species, but this does not imply they do not share secondary, tertiary, or quaternary features.	5.84885e-11
NZ_CP022477.1\|WP_075218327.1\|1999031_2000129_+\|type-III-polyketide-synthase	gnl\|CDD\|225958	COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism].	1.35805e-154
NZ_CP022477.1\|WP_009328010.1\|1984627_1986904_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|224126	COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only].	0
NZ_CP022477.1\|WP_003182865.1\|1996456_1997041_+\|xanthine-phosphoribosyltransferase	gnl\|CDD\|181705	PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated.	9.4737e-122
NZ_CP022477.1\|WP_009328016.1\|1997037_1998354_+\|purine-permease	gnl\|CDD\|274468	TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.	0
NZ_CP022477.1\|WP_003182857.1\|2000703_2000799_+\|Fur-regulated-basic-protein-FbpC	gnl\|CDD\|380216	NF033217, Fur_reg_FbpC, Fur-regulated basic protein FbpC. Members of this family are FbpC, Fur-regulated basic protein C. This protein has also been described as MrgC (metal-regulated gene C). Members of this family are found so far only in the genus Bacillus, although the small size may have interferred in gene-finding.	8.14213e-08

>NZ_CP022477.1|WP_003182872.1|1990312_1991464_+|class-I-SAM-dependent-RNA-methyltransferase
MKTYTLIATAPMGIEAIVAKEVRDLGYDCTVDNGKVVFEGDALAICRANLWLRTADRVKVQAAEFTAKTFDELFEKTKAIDWSAYLPEHASFPVTGKSVKSVLASVPDCQRIVKKAIAEKLKSEYQTQGEWLEETGPEYKIEVSLLKDKAVITLDSSGAGLHKRGYRTGQGEAPLKETLAAALILLTNWTPDRPFVDPFCGSGTIPIEAALIGQNIAPGFNRDFASERWEWIGKEVWDQARLEVEEKANYDQPLSISGYDLDHRMIEIAKANAEEAGLADFIEFKQMQVKDFRTKEEYGVIVGNPPYGERLGEKKAVEAMYKDMGKAFAELDTWSVYMLTSNERFEECYGKKATKKRKLFNGFIKTDYYQYWGKRPPKPNKEK
>NZ_CP022477.1|WP_003182873.1|1989481_1989778_+|cell-division-regulator-GpsB
MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMVIKDYEAFHQEIEELQQENLQLKKQLEEANKRQPAQSNTTNFDILKRLSNLEKHVFGSKLYD
>NZ_CP022477.1|WP_003182874.1|1988849_1989401_+|DUF1273-domain-containing-protein
MKVLAVTGYKPFELGIFKHDDKALFYIKKALENRMIALLEEGLEWVLISGQLGTELWAAEVAFSLQEEYPDLKVAVITPFLEQEKKWSEKNQEQYEAVLAASDFTESLTHRPYESPVQFKQKNRFFIEKADGLLILYDEEIEGSPVYMLNEAKKAQEKRDFPIYTITMDDLRVTVEECSFYEE
>NZ_CP022477.1|WP_003182875.1|1988464_1988734_+|spore-coat-protein-CotH
MHCKPHVMAPIVHPTQCCYNHTHSKTVVPHIHPQHTTNVNHQHFQHVHYYPQTQSAVNKASHQHFVSPGAGMMPGPGGMPGPGMGMGPY
>NZ_CP022477.1|WP_003182877.1|1986909_1988223_+|hypothetical-protein
MSLKRKLNRYKHHLGNQAKEEKTEPPADKLTSLSVSFEKEWAELGVKPYVFEECYCLIREVVYPLTHVHGHYAFSELHETVRRWNNSAVSHSLSSKGYTPSQLFFFDTETTGLGGGAGNAIFLLGHARVYDDRVVVKQHLLPKPGYEAALYHSFLSEVDIQSLVTYNGKAFDWPQVKTRHTLIRDRVPKLPDFGHFDLLHGSRRLWKHKFDRVSLGTVEKEELGVVRTEDTPGYLAPMMYFHFLKEERPEIIEGVLRHNELDVLSLITLYIHLSKKILTPEQTAEANEKYAMAKWLLANRETELATAQLQELEKKPFEHSERASFDLSMQYKKQGMLKEAAALWLKLQNGEDGKTAWRAGIELAKYFEHRKRDIRAALEVAENLLEQHGSQKFELTEKEMAGLLRRRERLERKYGRNIPRASAENDDLRKPNISSTL
>NZ_CP022477.1|WP_009328010.1|1984627_1986904_+|DEAD/DEAH-box-helicase
MTALFQKRNLTDMIQLLKEDQAFSRQIVHWHTIEGKEADYRDFPEGLDKRIVHALQQRGVEKLYSHQADAFLHSAAGKNVTLVTPTASGKTLCYNLPVIQRITEDQDARSLYLFPTKALSQDQKSELNELIDEIGASINCYTYDGDTSPSIRQKVRKAGHIVITNPDMLHSAILPHHTKWVSLFENLKYIVIDELHVYRGVFGSHVANVIRRLMRIAEFYGSKPQFICTSATIANPLELAETLTGQPMHLISNNGAPSGRKHFLFYNPPMVNRSLNIRKSATLEVRKLASEFLKNGIQTIVFARSRVRVEIILTYLQEVMKPIVGPHSIQGYRGGYLPNERRVIEKGLRSGDIKGVVSTNALELGVDIGQLQTCIMTGYPGTISSAWQQAGRAGRRHNEALIVMVASSAPLDQYIVQNPDYFFKQNPETAVINPDNLVILVDHIKCAAFELPFKRTDTFGGIEIEDILDYLAEERVLHLTGNTYHWMNDAFPAHGISLRSASQENVVIIDQSRREKAKVIGEMDRFSAMTLLHDEAIYLHQGIQYQVEKLDWEEKKAFVREVQVDYYTDANLAVLLRVLEVDKEKKTETAAFGFGDVTVQAKATIFKKIKFETHENIGSGPIHLPEEELHTNAAWVQVNDSERQNWNDIKLEEALLGTANVLGHVAALKVMCDPSDLHVFPQIKAVHNEKPTIFLYDRYPGGVGLSQKVYEQMPEIISEAHRLISRCPCESGCPSCIGVSGGDQTKNNALRLLKGWKG
>NZ_CP022477.1|WP_003182879.1|1984020_1984527_+|PTS-glucose-transporter-subunit-IIA
MLKKLFGIGQKQDEVKEETVFSPVDGQVLELSKVPDPVFSQKMMGDGMAVEPSAGEIVSPVDGEVIQLFHTKHAIGIRSLSGVELLIHIGLETVAMEGEGFTAHVKEGDKVKVGDPLITCDLELIKEKASSTITPIVIMNGDVLERVTKHEEAAAKKSETKLMELKVK
>NZ_CP022477.1|WP_003182880.1|1983425_1983845_-|hypothetical-protein
MDFKENDNHSLSKKDEIQEAVEQLFYNSPFHDILNSFQKLISDQLQNSTISMNIREDDGALYVDIAVPESFQNGDIMIEAKSRYLHIALKEKQESGGSSSFTSLSRTVLLPYPVREETMKTSWNRNVLTVSFSEQKKHE
>NZ_CP022477.1|WP_003182882.1|1982963_1983407_+|hypothetical-protein
MEERRSAVYPYSGPGAHIQAYQQNHQAYHPVQPYFSQESVPYAHPAQRPQPYQQPIEQNLDPFSVYHQPVQQQMQPLPPFQGFPYQHPYPSPRPNLHQPSQFQSFLSQFKKKNGQIDFSKMMDTAGQMVSTVNQVGALAKGFMGFFK
>NZ_CP022477.1|WP_011198064.1|1982583_1982784_-|hypothetical-protein
MNVSYLRNCFAEMKQYETDCMNKLMDFAKFLYIQGHLTLNEFRTSMKVLEANGAQHPAYDMNTDAS
>NZ_CP022477.1|WP_016886704.1|1992564_1994484_+|ATP-dependent-DNA-helicase
MTASRLPFSLTKTKNFYEELNNWIGDVFYDILPEKGFDLRDEQIFMAFQLERAFKEKKVMFAEAGVGTGKTLVYLLFALSYARYTGKPAVIACADETLIEQLVKKEGDIYKISEHLGLTIDARLSKSHDQYLCLKKLEKTMQRSDDEKWLDLYESLPSFVHESQGMQAFYPYGDRKENSSLSNDEWSEIGYDSFQDCLTCDMRHRCGLTLSRDHYRKSTDFIICSHDFYMEHVWTEEARKREGQLPLLPEHSAVVFDEGHLLEFAAQKALTYRVKQSTLEMFLERLLGNDIREEFAELVEEALRANDEFFGLLTENAEKAEGSERMRIKDDTDVKKAAAELYDLLEKIGEALVFEGELYTIDQYALTVVEEYLEQMAYSLSLYRKNAISWLEQKELESTFVVMPRTVSEVLGEKVFSKQIPFIFSSATLSENGSFDYLATSLGIRDYLSFTVDSPYDYEEQMKVYIHQIEEKEAKEEAAIRAIKESGGKTLILFPSFEELLSFKRRTAQESFSFPVYFEGDEEISTIVEKFQTVEESVLCSVHLWEGLDIPGDPLQNVIIWSLPFPPHDPVFEAKRSGVENAFREVDIPYMLLRLRQGIGRLIRSNSDSGTISIFAGDEKEWNVIKEVESVLPVQPVYV
>NZ_CP022477.1|WP_003182867.1|1994594_1996100_+|carboxypeptidase-M32
MMSINTYEKEFLETLKKISRYEQAINVMYWDMRTGAPRKGEESRAEAIGQLSADVFQMRTSPRMKELLDTLAGQKQDLPFDTQKAVEEAKKEYDLNSKIPEEEFKEYTTLTSKAESVWEKAKKASDFSLFAPYLEKIIDFKKRFISYWGYEGHPYNTLLDQYEPGVTVEKLDALFSELREAIVPLVQKIAASDKKPDTGFVHDHFPKERQRDVCHFFLQELGYDFEAGRLDETVHPFQVTISQGDARVTTAYNENDFRSAVFGTIHECGHAIYEQNIDEALGGTNLSDGASMGIHESQSLFYENFIGRHQSFWTRYFDKIKEASPDQFAGVTAEGFYRAVNESKPSLIRIEADELTYPLHIMIRYEIEKAIFSGEVSVGDLPKLWNDKYEAYLGITPPDDAKGILQDVHWSGGDFGYFPSYALGYMYAAQLKSSMLKDLPEFDRLIENGDFQPIRKWLTEHVHIHGKRKKPLEIIKSATGEELNVRHLIRYLEEKYTTLYL
>NZ_CP022477.1|WP_003182865.1|1996456_1997041_+|xanthine-phosphoribosyltransferase
MEKLKRKIAEQGTVLSDEVLKVDSFLNHQIDPELMLAVGEEFASLFREEGVTKIVTIESSGIAPAVMAGLKLGVPVVFARKRQSLTLTENLLTASVYSFTKKTESTVAVSASHLSKDDKVLIIDDFLANGQAAKGLVSIIEQAGAKVCGIGIVIEKSFQTGREELENLGIRVESLARIASLAGGKVTFLQEVGS
>NZ_CP022477.1|WP_009328016.1|1997037_1998354_+|purine-permease
MKLTAGKTVSLSIQHVLAMYAGAVVVPLIVGGALGLTPAQLTYLVSADILMCGVATLLQVWKNRFFGIGLPVVLGCTFTAVSPMISIASTYGIPAIYGSIIAGGVIVVIISFFFGKLVKFFPPVVTGSVVTVIGITLIPVAMNNMAGGEGSSDFGELSNLALAFSVLLVIVLLYRFTSGFIKSISILIGLIAGTAGAALMGKVDFTEVANAGWVQMIHPFYFGAPVFEVTPILTMSLVLIVSLVESTGVYFALGDLTDRRLTEKDLGKGYRAEGIAVLLGGVFNAFPYTAYSQNVGLVQLTGVKKNSVIALAGAFLILLGLFPKAAALTTIIPKPVLGGAMVAMFGMVIAYGIKMLSRVDFGKQENLLIVACSIGIGLGVTVVPQMFQNLPDAVKLLTENGIVAGSFTAILLNAIFHIHPFSRHAEQPEAVSAEKSAV
>NZ_CP022477.1|WP_003182862.1|1998438_1998990_+|GNAT-family-N-acetyltransferase
METVNELVERIRTKDGGEAVIRPVKMADAPDIIEAVKDVIQTGVYIQKERPRTLEEERAFISDMMKKDNMYAAVEIDGTVYGIARVIRGELKMKRHTGLFRTWLHSKAQGLGIGREIMSYTLKWCRLHRLHKLCLTVFSENEAALSLYKKSGFIVEGVQKEQVLSDGKYEDEVLMAYFFNGST
>NZ_CP022477.1|WP_075218327.1|1999031_2000129_+|type-III-polyketide-synthase
MAYVISAGTSIPRCHVDQKEAAVFAREMFKDSFKDIDRLLSAFQNGEIASRQFVMPLDWYKEAKSFKEKNQTYIDMAVRHSAEAVSNCLSDDRFLKKEIPCEKIDAIFFISSTGISTPSIEAKLMNILPFSKRAKRIPIWGLGCAGGASGIARAFEYCKAFPKAHVLVIAAELCSLTFQKDDQSKSNLIGTSLFGDGIAALLMCGKEADFSEARFEVLPEVLGSQSSTLEDSEEVMGWEINDNGFRVVFSRDIPTLIKTHLKNDIEAFLNKEHIALENIQVFLAHPGGKKVLDAYMESLGFSEAYIDCSRKILARHGNMSSATVMHVLKEYCLHGGPVPGKYGLLGALGPGFSSELLLLRWTKRE
>NZ_CP022477.1|WP_003182859.1|2000136_2000640_+|hypothetical-protein
MFWTILSIFAAQRLLELAVAKFNEKNALKEGAVEYGKRHYPYIVAMHVSFFVSLIWETTAFQRGTLPMALVVLTGLIFTQVLRYWALFSLGKCWNTKILVIPGTNLVRKGPYQWIKHPNYLAVALEFLLLPLLFQAYATALLFTVLNAAVMYIRIRTEEQALEKLHH
>NZ_CP022477.1|WP_003182857.1|2000703_2000799_+|Fur-regulated-basic-protein-FbpC
MTMFFLLAAVSTYSLLIGYVLKGIAGANPQK
>NZ_CP022477.1|WP_071583619.1|2000942_2004506_+|dynamin
MAQINTKDDLMKRAGAVFGELTKNGDDKRSAQLAGIIRKWLRKEVYIALTGHYSAGKSSLLNALLQEDVLPTSPIPTSANLVLVRRGEMKTTLHTVDGRYAQMDGSYDKEKVQAYCRDGSQIEMVEIEGPFSGIAPQAVLIDTPGIDSTDDAHFLSASSILHQADALFYVVHYNHVHSEENVKFLRSIKDKIPNIFFIVNQIDRHDEAETDFHAYKKQVLDMLLKEGISEEHLFFTSVTAADHPLNEFNRLRAELERLQHQSEQQLQAYTEQKISSLIHEHIKMLISDEDTALSEETASLRETVETLKSQLADLTEQEKRAEEQIKKDIQTIAQNANITPFEMRELAKSYLESIEKGFKKGILFSKAKTLEEKQKRKEAFLADVQKRVQAEIDWHVIEAIKAFMKCFNVQNDEMLREVLQFRTVIDENDLLRSRKKGAELTPEYVLNYTKELAENIRRKAKRQAQPLIDQLKTFIKERSVLQAEAIKAEYDAEQAKLAERERRLIEQQKSYEKANRLWDQWEHGNQSDLPANWYAAERKPLEKTLDAKRAEPVRAQGENSSRKDEALHPKKGVSEYIEHFFELARILADIPALEKQRKAFLHKTERLHTRQFTLALFGAFSSGKSSFANALCGRKVLPSSPTPTTATINKITKPSGTKRDGTAEVAFKTEGEITAELDQLLDGKMASAKGSAFGEKLKNLLKKEELHDDERLLIKNFLKAYERYGSYINDQEILTISADDLHPYVAEEQTACAVREVTVYLSTPVTEKGITIVDTPGASSMNKRHTELAFQYMKDADALLYLTYYQHSFSKADRSFLRKLGLIKDAFSMDKMFFILNAADLAKSPVELQTVEDYVRGELLKEGIQNPHLYHVSSKQELNKKTSPYNDFSRLKRELDDFIENGLARTAVEELLDEGKKLCETVFQLRGSLHRSAEEKEAEQKRVAKAYQEALAAIEEAEKGSSILQMTEKDVEEQFYHMKQRLAFFAHDLFKAAIHPGLQNGDWRANLQTALKSCLKEYEFEFLQELKALDIRMENLMLKFAGEQWANAVKERLAGNPYFSVHIQADRPETESWETTEASADEGEFTDELKMFKTPKTFFQQNGKARLVEAFTAKLSAITDNWIQREKQTFLNRCKTSAGQLQKAAVLSAKAQLEEQKEAYFHEALESAERENIEKAHALAGEWLRSC
>NZ_CP022477.1|WP_003182854.1|2004580_2004850_+|YpbS-family-protein
MTNVHEAITAHSKKQHQHIKQFVRLEQEREKAIDDVVDKCRRNEAFSTDLINQITVQMNELAKKGIVPTRRLVSKEMVAEYVSRKYPQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022477_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022477_2

3439696-3441803

Orphan

Consensus_repeat	Method
CCNGTNGNNCCNGTTGNNCC	CRT

32 spacers

The CRISPR arrays of NZ_CP022477_2

>merge|NZ_CP022477|2|3439696-3441803|CRT
CCTGTCGGGCCAGTTGGACCTGTCGGGCCAGTTGGACCTGTCGCTCCGGTTGGACCTGTTGGACCTGTCGCTCCCGTTGCTCCGGTTGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCCGTTGCTCCCGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGGGCCTGTCGCTCCGGTTGCTCCCGTTGCTCCGGTTGGGCCTGTCGCTCCGGTTGCTCCCGTTGCGCCTGTCGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTTGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTTGCTCCTGTCGCTCCGGTTGCTCCCGTCGGACCTGTTGGGCCTGTCGCTCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTCGGACCTGTTGGGCCTGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGCTCCTGTCGCTCCGGTTGCCCCCGTCGGACCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTCGCTCCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTCGCTCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTTGCTCCTGTCGCTCCGGTTGCTCCTGTCGCTCCCGTGGCTCCCGTGGCTCCCGTCGGACCTGTTGGGCCTGTCGCTCCGGTTGCTCCCGTCGGGCCGGTTGCTCCAGTTGGGCCTGTTGGGCCTGTCGCTCCCGTTGGACCTGTTGCTCCTGTCGCTCCGGTTGGACCTGTTGCGCCTGTCGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCGGTTGGACCTGTTGCGCCTGTCGCTCCGGTTGCTCCCGTTGCGCCTGTCGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCGCCGGTTGCGCCGGTTGCTCCGGTTGCGCCTGTTGCTCCCGTCGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCGCCGGTTGCTCCCGTCGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGCTCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTACGCCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGGACCTGTTGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCGCCTGTCGCTCCCGTTGGACCTGTTGCTCCTGTCGCTCCGGTTGCTCCTGTCGCTCCTGTGGCTCCCGTCGGACCTGTTGGGCCTGTCGCTCCGGTTGCTCCCGTCGGGCCGGTTGCTCCAGTTGGGCCTGTTGGGCCTGTCGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCGATTGGACCTGTTGCGCCTGTCGCTCCAGTTGCTCCCGTTGCGCCTGTCGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGCGCCGGTTGCTCCCGTTGCTCCTGTTGGACCGGTTGCTCCCGTTGCGCCTGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGCTCCTGTCGCTCCGGTTGCTCCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTTGCTCCCGTCGGACCTGTTGCTCCTGTCGGGCCGGTTGCGCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCTCCCGTTGCGCCTGTCGGGCCGGTTGCTCCCGTTGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCTCCCGTTGCGCCTGTCGGGCCGGTTGCTCCCGTTGGACCTGTTGCTCCCGTCGGACCGGTTGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTCGGACCGGTTGGGCCTGTCGCTCCTGTCGGGCCGGTTGCTCCCGTCGGACCTGTTGAGCCTGTCGCTCCTGTTGGACCGGTTGGACCTGTCGGGCCGGTTGGACC

>NZ_CP022477|2|1|3439696-3441803|CRT
CCTGTCGGGCCAGTTGGACC	TGTCGGGCCAGTTGGACCTGTCGCTCCGGTTGGACCTGTTGGACCTGTCGCTCCCGTTGCTCCGGTTGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCCGTTGCT
CCCGTCGGGCCGGTTGCTCC	CGTTGCTCCGGTTGGGCCTGTCGCTCCGGTTGCTCCCGTTGCTCCGGTTGGGCCTGTCGCTCCGGTTGCTCCCGTTGCGCCTGTCGCTCCCGTTGGA
CCTGTCGGGCCGGTTGCTCC	CGTTGCTCCTGTTGGACCTGTTGCTCCCGTTGGACCTGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTTGCT
CCTGTCGCTCCGGTTGCTCC	CGTCGGACCTGTTGGGCCTGTCGCTCCGGTTGCTCCTGTCGGGCCGGTTGCTCCCGTCGGACCTGTTGGG
CCTGTCGGGCCGGTTGCTCC	TGTCGGGCCGGTTGCTCCCGTTGCTCCGGTTGCTCCTGTCGCTCCGGTTGCCCCCGTCGGACCGGTTGCT
CCTGTCGGGCCGGTTGCTCC	TGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGACCTGTCGCTCCGGTTGCT
CCTGTCGGGCCGGTTGCTCC	TGTCGGGCCGGTTGCTCCCGTTGCTCCTGTTGGA
CCTGTCGCTCCGGTTGCTCC	CGTTGCTCCTGTTGGACCTGTTGCT
CCTGTCGCTCCGGTTGCTCC	TGTCGCTCCCGTGGCTCCCGTGGCTCCCGTCGGACCTGTTGGG
CCTGTCGCTCCGGTTGCTCC	CGTCGGGCCGGTTGCTCCAGTTGGGCCTGTTGGGCCTGTCGCTCCCGTTGGACCTGTTGCT
CCTGTCGCTCCGGTTGGACC	TGTTGCGCCTGTCGCTCCCGTTGGACCTGTCGGG
CCGGTTGCTCCGGTTGGACC	TGTTGCGCCTGTCGCTCCGGTTGCTCCCGTTGCG
CCTGTCGCTCCCGTTGGACC	TGTCGGGCCGGTTGCTCCCGTTGCGCCGGTTGCGCCGGTTGCTCCGGTTGCG
CCTGTTGCTCCCGTCGGACC	TGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCG
CCGGTTGCTCCCGTCGGACC	TGTTGCTCCTGTCGGGCCGGTTGCTCCCGTTGGA
CCTGTTGCTCCTGTCGGGCC	GGTTGCTCCCGTTGCTCCGGTTGCT
CCGGTTGCTCCTGTCGGGCC	GGTTGCTCCCGTTGCTCCGGTTACGCCTGTCGGG
CCGGTTGCTCCCGTTGCTCC	GGTTGGACCTGTTGCTCCCGTTGGACCTGTCGGG
CCGGTTGCTCCCGTTGCGCC	TGTCGCTCCCGTTGGACCTGTTGCTCCTGTCGCT
CCGGTTGCTCCTGTCGCTCC	TGTGGCTCCCGTCGGACCTGTTGGGCCTGTCGCT
CCGGTTGCTCCCGTCGGGCC	GGTTGCTCCAGTTGGGCCTGTTGGG
CCTGTCGCTCCCGTTGGACC	TGTCGGGCCGGTTGCTCCGATTGGACCTGTTGCG
CCTGTCGCTCCAGTTGCTCC	CGTTGCGCCTGTCGCTCCCGTTGGA
CCTGTCGGGCCGGTTGCTCC	CGTTGCTCCGGTTGCGCCGGTTGCTCCCGTTGCT
CCTGTTGGACCGGTTGCTCC	CGTTGCGCCTGTCGGGCCGGTTGCT
CCCGTTGCTCCGGTTGCTCC	TGTCGCTCCGGTTGCTCCGGTTGCT
CCTGTCGGGCCGGTTGCTCC	TGTCGGGCCGGTTGCTCCTGTCGGGCCGGTTGCTCCTGTTGCT
CCCGTCGGACCTGTTGCTCC	TGTCGGGCCGGTTGCGCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCTCCCGTTGCG
CCTGTCGGGCCGGTTGCTCC	CGTTGGACCTGTTGCTCCTGTCGGGCCGGTTGCTCCTGTCGCTCCGGTTGCTCCCGTTGCG
CCTGTCGGGCCGGTTGCTCC	CGTTGGACCTGTTGCTCCCGTCGGACCGGTTGGGCCGGTTGCT
CCTGTCGGGCCGGTTGCTCC	CGTCGGACCGGTTGGGCCTGTCGCT
CCTGTCGGGCCGGTTGCTCC	CGTCGGACCTGTTGAGCCTGTCGCTCCTGTTGGACCGGTTGGA
CCTGTCGGGCCGGTTGGACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022477.1\|WP_073411849.1\|3436807_3437782_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NZ_CP022477.1\|WP_003179731.1\|3455471_3455603_+\|DUF2639-domain-containing-protein	unknown	unknown	gnl\|CDD\|288026
NZ_CP022477.1\|WP_075218302.1\|3444493_3445819_-\|NTTRR-F1-domain	unknown	unknown	gnl\|CDD\|236090
NZ_CP022477.1\|WP_075218406.1\|3429397_3430462_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP022477.1\|WP_003179773.1\|3428016_3429312_-\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399
NZ_CP022477.1\|WP_003179739.1\|3451606_3451993_-\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NZ_CP022477.1\|WP_003179756.1\|3438338_3439430_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP022477.1\|WP_075218404.1\|3435366_3436740_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|223515
NZ_CP022477.1\|WP_003179746.1\|3447482_3449171_-\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP022477.1\|WP_080618597.1\|3442540_3444274_-\|NTTRR-F1-domain	unknown	unknown	gnl\|CDD\|236090
NZ_CP022477.1\|WP_003179735.1\|3454346_3455099_+\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|237252
NZ_CP022477.1\|WP_075218405.1\|3432967_3435211_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NZ_CP022477.1\|WP_075218303.1\|3445945_3446638_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|100048
NZ_CP022477.1\|WP_044822245.1\|3452260_3454222_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP022477.1\|WP_016886263.1\|3437799_3438342_+\|transferase	unknown	unknown	gnl\|CDD\|100053
NZ_CP022477.1\|WP_069500302.1\|3449244_3450657_-\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP022477.1\|WP_003179769.1\|3430458_3431568_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP022477.1\|WP_003179768.1\|3431690_3432773_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NZ_CP022477.1\|WP_009329065.1\|3446744_3447461_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP022477.1\|WP_011197653.1\|3427024_3427936_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999

Protein	Function_ID	Function_description	E-value
NZ_CP022477.1\|WP_073411849.1\|3436807_3437782_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.78515e-69
NZ_CP022477.1\|WP_003179731.1\|3455471_3455603_+\|DUF2639-domain-containing-protein	gnl\|CDD\|288026	pfam11121, DUF2639, Protein of unknown function (DUF2639). This family is conserved in the Bacillaceae family. Several members are named as being YflJ, but the function is not known.	1.6997e-09
NZ_CP022477.1\|WP_075218302.1\|3444493_3445819_-\|NTTRR-F1-domain	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	6.85241e-08
NZ_CP022477.1\|WP_075218406.1\|3429397_3430462_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	5.30922e-70
NZ_CP022477.1\|WP_003179773.1\|3428016_3429312_-\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	0
NZ_CP022477.1\|WP_003179739.1\|3451606_3451993_-\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.89474e-19
NZ_CP022477.1\|WP_003179756.1\|3438338_3439430_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.26658e-109
NZ_CP022477.1\|WP_075218404.1\|3435366_3436740_+\|glycosyltransferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	4.65841e-16
NZ_CP022477.1\|WP_003179746.1\|3447482_3449171_-\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP022477.1\|WP_080618597.1\|3442540_3444274_-\|NTTRR-F1-domain	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	1.87184e-10
NZ_CP022477.1\|WP_003179735.1\|3454346_3455099_+\|type-I-methionyl-aminopeptidase	gnl\|CDD\|237252	PRK12896, PRK12896, methionine aminopeptidase; Reviewed.	1.50659e-143
NZ_CP022477.1\|WP_075218405.1\|3432967_3435211_+\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.71342e-24
NZ_CP022477.1\|WP_075218303.1\|3445945_3446638_-\|N-acetyltransferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	2.18923e-50
NZ_CP022477.1\|WP_044822245.1\|3452260_3454222_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP022477.1\|WP_016886263.1\|3437799_3438342_+\|transferase	gnl\|CDD\|100053	cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.	1.63987e-36
NZ_CP022477.1\|WP_069500302.1\|3449244_3450657_-\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP022477.1\|WP_003179769.1\|3430458_3431568_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	5.519e-169
NZ_CP022477.1\|WP_003179768.1\|3431690_3432773_-\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.61835e-47
NZ_CP022477.1\|WP_009329065.1\|3446744_3447461_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.1936e-116
NZ_CP022477.1\|WP_011197653.1\|3427024_3427936_-\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	7.87289e-17

>NZ_CP022477.1|WP_003179756.1|3438338_3439430_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIRLIEPYITFEEVQAELKEIFSSGMLTKGPYVRTFADHMRQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPVFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKQICKEYGLPLVDDAACAIGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWLSVKLNHGAAISDGKLDFIDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQQIGPNVVHNIQSAVFKVPKNIVRDELIQYLSDCHIESTFGTYCLSGTTYYRRKYRQIKPNSIFLEQNTITLPCHDQVNVDQVVSAIQSFSQRKG
>NZ_CP022477.1|WP_016886263.1|3437799_3438342_+|transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLVIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRMHAAYHTDPDKPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRNIPPYSIAVGVPAKVIKNRRMKDEDLS
>NZ_CP022477.1|WP_073411849.1|3436807_3437782_+|NAD-dependent-epimerase/dehydratase-family-protein
MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVLQGDILDLNALKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKELGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAVGESFNIGNERTVITVYGLASTIIRVLGSKSQIFFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGIRRTAESIKKNLEQ
>NZ_CP022477.1|WP_075218404.1|3435366_3436740_+|glycosyltransferase
MKDFKSDIIHCLEQKEWNKAMKRLKEWEAQGSHNEPDFYFLQASLSVYLGHDHNAWLWLWRGLDLFPENRSLNLLMGKVCLRTGREKESAAYLQKGDGAETASWPKLDLPVDEKTEPPAGQIRILQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLANDLLPSYDLFHFHFGTSFTLDMSDYPILKQAEKPMVMHHWGSDVRLYSTLAKTNPYAVVKTKNEARIRYHLKRISQYVQHCIVADMELYEYVKDYYEHVHMIPTMIQLDRYTPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFHLVQGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWISDFMKDHYPSELPLIRANPANITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKTLAVYQSLLSE
>NZ_CP022477.1|WP_075218405.1|3432967_3435211_+|glycosyltransferase
MDNELEYLLDSVGLSWRETEISQLIFHHKWHDAAQKLEEKLKAAPFDPGLLISAAFVCEKKQQAQRASELYDDALLFVRREHRPRLMKEKEDLFKKMVRRPKIIFFVKPDLDRFLNSVVEHLSGTYRTKKIVVHDLNQIDAGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHLREYVLDQVKALKKEKTAVVPNGIKLDQYTFKQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDPRYKLFIAGTFQDARYQLYFNQMIDELRLTDNVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHSTDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVIHDFMQCFFEEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLRKPVLCYRRHQNNISYQLHKRIQSLVYVIDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDQDAKKECIQPLLDKMDEYFQLSLASDNQYERYMKNIKKIQLI
>NZ_CP022477.1|WP_003179768.1|3431690_3432773_-|glycosyltransferase
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDKTVEIAKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEEDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDMDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYKAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYHHNEEARKYRPEDKSVLHNKQLLEGKLGINN
>NZ_CP022477.1|WP_003179769.1|3430458_3431568_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIPLVNLKRQFQTVKQDILKEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAEPVFADVDPETYNLDPKKIEEKITPATKAIIPVHIFGQPADMDEIMELAKKHGLLVIEDACQAFGASYKERPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRRVASRYREGLKTAEHLTLPAEKEDRTHIYHLYCIGAKNRDYIIQSLKEQDIHSGVYYPCCLHLQSVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQDQIISALLKKGGGEK
>NZ_CP022477.1|WP_075218406.1|3429397_3430462_-|Gfo/Idh/MocA-family-oxidoreductase
MTVHFGLIGCGYMSRKHLQALAECDDAKLSAVSDLQEERMKEAEEYYASLAGEESRMTRYPQYQALLSDPKIEAVIIAAVSGLHAEMAKHALLTGKHVIVEKPMTLSLRDADELIELAEQNGLKLMVCHQMRHRPIMKKLKETIEEGKLGKIYLGTVSLRLNRSPAYYEAASWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDMLGGSGAKETEDVAVGILTFASQAKGVVEANIVTQPNNIGSSLSIFGENGTISLEGPALNRISRWYIHGEKADAEEAAKLIDIGGEQTAMYQNFISALKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTTDMKNK
>NZ_CP022477.1|WP_003179773.1|3428016_3429312_-|nucleotide-sugar-dehydrogenase
MSKQEIHNETIAVIGLGFVGLPLAMLLISKGMRVIGVDLDKKKVEALRKGTSYISDINDQAVQDGIGTGFFRPVSDYSLIGEADAVIICVPTPLNDDAGPDLNYVKRAAQLIGAHLKKGQLVVLESSTYPGTTRDIVKPILEKSGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGATDACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDRLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYIAERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPDLDLSGKKLASVPIDSKMLKEYDCVVILTDHDALPKELLLNHANVIFDTRGVLREAAGKAKVIQLGNGRS
>NZ_CP022477.1|WP_011197653.1|3427024_3427936_-|alpha/beta-hydrolase
MWIGILLMVSGIGISIFAVSLIVSYLFVLPNRSTYEETFFSGLKHGEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIISHGIKWSLFGGYKYVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAAVKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTKDQLVPPEMAKSLYERKKGFKKLYWIEGAGHVGGFRHNPEEYLNKIKDFILKIEPAN
>NZ_CP022477.1|WP_080618597.1|3442540_3444274_-|NTTRR-F1-domain
MTIENRIINGGFETGSLPPWTGFNAVVTSNFSHSGIYSVNLVTSSIGILAQSFLVNPGENFEFVISISKASSAPNPAIVITVDYYNSSFDFLSQGLSLTIPVNRLSAVNVWNEIYATTNSAPPGTVIGVVTIQKLPLSGGAPILIDDVAMITIDQPGATGATGATGATGPTGVTGPTGATGPTGPTGATGSTGATGPTGPTGATGPTGATGPTGPTGATGATGATGPTGATGATGPTGATGPTGATGPTGPTGATGSTGSTGPTGATGATGPTGVTGATGATGPTGATGPTGPTGATGPTGATGATGPTGATGPTGATGPTGATGPTGPTGATGSTGSTGPTGATGATGPTGVTGATGATGPTGATGPTGPTGATGPTGATGATGPTGVTGATGATGATGATGTTGATGPTGPQGPTGPPGEAGTMGAAGPTGPTGPASPQTAIFFNNLFGSTTVYNPPTVPLNTEVTVVSVPNVSVTSGQNIKVDYALAIEAVNTANSNIIFEIRLYRGGTLVQTRIFNRSLAAAGTQRFPLASTIVDTVPATATVDYSVRVAVTTASNVTSAAAFNRDLNLIRFP
>NZ_CP022477.1|WP_075218302.1|3444493_3445819_-|NTTRR-F1-domain
MSIRNAVMNGGFETGTLSSWLGVNASVTSQFSHSGFFSARFLGGTVTSYIAQFVPARAGEGSEFLVSLARASFLPAPSVTIQVTYFDSQFNFLGYGLFATVPSSRIPAAENGTWLEVYQTTSPAPSGTTQAFILINNIPQAGTASVLVDDVALLSVEGGGGPTGATGPTGATGVTGATGATGATGVTGPTGAPGPTGVTGPTGVTGATGPTGPTGATGPTGATGATGATGPTGTTGPTGATGPTGATGATGPTGVTGPTGATGPTGATGSTGATGPTGVTGPTGATGATGATGPTGATGPTGATGPGSLLGTPAQSTDPVSLTVGSETPILTTTVTSSAGQNIKLDSMAEVDIIIGPATTFEYSIIFTLYRNNSAIAQVSVDSQDEKSAGSVRVYGDIPNLTWVDTPGAGTQTYEVRINVTGTNLLAANVNTRALNAVIFD
>NZ_CP022477.1|WP_075218303.1|3445945_3446638_-|N-acetyltransferase
MIHETAKIGKNVVLGEHAVIEENVVIGDNVTIGHHAIIKRDTHIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAIVGASAVIYRDVLLEQGVFVGDMASIRENVAIGRESIIGRNAMVENNTRIGSKVTIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGKGNYPYQGPTIKRGAKIGNNATLLPAVVVGEGAVIGAGAVITKDVPAGKTAVGNPGRLMK
>NZ_CP022477.1|WP_009329065.1|3446744_3447461_-|trehalose-operon-repressor
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEDECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>NZ_CP022477.1|WP_003179746.1|3447482_3449171_-|alpha,alpha-phosphotrehalase
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAKPC
>NZ_CP022477.1|WP_069500302.1|3449244_3450657_-|PTS-system-trehalose-specific-EIIBC-component
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPQWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVIGFASFIVIGPITFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>NZ_CP022477.1|WP_003179739.1|3451606_3451993_-|DUF1992-domain-containing-protein
MDFSSIVSEDKIKQAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMAGDEGALKKELMTIDDLIAKCADEDERERLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGNKKR
>NZ_CP022477.1|WP_044822245.1|3452260_3454222_+|LTA-synthase-family-protein
MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQHILLFVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPTIMQAKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGASILVFLANLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTEVENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFLIDYKLDGKEVTPFLNSLAHDNETFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSAAFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLKQPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQALEQFFNDLKKAGLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSHKYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYYDTKTGELLNEKDIDPNIEEAVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHNPKTSESDAAQTTKSDSGQ
>NZ_CP022477.1|WP_003179735.1|3454346_3455099_+|type-I-methionyl-aminopeptidase
MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDLIGKEVLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESRILKEGDLINIDISAEFGGYYSDTGISFVLGKGDEMLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIKNLTGHGIGRNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFKTPDGSFVAQIEHTIVITKNEPIILTQLD
>NZ_CP022477.1|WP_003179731.1|3455471_3455603_+|DUF2639-domain-containing-protein
MHYGSKGWYVEELKKLGMTKYEGRKLQSYKKHFLANLLESVKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP022477.1	3444908-3444932	1	0.96
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP022477.1	3443285-3443309	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP022477.1	3443519-3443543	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP022477.1	3443537-3443561	2	0.92
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP022477.1	3443618-3443651	2	0.941
NZ_CP022477_2	2.20\|3441066\|34\|NZ_CP022477\|CRT	3441066-3441099	34	NZ_CP022477.1	3443618-3443651	2	0.941
NZ_CP022477_2	2.23\|3441219\|25\|NZ_CP022477\|CRT	3441219-3441243	25	NZ_CP022477.1	3444953-3444977	2	0.92
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP022477.1	3445133-3445157	2	0.92
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NZ_CP022477.1	3443627-3443651	2	0.92

1. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to position: 3444908-3444932, mismatch: 1, identity: 0.96

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgcgcctgttggacctgttgct	Protospacer
****** ******************

2. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to position: 3443285-3443309, mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttggtcctgttggacccgttgct	Protospacer
***** ************.******

3. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to position: 3443519-3443543, mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttggtcctgttggacccgttgct	Protospacer
***** ************.******

4. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to position: 3443537-3443561, mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgggcctgtcgct	Protospacer
***************.*****.***

5. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to position: 3443618-3443651, mismatch: 2, identity: 0.941

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgtcgctcccgttggacctgttgggcctgtcgct	Protospacer
***********************  *********

6. spacer 2.20|3441066|34|NZ_CP022477|CRT matches to position: 3443618-3443651, mismatch: 2, identity: 0.941

tgtggctcccgtcggacctgttgggcctgtcgct	CRISPR spacer
tgtcgctcccgttggacctgttgggcctgtcgct	Protospacer
*** ********.*********************

7. spacer 2.23|3441219|25|NZ_CP022477|CRT matches to position: 3444953-3444977, mismatch: 2, identity: 0.92

cgttgcgcctgtcgctcccgttgga	CRISPR spacer
cgttgcgcctgttgctcccgtcgga	Protospacer
************.********.***

8. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to position: 3445133-3445157, mismatch: 2, identity: 0.92

tgtcgctccggttgctccggttgct	CRISPR spacer
tgtcgctccggtggctccggtggct	Protospacer
************ ******** ***

9. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to position: 3443627-3443651, mismatch: 2, identity: 0.92

cgtcggaccggttgggcctgtcgct	CRISPR spacer
cgttggacctgttgggcctgtcgct	Protospacer
***.***** ***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26698-26722	1	0.96
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251883-251907	1	0.96
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN694114	Marine virus AFVG_250M252, complete genome	19703-19727	1	0.96
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	127-151	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	226-250	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130734-130758	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130761-130785	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321896-321920	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35457-35481	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35475-35499	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472805-472829	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26878-26902	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26626-26650	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26734-26758	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26752-26776	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26779-26803	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26797-26821	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26815-26839	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26842-26866	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26869-26893	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251901-251925	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251919-251943	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251973-251997	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251991-252015	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321698-321722	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321743-321767	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321887-321911	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-160	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-259	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-430	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-475	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68914-68938	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73747-73771	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-73996	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130743-130767	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73558-73582	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73666-73690	2	0.92
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32384-32408	2	0.92
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251964-251988	2	0.92
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71209-71233	2	0.92
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71536-71560	2	0.92
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73639-73663	2	0.92
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	361-385	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68779-68803	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68788-68812	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68797-68821	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68806-68830	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68815-68839	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68824-68848	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68833-68857	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68842-68866	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68851-68875	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68860-68884	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68869-68893	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68932-68956	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90219-90243	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90228-90252	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90237-90261	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90246-90270	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90255-90279	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90264-90288	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90273-90297	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130581-130605	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130590-130614	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130599-130623	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130662-130686	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130671-130695	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130680-130704	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130689-130713	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130698-130722	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130707-130731	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130716-130740	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130725-130749	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73876-73900	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321788-321812	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35402-35426	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35439-35463	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35493-35517	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327941-327965	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327977-328001	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328085-328109	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328103-328127	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328139-328163	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328175-328199	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328193-328217	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328283-328307	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328301-328325	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328319-328343	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328355-328379	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_006869	Bacillus mycoides pSin9.7 plasmid	8648-8672	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4501-4525	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4537-4561	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4645-4669	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4663-4687	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4699-4723	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4735-4759	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4753-4777	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4843-4867	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4861-4885	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4879-4903	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4915-4939	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53529-53553	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53547-53571	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53565-53589	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53601-53625	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53637-53661	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53709-53733	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53727-53751	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MN693798	Marine virus AFVG_250M119, complete genome	11466-11490	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131079-131103	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42441-42465	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42459-42483	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42531-42555	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42567-42591	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42603-42627	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42621-42645	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42639-42663	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137842-137866	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137860-137884	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137932-137956	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137968-137992	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138004-138028	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138022-138046	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138040-138064	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179427-179451	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179445-179469	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179517-179541	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179553-179577	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179589-179613	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179607-179631	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179625-179649	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355364-355388	3	0.88
NZ_CP022477_2	2.12\|3440616\|34\|NZ_CP022477\|CRT	3440616-3440649	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71200-71233	3	0.912
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26599-26623	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26608-26632	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26788-26812	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26824-26848	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26851-26875	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26662-26686	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26680-26704	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26689-26713	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26716-26740	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26725-26749	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251952	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251964-251988	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321788-321812	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321842-321866	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321869-321893	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321896-321920	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321914-321938	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	109-133	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	127-151	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	154-178	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	181-205	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	208-232	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	226-250	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	253-277	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	280-304	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	307-331	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	361-385	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68779-68803	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68788-68812	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68797-68821	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68806-68830	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68815-68839	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68824-68848	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68833-68857	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68842-68866	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68851-68875	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68860-68884	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68869-68893	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68923-68947	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68932-68956	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71209-71233	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72582-72606	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72750-72774	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73639-73663	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73720-73744	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73909-73933	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90219-90243	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90228-90252	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90237-90261	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90246-90270	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90255-90279	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90264-90288	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90273-90297	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130572-130596	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130581-130605	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130590-130614	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130599-130623	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130662-130686	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130671-130695	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130680-130704	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130689-130713	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130698-130722	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130707-130731	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130716-130740	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130725-130749	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130734-130758	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130752-130776	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130761-130785	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130770-130794	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72609-72633	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32393-32417	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179076-179100	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270977-271001	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131079-131103	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58283-58307	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30737-30761	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN693798	Marine virus AFVG_250M119, complete genome	11466-11490	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KF437907	Phormidium phage MIS-PhV1A, complete genome	8680-8704	3	0.88
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KF437907	Phormidium phage MIS-PhV1A, complete genome	8689-8713	3	0.88
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	207812-207836	3	0.88
NZ_CP022477_2	2.23\|3441219\|25\|NZ_CP022477\|CRT	3441219-3441243	25	MN693956	Marine virus AFVG_250M695, complete genome	17863-17887	3	0.88
NZ_CP022477_2	2.23\|3441219\|25\|NZ_CP022477\|CRT	3441219-3441243	25	MK686071	Streptomyces phage Mischief19, complete genome	33448-33472	3	0.88
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	MN694114	Marine virus AFVG_250M252, complete genome	19694-19727	3	0.912
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251892-251925	3	0.912
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP054842	Acidovorax sp. 16-35-5 plasmid unnamed2, complete sequence	33648-33672	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251952	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251919-251943	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71200-71224	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73558-73582	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	54579-54603	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26608-26632	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26734-26758	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26788-26812	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26797-26821	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26824-26848	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26851-26875	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26635-26659	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26761-26785	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051349-3051373	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051385-3051409	3	0.88
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NC_021304	Streptomyces phage Sujidade, complete genome	17743-17767	3	0.88
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NZ_CP025614	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence	50652-50676	3	0.88
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	397-421	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321752-321776	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125273-125297	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	1008-1032	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131040-131064	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131088-131112	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2731-2755	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	232-256	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	15-39	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MN694154	Marine virus AFVG_250M77, complete genome	21278-21302	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3238-3262	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246688-246712	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246760-246784	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246814-246838	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246958-246982	4	0.84
NZ_CP022477_2	2.15\|3440805\|34\|NZ_CP022477\|CRT	3440805-3440838	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73711-73744	4	0.882
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26887-26911	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26590-26614	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26635-26659	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KY421186	Flavobacterium phage FL-1, complete genome	26761-26785	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321707-321731	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	442-466	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73630-73654	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73729-73753	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131088-131112	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	KF437907	Phormidium phage MIS-PhV1A, complete genome	8671-8695	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN693862	Marine virus AFVG_250M91, complete genome	4489-4513	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN694247	Marine virus AFVG_250M89, complete genome	17686-17710	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN693850	Marine virus AFVG_250M88, complete genome	20526-20550	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416112-416136	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN694690	Marine virus AFVG_250M90, complete genome	19763-19787	4	0.84
NZ_CP022477_2	2.16\|3440859\|25\|NZ_CP022477\|CRT	3440859-3440883	25	MN693992	Marine virus AFVG_250M87, complete genome	8723-8747	4	0.84
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73657-73690	4	0.882
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125273-125306	4	0.882
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327959-327983	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327995-328019	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328121-328145	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328157-328181	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328337-328361	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327887-327911	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327923-327947	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328031-328055	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328067-328091	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328265-328289	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4519-4543	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4555-4579	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4681-4705	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4717-4741	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4897-4921	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4447-4471	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4483-4507	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4591-4615	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4627-4651	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4825-4849	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53583-53607	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53619-53643	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53691-53715	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53475-53499	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53511-53535	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42477-42501	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42549-42573	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42585-42609	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42657-42681	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42693-42717	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137878-137902	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137950-137974	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137986-138010	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138058-138082	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138094-138118	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179463-179487	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179535-179559	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179571-179595	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179643-179667	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179679-179703	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	MH884513	Bacillus phage vB_BpsS-36, complete genome	21495-21519	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531043-531067	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531151-531175	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531259-531283	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531601-531625	4	0.84
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553420-553444	4	0.84
NZ_CP022477_2	2.23\|3441219\|25\|NZ_CP022477\|CRT	3441219-3441243	25	MN694114	Marine virus AFVG_250M252, complete genome	19694-19718	4	0.84
NZ_CP022477_2	2.23\|3441219\|25\|NZ_CP022477\|CRT	3441219-3441243	25	MN694114	Marine virus AFVG_250M252, complete genome	19712-19736	4	0.84
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251910-251943	4	0.882
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	KY421186	Flavobacterium phage FL-1, complete genome	26680-26713	4	0.882
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71200-71233	4	0.882
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73711-73744	4	0.882
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_LR594668	Variovorax sp. SRS16 plasmid 3	329609-329633	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	508995-509019	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	80572-80596	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	234566-234590	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	80392-80416	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1834638-1834662	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1322801-1322825	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	80681-80705	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	80570-80594	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1210056-1210080	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	346660-346684	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	410597-410621	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	332675-332699	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	869363-869387	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	233881-233905	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	83292-83316	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	MN694423	Marine virus AFVG_250M1001, complete genome	26274-26298	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1661718-1661742	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	128194-128218	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	610592-610616	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1618563-1618587	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	45922-45946	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1224070-1224094	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1344848-1344872	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	593157-593181	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	934263-934287	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	187681-187705	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1552325-1552349	4	0.84
NZ_CP022477_2	2.25\|3441318\|25\|NZ_CP022477\|CRT	3441318-3441342	25	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1661733-1661757	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26680-26704	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26689-26713	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26716-26740	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KY421186	Flavobacterium phage FL-1, complete genome	26725-26749	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NC_021304	Streptomyces phage Sujidade, complete genome	17752-17776	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14671-14695	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32393-32417	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7526-7550	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	KF437907	Phormidium phage MIS-PhV1A, complete genome	8698-8722	4	0.84
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NC_028827	Streptomyces phage Lannister, complete genome	17472-17496	4	0.84
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	MT553337	Mycobacterium phage DroogsArmy, complete genome	2148-2172	4	0.84
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	JF957060	Mycobacterium phage Timshel, complete genome	2148-2172	4	0.84
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	485061-485085	4	0.84
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	405610-405634	4	0.84
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132597-132621	5	0.8
NZ_CP022477_2	2.8\|3440373\|25\|NZ_CP022477\|CRT	3440373-3440397	25	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	234635-234659	5	0.8
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125330-125363	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125387-125420	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125519-125552	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125576-125609	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125633-125666	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125690-125723	5	0.853
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125747-125780	5	0.853
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2551-2575	5	0.8
NZ_CP022477_2	2.21\|3441120\|25\|NZ_CP022477\|CRT	3441120-3441144	25	CP019719	Paenibacillus phage phiERICV, complete genome	5879-5903	5	0.8
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252027-252051	5	0.8
NZ_CP022477_2	2.26\|3441363\|25\|NZ_CP022477\|CRT	3441363-3441387	25	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	56681-56705	5	0.8
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116691-116715	5	0.8
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116727-116751	5	0.8
NZ_CP022477_2	2.31\|3441696\|25\|NZ_CP022477\|CRT	3441696-3441720	25	NZ_CP025549	Mycobacterium paragordonae strain 49061 plasmid unnamed3, complete sequence	12677-12701	5	0.8
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72741-72774	6	0.824
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73738-73771	6	0.824
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125462-125495	6	0.824
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321734-321767	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-439	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-74005	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73729-73762	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163665-163698	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576802-576835	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213677-213710	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183458-183491	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194963-194996	7	0.794
NZ_CP022477_2	2.12\|3440616\|34\|NZ_CP022477\|CRT	3440616-3440649	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73918-73951	7	0.794
NZ_CP022477_2	2.12\|3440616\|34\|NZ_CP022477\|CRT	3440616-3440649	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321689-321722	7	0.794
NZ_CP022477_2	2.12\|3440616\|34\|NZ_CP022477\|CRT	3440616-3440649	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-484	7	0.794
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73621-73654	7	0.794
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416103-416136	7	0.794
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	MN694114	Marine virus AFVG_250M252, complete genome	19712-19745	7	0.794
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321878-321911	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321779-321812	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251910-251943	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-169	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-268	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	361-394	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71281-71314	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130725-130758	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130761-130794	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71380-71413	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179076-179109	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270977-271010	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	KY421186	Flavobacterium phage FL-1, complete genome	26878-26911	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	MN693798	Marine virus AFVG_250M119, complete genome	11466-11499	8	0.765
NZ_CP022477_2	2.11\|3440562\|34\|NZ_CP022477\|CRT	3440562-3440595	34	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	756-789	8	0.765
NZ_CP022477_2	2.15\|3440805\|34\|NZ_CP022477\|CRT	3440805-3440838	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472751-472784	8	0.765
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328229-328262	8	0.765
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4789-4822	8	0.765
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49953-49986	8	0.765
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1105129-1105162	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163548-163581	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576685-576718	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19445-19478	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20372-20405	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213560-213593	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16431-16464	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17358-17391	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80299-80332	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81226-81259	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183341-183374	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77409-77442	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76482-76515	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	9045-9078	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8118-8151	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23664-23697	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22737-22770	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	213-246	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88639-88672	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195080-195113	8	0.765
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228815-228848	8	0.765
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1127437-1127470	8	0.765
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	729167-729200	8	0.765
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	322421-322454	8	0.765
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	386423-386456	8	0.765
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72609-72642	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130599-130632	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73666-73699	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73747-73780	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	KY421186	Flavobacterium phage FL-1, complete genome	26689-26722	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	KY421186	Flavobacterium phage FL-1, complete genome	26860-26893	9	0.735
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71527-71560	9	0.735
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_LT963396	Pseudomonas cerasi isolate PL963 plasmid PP1, complete sequence	104252-104285	9	0.735
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6537-6570	9	0.735
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11640-11673	9	0.735
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41507-41540	9	0.735
NZ_CP022477_2	2.19\|3441012\|34\|NZ_CP022477\|CRT	3441012-3441045	34	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15499-15532	9	0.735
NZ_CP022477_2	2.20\|3441066\|34\|NZ_CP022477\|CRT	3441066-3441099	34	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116727-116760	9	0.735
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321689-321722	10	0.706
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252018-252051	10	0.706
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-484	10	0.706
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90273-90306	10	0.706
NZ_CP022477_2	2.7\|3440319\|34\|NZ_CP022477\|CRT	3440319-3440352	34	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	8222-8255	10	0.706
NZ_CP022477_2	2.17\|3440904\|34\|NZ_CP022477\|CRT	3440904-3440937	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73900-73933	10	0.706
NZ_CP022477_2	2.18\|3440958\|34\|NZ_CP022477\|CRT	3440958-3440991	34	MN693226	Marine virus AFVG_25M419, complete genome	11822-11855	10	0.706
NZ_CP022477_2	2.24\|3441264\|34\|NZ_CP022477\|CRT	3441264-3441297	34	NC_007616	Nitrosospira multiformis ATCC 25196 plasmid 2, complete sequence	15804-15837	10	0.706
NZ_CP022477_2	2.27\|3441408\|43\|NZ_CP022477\|CRT	3441408-3441450	43	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35393-35435	12	0.721

1. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 1, identity: 0.96

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcccgttgctccgattgct	Protospacer
*******************.*****

2. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.96

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcccgttgctccggttggt	Protospacer
*********************** *

3. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 1, identity: 0.96

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcccgttgcgccggttgct	Protospacer
*************** *********

4. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
**************  *********

5. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
**************  *********

6. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
**************  *********

7. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
**************  *********

8. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
**************  *********

9. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgttcctgttggacccgttgct	Protospacer
*****.************.******

10. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgggcccgttgct	Protospacer
***************.**.******

11. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttagacctgttact	Protospacer
*************.********.**

12. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcccgttgct	Protospacer
 ***************** ******

13. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcctattgctccggttgct	Protospacer
*********..**************

14. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctccgattgctccggttgct	Protospacer
********* .**************

15. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcctattgctccggttgct	Protospacer
*********..**************

16. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgcttccgttgctccggttgct	Protospacer
*.*****.*****************

17. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctccgattgctccggttgct	Protospacer
********* .**************

18. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgcttccgttgctccgattgct	Protospacer
*******.***********.*****

19. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgcttccgttgctccgattgct	Protospacer
*******.***********.*****

20. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgcttccgttgctcccgttgct	Protospacer
*******.********** ******

21. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcctgttgccccggttgct	Protospacer
*********.*****.*********

22. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctccggttgccccggttgct	Protospacer
********* *****.*********

23. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcctgttgccccggttgct	Protospacer
*********.*****.*********

24. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttgctcctgttgccccggttgct	Protospacer
*********.*****.*********

25. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcccgttgct	Protospacer
 ***************** ******

26. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

27. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

28. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

29. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

30. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

31. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcccgttgct	Protospacer
 ***************** ******

32. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

33. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctccggttact	Protospacer
 *********************.**

34. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

35. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttgctcctgttgct	Protospacer
 ***************** ******

36. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggtcgctcccgttgctcccgttgct	Protospacer
***.************** ******

37. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
ggctgctcccgttgctccggttact	Protospacer
**.*******************.**

38. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 2, identity: 0.92

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcccgttgct	Protospacer
 ***************** ******

39. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

tgtcgctccggttgctccggttgct	CRISPR spacer
tgttgccccggttgctccggttgct	Protospacer
***.**.******************

40. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

tgtcgctccggttgctccggttgct	CRISPR spacer
tgttgctccggtcgctccggttgct	Protospacer
***.********.************

41. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

tgtcgctccggttgctccggttgct	CRISPR spacer
tgtcactccggttgctccggttact	Protospacer
****.*****************.**

42. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

tgtcgctccggttgctccggttgct	CRISPR spacer
tgtcgctcccgttgctcccgttgct	Protospacer
********* ******** ******

43. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

44. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

45. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

46. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

47. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

48. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

49. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

50. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

51. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

52. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

53. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

54. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

55. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

56. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

57. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

58. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

59. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

60. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

61. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

62. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

63. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

64. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

65. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

66. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

67. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

68. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

69. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

70. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

71. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

72. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

73. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

74. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgcccctgttggtcctgttggt	Protospacer
******.******** ******* *

75. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

76. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgggcccgttgct	Protospacer
.**************.**.******

77. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgggcccgttgtt	Protospacer
***************.**.****.*

78. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgggcccgttgtt	Protospacer
***************.**.****.*

79. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

80. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

81. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

82. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

83. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

84. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

85. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

86. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

87. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

88. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

89. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

90. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgtttctcctgttggacctgttggt	Protospacer
.*** ****************** *

91. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

92. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

93. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

94. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

95. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

96. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

97. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

98. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

99. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

100. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

101. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

102. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

103. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

104. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

105. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

106. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

107. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

108. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

109. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

110. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
.*************  *********

111. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

112. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

113. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

114. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

115. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

116. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

117. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

118. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

119. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

120. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

121. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

122. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

123. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

124. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

125. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

126. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

127. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

128. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

129. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

130. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccagtaggacctgttgct	Protospacer
.******** ** ************

131. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctccggtaggacctgttgct	Protospacer
.******** ** ************

132. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgctcctgttggacctgttgct	CRISPR spacer
cgtagctcctgttggtcctgttggt	Protospacer
*** *********** ******* *

133. spacer 2.12|3440616|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.912

tgttgcgcctgtcgctccggttgctcccgttgcg	CRISPR spacer
tgttgctccggtcgctccggttgctcccgttgca	Protospacer
****** ** ***********************.

134. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgcttccgttgctccgattgct	Protospacer
 ******.***********.*****

135. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
 ******** .**************

136. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctccggttgctccgattgct	Protospacer
 ******** *********.*****

137. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
 ******** .**************

138. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
 ******** .**************

139. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgcttccgttgctccgattgct	Protospacer
*.*****.***********.*****

140. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgctccgattgctccggttgct	Protospacer
*.******* .**************

141. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgctccggttgctcccgttgct	Protospacer
*.******* ******** ******

142. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgctccgattgctccggttgct	Protospacer
*.******* .**************

143. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgctccggttgctccgattgct	Protospacer
*.******* *********.*****

144. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccggttgctccggttgcc	Protospacer
.******** **************.

145. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgccccggttgctccggttgct	Protospacer
 *****.** ***************

146. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

147. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

148. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

149. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

150. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

151. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

152. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

153. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

154. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

155. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

156. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

157. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

158. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

159. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttactcctgttgct	Protospacer
 ************.**** ******

160. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

161. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

162. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

163. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

164. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

165. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

166. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

167. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

168. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

169. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

170. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

171. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

172. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcccgttgct	Protospacer
 ********.******** ******

173. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

174. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctccggtcgctccggttgct	Protospacer
 ******** **.************

175. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgcacccgttgctccgattgct	Protospacer
 ***** ************.*****

176. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgcacccgttgctccggttact	Protospacer
 ***** ***************.**

177. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgtcgctcccgttgctcccgttgct	Protospacer
 **.************** ******

178. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgggccggttgct	Protospacer
 *************  *********

179. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgtttctcccgttgctccggttact	Protospacer
 *** *****************.**

180. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

181. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

182. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

183. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

184. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

185. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

186. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

187. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcccgttgct	Protospacer
 ********.******** ******

188. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

189. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

190. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

191. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

192. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

193. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

194. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

195. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

196. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

197. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

198. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

199. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

200. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcccgttgct	Protospacer
 ********.******** ******

201. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

202. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttactcccgttgctcctgttgct	Protospacer
 ***.************* ******

203. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gattgctcccgttgctcctgctgct	Protospacer
*.**************** *.****

204. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
gatcgctcccgttgctcccgttgct	Protospacer
*.*.************** ******

205. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttggtcccgttgctccggttgac	Protospacer
***** ***************** .

206. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttggtcccgttgctccggttgac	Protospacer
***** ***************** .

207. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

208. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcccgttgtt	Protospacer
 ***************** ****.*

209. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcccgttgtt	Protospacer
 ***************** ****.*

210. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgct	Protospacer
 ********.******** ******

211. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgctccagttgct	Protospacer
.******** ********.******

212. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 3, identity: 0.88

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgctccagttgct	Protospacer
.******** ********.******

213. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggttgctccagttgggcctgttggg	CRISPR spacer
cgttgctgcagttgtgcctgttggg	Protospacer
 ****** ****** **********

214. spacer 2.23|3441219|25|NZ_CP022477|CRT matches to MN693956 (Marine virus AFVG_250M695, complete genome) position: , mismatch: 3, identity: 0.88

cgttgcgcctgtcgctcccgttgga	CRISPR spacer
cgttgcgcctgtggctcctgttggt	Protospacer
************ *****.*****

215. spacer 2.23|3441219|25|NZ_CP022477|CRT matches to MK686071 (Streptomyces phage Mischief19, complete genome) position: , mismatch: 3, identity: 0.88

cgttgcgcctgtcgctcccgttgga	CRISPR spacer
cgttgcgcctgccggtcccgttgca	Protospacer
***********.** ******** *

216. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 3, identity: 0.912

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgctcccgttgcgccggttgctcccgttgcg	Protospacer
 ******** ***********************

217. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.912

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgctcctgttgccccggttgctcccgttgct	Protospacer
 ******** ***** ******************

218. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP054842 (Acidovorax sp. 16-35-5 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgcgcctgtccggccggttcat	Protospacer
************* ********  *

219. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
agttgctccggttgctccggttgcc	Protospacer
 **.********************.

220. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggttgctccggttgccccggttgct	Protospacer
 **.***********.*********

221. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggtcgctccggttgctcccgttgca	Protospacer
 ***************** *****

222. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggtcgctcccgttgctcccgttgct	Protospacer
 ******** ******** ******

223. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggtcgctccggtcgctccggtcgct	Protospacer
 ***********.********.***

224. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
.**.******.**************

225. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggttgctccgattgctccggttgct	Protospacer
 **.******.**************

226. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
cgttgctccggttgctccgattgct	Protospacer
.**.***************.*****

227. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggttgctccgattgctccggttgct	Protospacer
 **.******.**************

228. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
.**.******.**************

229. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
cgttgctccgattgctccggttgct	Protospacer
.**.******.**************

230. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
tattgctccggttgctccgattgct	Protospacer
*.*.***************.*****

231. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
tattgctccggttgctccgattgct	Protospacer
*.*.***************.*****

232. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggtcgctccggttgcgccggtcgct	Protospacer
 ************** *****.***

233. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
agtcgctccggttgcgccggtcgct	Protospacer
 ************** *****.***

234. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NC_021304 (Streptomyces phage Sujidade, complete genome) position: , mismatch: 3, identity: 0.88

tgtcgctccggttgctccggttgct	CRISPR spacer
ggtcgctccggttgcgccggtcgct	Protospacer
 ************** *****.***

235. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NZ_CP025614 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

cgtcggaccggttgggcctgtcgct	CRISPR spacer
cgctggaccggttgggcctgtcgca	Protospacer
**..********************

236. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttggc	Protospacer
**************  ******* .

237. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
cgttgctcctgttgctcctgttggc	Protospacer
**************  ******* .

238. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcccgttggacctgttgag	Protospacer
.********.*************

239. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttggtcctgttggacctgttgaa	Protospacer
.**** *****************

240. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgtgggtcctgttgca	Protospacer
.*********** ** ********

241. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
tgttgctcctgttgctcctgttgca	Protospacer
.*************  ********

242. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agttgcacctgttggaccggttgca	Protospacer
 ***** *********** *****

243. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agttgcacctgttggaccggttgca	Protospacer
 ***** *********** *****

244. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agttgcacctgttggaccggttgca	Protospacer
 ***** *********** *****

245. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MN694154 (Marine virus AFVG_250M77, complete genome) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
acttgctcctgttgaacctgttgat	Protospacer
  ************.******** *

246. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agttgcacctgttggaccggttgca	Protospacer
 ***** *********** *****

247. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agtcgctcctgtaggacctgttgcg	Protospacer
 **.******** ***********

248. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agtcgctcctgtaggacctgttgcg	Protospacer
 **.******** ***********

249. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
agtcgctcctgtaggacctgttgcg	Protospacer
 **.******** ***********

250. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgctcctgttggacctgttgct	CRISPR spacer
tgtcgctcctgtaggacctgttgcg	Protospacer
.**.******** ***********

251. spacer 2.15|3440805|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.882

tgttgctcctgtcgggccggttgctcccgttgga	CRISPR spacer
cgttgctcccgttgggccggttgctcccgttggg	Protospacer
.********.**.********************.

252. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctccggtttaa	Protospacer
 *********************

253. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
aattgctcccgttgcttccgttgct	Protospacer
..**************.* ******

254. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
tattgctccggttgctccgattgct	Protospacer
 .******* *********.*****

255. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
tattgctccggttgctccgattgct	Protospacer
 .******* *********.*****

256. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcctgttggc	Protospacer
 ***************** **** .

257. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctcctgttggc	Protospacer
 ***************** **** .

258. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
cgttgctcccgttgctccggtcacc	Protospacer
 ********************..*.

259. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
ggttactcccgttgctcccgttggg	Protospacer
****.************* ****

260. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcctgttgctcctgttgca	Protospacer
 ********.******** *****

261. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgctccagttgca	Protospacer
.******** ********.*****

262. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN693862 (Marine virus AFVG_250M91, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgcaccggttgcc	Protospacer
.******** ***** ********.

263. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN694247 (Marine virus AFVG_250M89, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgcaccggttgcc	Protospacer
.******** ***** ********.

264. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN693850 (Marine virus AFVG_250M88, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgcaccggttgcc	Protospacer
.******** ***** ********.

265. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
tgttgctcccgttggtccggttaca	Protospacer
 ************* *******.*

266. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN694690 (Marine virus AFVG_250M90, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgcaccggttgcc	Protospacer
.******** ***** ********.

267. spacer 2.16|3440859|25|NZ_CP022477|CRT matches to MN693992 (Marine virus AFVG_250M87, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctcccgttgctccggttgct	CRISPR spacer
agttgctccagttgcaccggttgcc	Protospacer
.******** ***** ********.

268. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.882

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
ggctgctcccgttgctccggttactcctgtcgct	Protospacer
**.********************* *******

269. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctgttgag	Protospacer
 * ***************************.*.*

270. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

271. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

272. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

273. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

274. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

275. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

276. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

277. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

278. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

279. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

280. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

281. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

282. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

283. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

284. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

285. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

286. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

287. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

288. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

289. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

290. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

291. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

292. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

293. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

294. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

295. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

296. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

297. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

298. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

299. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

300. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

301. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

302. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

303. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

304. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

305. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

306. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

307. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtagggcctgttgct	Protospacer
 *********** **********

308. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

309. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagtaggacctgttggt	Protospacer
 *********** **.********

310. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
agttgctccagttggacctattgga	Protospacer
.**************.***.****.

311. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
ggttgctccagtagagcctgttgct	Protospacer
************ *.********

312. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
ggttgctccagtagagcctgttgct	Protospacer
************ *.********

313. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
ggttgctccagtagagcctgttgct	Protospacer
************ *.********

314. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
ggttgctccagtagagcctgttgct	Protospacer
************ *.********

315. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

ggttgctccagttgggcctgttggg	CRISPR spacer
ggttgctccagtagagcctgttgct	Protospacer
************ *.********

316. spacer 2.23|3441219|25|NZ_CP022477|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgctcccgttgga	CRISPR spacer
cgttgcgccggttgctcccgttgcg	Protospacer
********* **.********** .

317. spacer 2.23|3441219|25|NZ_CP022477|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgctcccgttgga	CRISPR spacer
cgttgcgccggttgctcccgttgcg	Protospacer
********* **.********** .

318. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgctccggttgccccggttgctcctgttgcc	Protospacer
 ************** ***********.*****.

319. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.882

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
gattgctccgattgctccggttgctcccgttgct	Protospacer
 .********.**** ******************

320. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.882

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
tgttgctccggtcgctccggttgctcccgttgca	Protospacer
.***********.** *****************

321. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.882

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
cgttgctcccgttgggccggttgctcccgttggg	Protospacer
********* **** *****************

322. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_LR594668 (Variovorax sp. SRS16 plasmid 3) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
tgttgcgcgtgtcgggccggttgag	Protospacer
.******* **************

323. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
tgttgcgcgtgtcgggccggttgag	Protospacer
.******* **************

324. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

325. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagccggtcgggccggttgag	Protospacer
***** *** *************

326. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

327. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

328. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

329. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

330. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

331. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagccggtcgggccggttgag	Protospacer
***** *** *************

332. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

333. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

334. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

335. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

336. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

337. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

338. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to MN694423 (Marine virus AFVG_250M1001, complete genome) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
agttgcccctgtcgggccagttgcg	Protospacer
 ***** ***********.*****

339. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

340. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
aattgcgcttgtcgggccggttgat	Protospacer
 .******.************** *

341. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgcgcttgtccggccggttgaa	Protospacer
********.**** *********

342. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

343. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

344. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

345. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

346. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgcgcttgtccggccggttgaa	Protospacer
********.**** *********

347. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

348. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

349. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

350. spacer 2.25|3441318|25|NZ_CP022477|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.84

cgttgcgcctgtcgggccggttgct	CRISPR spacer
cgttgagcttgtcgggccggttgag	Protospacer
***** **.**************

351. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gattgctccgattgctccggttgct	Protospacer
 .*.******.**************

352. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gattgctccggttgctcccgttgct	Protospacer
 .*.************** ******

353. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gattgctccgattgctccggttgct	Protospacer
 .*.******.**************

354. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gattgctccggttgctccgattgct	Protospacer
 .*.***************.*****

355. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NC_021304 (Streptomyces phage Sujidade, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
agtcgcgccggtcgctccggttgcg	Protospacer
 ***** *****.***********

356. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
tgttgctccggttgctccggtggtc	Protospacer
***.***************** *..

357. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gatcgctcccgttgctcccgttgct	Protospacer
 .******* ******** ******

358. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gatcgctcctgttgctccagttgct	Protospacer
 .******* ********.******

359. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
gatcgctccagttgctccagttgct	Protospacer
 .*******.********.******

360. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NC_028827 (Streptomyces phage Lannister, complete genome) position: , mismatch: 4, identity: 0.84

tgtcgctccggttgctccggttgct	CRISPR spacer
agtcgcgccggttgcgccggttgcg	Protospacer
 ***** ******** ********

361. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to MT553337 (Mycobacterium phage DroogsArmy, complete genome) position: , mismatch: 4, identity: 0.84

cgtcggaccggttgggcctgtcgct	CRISPR spacer
ggtcggaccggctgggcctgtcggc	Protospacer
 **********.*********** .

362. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to JF957060 (Mycobacterium phage Timshel, complete genome) position: , mismatch: 4, identity: 0.84

cgtcggaccggttgggcctgtcgct	CRISPR spacer
ggtcggaccggctgggcctgtcggc	Protospacer
 **********.*********** .

363. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cgtcggaccggttgggcctgtcgct	CRISPR spacer
ggtcggaccggtcgggccggtcgcc	Protospacer
 ***********.***** *****.

364. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 4, identity: 0.84

cgtcggaccggttgggcctgtcgct	CRISPR spacer
tgcaggaccggctgggcctgtcgct	Protospacer
.*. *******.*************

365. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.8

cgttgctcctgttggacctgttgct	CRISPR spacer
tactggtcctgttggacctgttgcc	Protospacer
...** ******************.

366. spacer 2.8|3440373|25|NZ_CP022477|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.8

cgttgctcctgttggacctgttgct	CRISPR spacer
tactggtcctgttggacctgttgcc	Protospacer
...** ******************.

367. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

368. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

369. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

370. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

371. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

372. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

373. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgttgctcccgttggacctggtgga	Protospacer
 * ************************** .**.

374. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.8

ggttgctccagttgggcctgttggg	CRISPR spacer
accgggtccagttgggcctgttggg	Protospacer
. . * *******************

375. spacer 2.21|3441120|25|NZ_CP022477|CRT matches to CP019719 (Paenibacillus phage phiERICV, complete genome) position: , mismatch: 5, identity: 0.8

ggttgctccagttgggcctgttggg	CRISPR spacer
tgttgctccagttgggcatgtttct	Protospacer
 **************** ****

376. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

tgtcgctccggttgctccggttgct	CRISPR spacer
aatacctccggttgctccggttgcc	Protospacer
 .*  *******************.

377. spacer 2.26|3441363|25|NZ_CP022477|CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

tgtcgctccggttgctccggttgct	CRISPR spacer
cccggctccggctgctccggttgct	Protospacer
. . *******.*************

378. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 5, identity: 0.8

cgtcggaccggttgggcctgtcgct	CRISPR spacer
cgttggaccggttgggcctgttata	Protospacer
***.*****************...

379. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 5, identity: 0.8

cgtcggaccggttgggcctgtcgct	CRISPR spacer
cgttggaccggttgggcctgttata	Protospacer
***.*****************...

380. spacer 2.31|3441696|25|NZ_CP022477|CRT matches to NZ_CP025549 (Mycobacterium paragordonae strain 49061 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.8

cgtcggaccggttgggcctgtcgct	CRISPR spacer
aactggaccggttgggccggtcgct	Protospacer
 ...************** ******

381. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.824

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
tgttgcacccgttgctccggttactcctgttgct	Protospacer
 ***** ***************** *****.*

382. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.824

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
tgttgctcccgttgctccggttactcccgttgct	Protospacer
 *********************** **.**.*

383. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgatggacctgtcgctcccgttggacctggtgga	Protospacer
 * *********.**************** .**.

384. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgtcactcctgttgctcccgttgctcctgttgct	Protospacer
.***.  ** **********************

385. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgtcactcctgttgctcccgttgctcctgttgct	Protospacer
.***.  ** **********************

386. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgtttctcctgttgctcccgttgctcctgttgct	Protospacer
***.   ** **********************

387. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttgctccggttactcccgttgctcccgttggg	Protospacer
.**.*  ******.*************.*****.

388. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactccggttggtcccgttactcctgttggt	Protospacer
***..  ******* *******.**********

389. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactccggttggtcccgttactcctgttggt	Protospacer
***..  ******* *******.**********

390. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactccggttggtcccgttactcctgttggt	Protospacer
***..  ******* *******.**********

391. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactccggttggtcccgttactcctgttggt	Protospacer
***..  ******* *******.**********

392. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 7, identity: 0.794

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactccggttggtcccgttactcctgttggt	Protospacer
***..  ******* *******.**********

393. spacer 2.12|3440616|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

tgttgcgcctgtcgctccggttgctcccgttgcg	CRISPR spacer
agctactcctgtcgctcctgtttctcccgttgct	Protospacer
 *.*.* *********** *** **********

394. spacer 2.12|3440616|34|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.794

tgttgcgcctgtcgctccggttgctcccgttgcg	CRISPR spacer
taatccccctgttgctcccgttgctcccgttgct	Protospacer
*. * * *****.***** **************

395. spacer 2.12|3440616|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.794

tgttgcgcctgtcgctccggttgctcccgttgcg	CRISPR spacer
taatccccctgttgctcccgttgctcccgttgct	Protospacer
*. * * *****.***** **************

396. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
cgttgctcccgttgctccggtcacccctgttact	Protospacer
 ********************.** *****..

397. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
tgttgctcccgttggtccggttacacctgtaatc	Protospacer
 ************* *********.***** .

398. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 7, identity: 0.794

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ttgcgcccccgttgcgccggttgctcccgttgcg	Protospacer
.  .**.** ***********************

399. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttactcctgttgctcccgttgctcctgttgct	Protospacer
.**..  ** **********************

400. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgtcactcctgttgctcctgttgctcctgttgct	Protospacer
.***.  ** ********.*************

401. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
ggttgctccggttgccccggttgctcctgttgcc	Protospacer
 **.*  ********.** *************

402. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttactcctgttgctcccgttgctcctgttgct	Protospacer
.**..  ** **********************

403. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttactcctgttgctcccgttgctcctgttgct	Protospacer
.**..  ** **********************

404. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgtcactcctgttgctcctgttgctcctgttgct	Protospacer
.***.  ** ********.*************

405. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
ggtcactccggttgctcccgttactcctgttaac	Protospacer
 ***.  ***************.********..

406. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttgctcctgttgctcctgttgctcctgttgct	Protospacer
.**.*  ** ********.*************

407. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttactcccgttgctcctgttgctcctgttgct	Protospacer
***..  ** ********.*************

408. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttgttcccgtcgctcccgttgctcctgtttca	Protospacer
.**.*  ** **.******************  *

409. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgtatttccggttggtcccgttgctccggttgac	Protospacer
***    ******* ************ ****.

410. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgtatttccggttggtcccgttgctccggttgac	Protospacer
***    ******* ************ ****.

411. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttgctcccgttgctcccgttgctccggtttaa	Protospacer
.**.*  ** ***************** *** .*

412. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 8, identity: 0.765

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgtgcctcctgttgctcctgttgctcctgttgct	Protospacer
***    ** ********.*************

413. spacer 2.11|3440562|34|NZ_CP022477|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.765

tgttgcgcctgtcgctcccgttggacctgtcggg	CRISPR spacer
agaaggtcctgtcggtcccgttggtcctgtcggt	Protospacer
 *  *  ******* ********* ********

414. spacer 2.15|3440805|34|NZ_CP022477|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

tgttgctcctgtcgggccggttgctcccgttgga	CRISPR spacer
tactcctcctgtcgggcctgttgctcctgtcagg	Protospacer
*..* ************* ********.**..*.

415. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
agtgaaacctgttgctccggtaggacctgtcgct	Protospacer
.** ..************ ** **********

416. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 8, identity: 0.765

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
agtgaaacctgttgctccggtaggacctgtcgct	Protospacer
.** ..************ ** **********

417. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
tgtcgaacctgttgctcccgttggacctatgtcc	Protospacer
 **.*.**********************.*

418. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.765

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
agcgcgacctgttgctggcgttggacctgtcgca	Protospacer
.*.  ***********  ************** .

419. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

420. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

421. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

422. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

423. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

424. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

425. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

426. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

427. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

428. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

429. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

430. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

431. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

432. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

433. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

434. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

435. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

436. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tgttagtccggttggtcctgttgctcctgttatt	Protospacer
***.. *** ***** **************...*

437. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

438. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.765

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
agtgtctcccgttggaccagtagctcctgttagt	Protospacer
 **  ************* ** ********.. *

439. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.765

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgcgccggttgcgccggtttctccgggccgt	Protospacer
 ***** *************** **** * .  *

440. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.765

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgcgccggttgcgccggtttctccgggccgt	Protospacer
 ***** *************** **** * .  *

441. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.765

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgcgccggttgcgccggtttctccgggccgt	Protospacer
 ***** *************** **** * .  *

442. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 8, identity: 0.765

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ggttgcgccggttgcgccggtttctccgggccgt	Protospacer
 ***** *************** **** * .  *

443. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
aattgctccgattgctcccgttgctcctgctgct	Protospacer
 .*.*  ***.******************.**

444. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgcttctcctgttgctcctgttgctcctgttgct	Protospacer
**..   ** ********.*************

445. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
cgttgctccggctgctcccgttgctccggttact	Protospacer
.**.*  ****.*************** ***.

446. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
tgttattcctgttgctcccgttgctccggttact	Protospacer
***..  ** ***************** ***.

447. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
gattgctccggttgctcccgttgctccgattgct	Protospacer
 .*.*  ******************** .***

448. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 9, identity: 0.735

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
gattgctccggttgcttccgttgctcccgttgct	Protospacer
 .*.*  *********.**********.****

449. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
tgtcactccggttgctccggttactcctgtttca	Protospacer
 **..**** ************** *****.  .

450. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_LT963396 (Pseudomonas cerasi isolate PL963 plasmid PP1, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
agatcttcctgttgctccggttatgcctgttgaa	Protospacer
.* * .***.*************.******.*..

451. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 9, identity: 0.735

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
cgttggtcctgtggctcccgttggaaaagtaaga	Protospacer
 ***** ***** ************   ** .*.

452. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tccgattccggttggacctgttgctcccgtttct	Protospacer
* . ..*** *****************.**. **

453. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tccgattccggttggacctgttgctcccgtttct	Protospacer
* . ..*** *****************.**. **

454. spacer 2.19|3441012|34|NZ_CP022477|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 9, identity: 0.735

tgtcgctcccgttggacctgttgctcctgtcgct	CRISPR spacer
tccgattccggttggacctgttgctcccgtttct	Protospacer
* . ..*** *****************.**. **

455. spacer 2.20|3441066|34|NZ_CP022477|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 9, identity: 0.735

tgtggctcccgtcggacctgttgggcctgtcgct	CRISPR spacer
cgtttctcccgttggaccggttgggcctgttata	Protospacer
.**  *******.***** ***********...

456. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 10, identity: 0.706

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
taatccccctgttgctcccgttgctcccgttgct	Protospacer
*. .   ** *****************.****

457. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.706

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
aatacctccggttgctccggttgcccctgttgcc	Protospacer
 .*    *********** *****.*******

458. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 10, identity: 0.706

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
taatccccctgttgctcccgttgctcccgttgct	Protospacer
*. .   ** *****************.****

459. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.706

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
ggatactcctgttgctcctgttgctcctgttgct	Protospacer
 * ..  ** ********.*************

460. spacer 2.7|3440319|34|NZ_CP022477|CRT matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

tgtcgggccggttgctcccgttgctcctgttgga	CRISPR spacer
ccgggggccggttgctccggctgctcctggggct	Protospacer
.   ************** *.********  *

461. spacer 2.17|3440904|34|NZ_CP022477|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.706

ggttgctcccgttgctccggttacgcctgtcggg	CRISPR spacer
tgtttctcccgttgctccggttactccaacaccc	Protospacer
 *** ******************* ** ..

462. spacer 2.18|3440958|34|NZ_CP022477|CRT matches to MN693226 (Marine virus AFVG_25M419, complete genome) position: , mismatch: 10, identity: 0.706

ggttggacctgttgctcccgttggacctgtcggg	CRISPR spacer
ttgtggacctgttgctcctgtaggacctacattg	Protospacer
   ***************.** ******..   *

463. spacer 2.24|3441264|34|NZ_CP022477|CRT matches to NC_007616 (Nitrosospira multiformis ATCC 25196 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.706

cgttgctccggttgcgccggttgctcccgttgct	CRISPR spacer
ttttgctcaggttgcgcaggttgctcggggggac	Protospacer
. ****** ******** ********  *  * .

464. spacer 2.27|3441408|43|NZ_CP022477|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 12, identity: 0.721

------tgtcgggccggttgctcctgtcgggccggttgctcctgttgct	CRISPR spacer
acaacct------tctgttgctcctgttgggcccgttgctcctgttggg	Protospacer
      *      .* ***********.***** *************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1016864 : 1071212

Bacillus_phage(31.11%)

terminase,integrase,holin,tail,portal,capsid,plate

attL 1015837:1015853|attR 1066942:1066958

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1015837:1015853	attL	NA	NA	NA	NA
WP_026080873.1\|1016864_1018079_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	3.6e-95	45.6
WP_017474936.1\|1018188_1018782_-	hypothetical protein	NA	NA	NA	NA
WP_017474937.1\|1018856_1019288_-	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	5.8e-40	53.6
WP_017474938.1\|1019304_1019784_-	helix-turn-helix domain-containing protein	A6XML9	Bacillus_virus	1.1e-47	63.5
WP_017474939.1\|1019951_1020200_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017474940.1\|1020202_1020403_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017474941.1\|1020492_1021011_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	1.2e-36	47.6
WP_017474942.1\|1020995_1021274_+	hypothetical protein	NA	NA	NA	NA
WP_017474943.1\|1021274_1021463_+	hypothetical protein	NA	NA	NA	NA
WP_017474944.1\|1021598_1021796_+	hypothetical protein	NA	NA	NA	NA
WP_017474945.1\|1021808_1022024_+	hypothetical protein	NA	NA	NA	NA
WP_017474946.1\|1022144_1022324_+	hypothetical protein	NA	NA	NA	NA
WP_017474947.1\|1022323_1023274_+	hypothetical protein	S6C475	Thermus_phage	9.7e-112	62.7
WP_017474948.1\|1023266_1024193_+	recombination protein RecT	S6AVW6	Thermus_phage	1.9e-91	60.7
WP_017474950.1\|1024360_1025173_+	hypothetical protein	S6BFM4	Thermus_phage	1.3e-11	45.6
WP_017474951.1\|1025175_1025457_+	hypothetical protein	NA	NA	NA	NA
WP_075218334.1\|1025431_1026736_+	replicative DNA helicase	D2XR44	Bacillus_phage	2.2e-90	42.5
WP_075218335.1\|1026771_1026948_+	Fur-regulated basic protein FbpA	M4ZS77	Bacillus_phage	1.7e-06	49.1
WP_017474954.1\|1027055_1027316_+	hypothetical protein	NA	NA	NA	NA
WP_017474955.1\|1027315_1027459_+	hypothetical protein	NA	NA	NA	NA
WP_017474956.1\|1027451_1027910_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	4.6e-51	68.3
WP_026080875.1\|1027879_1028557_+	hypothetical protein	NA	NA	NA	NA
WP_017474958.1\|1028798_1029065_+	DUF3850 domain-containing protein	A8E2L6	Enterococcus_phage	2.1e-19	59.2
WP_017474959.1\|1029136_1029343_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.3e-08	49.1
WP_017474960.1\|1029388_1029628_+	hypothetical protein	NA	NA	NA	NA
WP_017474961.1\|1029642_1030080_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	3.6e-53	72.9
WP_017474962.1\|1030114_1030324_+	hypothetical protein	F8WPM3	Bacillus_phage	1.2e-09	50.7
WP_017474963.1\|1030614_1030902_+	hypothetical protein	NA	NA	NA	NA
WP_017474964.1\|1031077_1031461_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.0e-31	60.2
WP_017474966.1\|1031642_1032746_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.7e-46	30.8
WP_042886261.1\|1034700_1035153_+	hypothetical protein	NA	NA	NA	NA
WP_017474971.1\|1035879_1036149_+	hypothetical protein	NA	NA	NA	NA
WP_017474972.1\|1036257_1037535_+	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	1.2e-88	44.8
WP_017474973.1\|1037669_1037918_+	hypothetical protein	A8ATN7	Listeria_phage	3.2e-06	39.7
WP_075218314.1\|1037964_1038834_+\|terminase	terminase	D2IYW0	Enterococcus_phage	1.4e-37	42.5
WP_075218313.1\|1038830_1040126_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	5.9e-160	63.7
WP_017474896.1\|1041659_1042577_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.3e-49	38.1
WP_017474897.1\|1042615_1043356_+	hypothetical protein	NA	NA	NA	NA
WP_017474898.1\|1043389_1044565_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.6e-82	52.3
WP_017474899.1\|1044577_1045513_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.9e-102	62.7
WP_016886615.1\|1045523_1045937_+	hypothetical protein	NA	NA	NA	NA
WP_017474900.1\|1045943_1046339_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.7e-17	41.1
WP_017474901.1\|1046335_1046692_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_017474902.1\|1046688_1047186_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.2e-39	46.5
WP_017474903.1\|1047175_1047640_+	hypothetical protein	NA	NA	NA	NA
WP_017474904.1\|1047640_1047865_+	hypothetical protein	NA	NA	NA	NA
WP_017474905.1\|1047865_1049266_+\|portal	phage portal protein	A0A0A7RTT5	Clostridium_phage	8.7e-85	42.0
WP_016886608.1\|1049267_1049711_+\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	1.2e-27	46.3
WP_016886607.1\|1049977_1050061_-	hypothetical protein	NA	NA	NA	NA
WP_016886606.1\|1050201_1050651_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.5e-09	31.2
WP_085959894.1\|1050680_1050830_+	hypothetical protein	NA	NA	NA	NA
WP_100225868.1\|1051001_1056086_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	3.7e-48	40.9
WP_017474907.1\|1056078_1056738_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	1.3e-25	33.3
WP_017474908.1\|1056759_1057743_+	hypothetical protein	H7BV96	unidentified_phage	9.6e-38	31.6
WP_017474909.1\|1057739_1058048_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.1e-05	36.3
WP_017474910.1\|1058060_1058486_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	8.7e-12	35.9
WP_017474911.1\|1058478_1059522_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.6
WP_017474912.1\|1059508_1060087_+	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	1.8e-15	27.8
WP_017474913.1\|1060083_1060359_+	hypothetical protein	NA	NA	NA	NA
WP_017474914.1\|1060359_1061463_+	hypothetical protein	M4ZRP1	Bacillus_phage	2.1e-17	63.4
WP_017474915.1\|1061474_1061804_+	hypothetical protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.1e-11	39.4
WP_017474916.1\|1061800_1061983_+	XkdX family protein	NA	NA	NA	NA
WP_017474917.1\|1062083_1062917_+	hypothetical protein	NA	NA	NA	NA
WP_017474918.1\|1062999_1063269_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	61.8
WP_017474919.1\|1063284_1063548_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.4e-31	74.7
WP_075218312.1\|1063599_1064679_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	1.7e-43	46.8
WP_017474554.1\|1064686_1064833_+	hypothetical protein	NA	NA	NA	NA
WP_017474553.1\|1065098_1065272_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.4e-24	92.7
WP_017474552.1\|1065319_1066129_-	ATP-dependent DNA ligase	O64130	Bacillus_phage	3.4e-97	62.8
WP_017474550.1\|1066704_1067415_+	hypothetical protein	Q0H269	Geobacillus_phage	1.3e-49	48.0
1066942:1066958	attR	NA	NA	NA	NA
WP_017474549.1\|1067417_1068167_+	DUF4065 domain-containing protein	Q0H268	Geobacillus_phage	1.4e-89	61.8
WP_016886467.1\|1068534_1069716_-	oxalate decarboxylase family bicupin	NA	NA	NA	NA
WP_003184708.1\|1070030_1071212_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.4e-27	28.2

DBSCAN-SWA_2

1243774 : 1280614

Bacillus_phage(36.11%)

capsid,terminase,integrase,portal

attL 1243668:1243685|attR 1282351:1282368

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1243668:1243685	attL	NA	NA	NA	NA
WP_094023852.1\|1243774_1244974_-\|integrase	site-specific integrase	S6C485	Thermus_phage	5.9e-82	45.0
WP_094023853.1\|1245057_1245534_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	1.4e-31	43.2
WP_157675207.1\|1245667_1245850_-	hypothetical protein	NA	NA	NA	NA
WP_094023855.1\|1245886_1246534_-	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	2.0e-28	50.8
WP_094023856.1\|1246628_1246895_-	hypothetical protein	NA	NA	NA	NA
WP_094023857.1\|1246946_1247312_-	helix-turn-helix transcriptional regulator	A8ATJ9	Listeria_phage	1.6e-09	54.2
WP_094023858.1\|1247483_1247726_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094023859.1\|1247738_1248050_+	hypothetical protein	A0A2H4JDL0	uncultured_Caudovirales_phage	1.7e-09	45.6
WP_094023860.1\|1248050_1248824_+	phage antirepressor Ant	A0A290FZK7	Caldibacillus_phage	4.3e-102	71.4
WP_094023861.1\|1248898_1249417_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	4.4e-34	47.0
WP_094023862.1\|1249413_1249692_+	hypothetical protein	Q9ZXC9	Bacillus_phage	5.1e-21	51.7
WP_011197846.1\|1249813_1250002_+	hypothetical protein	NA	NA	NA	NA
WP_094023863.1\|1250231_1251170_+	hypothetical protein	A6XMH8	Bacillus_virus	5.5e-83	48.9
WP_026579164.1\|1251188_1252034_+	recombination protein RecT	Q0H279	Geobacillus_phage	4.8e-78	55.2
WP_157675210.1\|1252055_1252193_+	hypothetical protein	NA	NA	NA	NA
WP_016885857.1\|1252208_1252442_+	hypothetical protein	NA	NA	NA	NA
WP_094023864.1\|1252463_1252664_+	hypothetical protein	NA	NA	NA	NA
WP_157675212.1\|1253453_1254278_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.2e-62	49.6
WP_094023866.1\|1254353_1254557_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.1e-15	61.5
WP_094023867.1\|1254734_1255025_+	IDEAL domain-containing protein	NA	NA	NA	NA
WP_094023868.1\|1255021_1255288_+	hypothetical protein	A0A1P8CWX5	Bacillus_phage	2.2e-21	54.3
WP_011197856.1\|1255388_1255598_+	hypothetical protein	NA	NA	NA	NA
WP_009328661.1\|1255692_1256142_+	hypothetical protein	A0A1B1P7V7	Bacillus_phage	3.6e-08	39.6
WP_094023869.1\|1256138_1256594_+	hypothetical protein	A0A0A7RWK2	Clostridium_phage	2.5e-09	33.5
WP_009330082.1\|1256593_1256782_+	hypothetical protein	A0A0A0RMX5	Bacillus_phage	1.5e-13	64.4
WP_009328659.1\|1256954_1257377_+	RusA family crossover junction endodeoxyribonuclease	M4ZS69	Bacillus_phage	2.5e-35	56.5
WP_094023870.1\|1257355_1257562_+	hypothetical protein	NA	NA	NA	NA
WP_094023871.1\|1257619_1258117_+	hypothetical protein	NA	NA	NA	NA
WP_094023872.1\|1258106_1258568_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	4.0e-47	63.8
WP_021837344.1\|1258900_1259419_+	hypothetical protein	NA	NA	NA	NA
WP_009328652.1\|1259354_1259582_+	hypothetical protein	A0A2H4JDM6	uncultured_Caudovirales_phage	4.0e-16	66.7
WP_073461257.1\|1259747_1260065_+	hypothetical protein	NA	NA	NA	NA
WP_021837347.1\|1260097_1260535_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	3.8e-55	74.3
WP_075646937.1\|1261070_1261526_+	hypothetical protein	A0A290FZR5	Caldibacillus_phage	1.1e-41	61.2
WP_021837352.1\|1262321_1262552_+	hypothetical protein	NA	NA	NA	NA
WP_094023873.1\|1262737_1263181_+	hypothetical protein	NA	NA	NA	NA
WP_094023955.1\|1263218_1263761_+\|terminase	terminase small subunit	A0A0M3LS14	Mannheimia_phage	2.0e-21	47.0
WP_094023874.1\|1263750_1265043_+\|terminase	PBSX family phage terminase large subunit	D2XPX9	Bacillus_virus	6.2e-178	69.4
WP_094023875.1\|1265045_1265486_+	hypothetical protein	NA	NA	NA	NA
WP_094023876.1\|1265498_1267010_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	4.0e-128	46.3
WP_094023877.1\|1267009_1268125_+	hypothetical protein	A0A1B1P858	Bacillus_phage	2.1e-89	47.0
WP_157675214.1\|1268136_1268301_+	hypothetical protein	NA	NA	NA	NA
WP_157675216.1\|1268300_1268453_+	hypothetical protein	NA	NA	NA	NA
WP_094023956.1\|1268571_1268889_+	hypothetical protein	A0A142F184	Bacillus_phage	1.4e-43	78.1
WP_094023878.1\|1268980_1269610_+	hypothetical protein	B3GW02	Streptococcus_phage	2.2e-27	46.8
WP_094023879.1\|1269628_1270516_+	hypothetical protein	A0A1S5SA37	Streptococcus_phage	7.0e-88	56.6
WP_157675218.1\|1270530_1270683_+	hypothetical protein	NA	NA	NA	NA
WP_094023880.1\|1270719_1271139_+	hypothetical protein	A0A1B1P889	Bacillus_phage	1.2e-10	48.1
WP_094023881.1\|1271131_1271470_+	hypothetical protein	NA	NA	NA	NA
WP_094023882.1\|1271466_1271814_+\|capsid	minor capsid protein	A0A1B1P872	Bacillus_phage	1.7e-26	53.0
WP_094023883.1\|1271825_1272236_+	hypothetical protein	NA	NA	NA	NA
WP_094023884.1\|1272237_1272690_+\|capsid	capsid protein	I1TLE8	Bacillus_phage	2.0e-22	42.5
WP_094023885.1\|1272643_1272943_+	fibronectin type III domain-containing protein	R4JF61	Bacillus_phage	1.5e-26	70.6
WP_094023886.1\|1272997_1273384_+	hypothetical protein	NA	NA	NA	NA
WP_094023887.1\|1273393_1274047_+	hypothetical protein	A8ASK5	Listeria_phage	6.2e-17	35.5
WP_094023888.1\|1274052_1276599_+	hypothetical protein	W8EBC4	Geobacillus_phage	1.0e-83	57.0
WP_094023889.1\|1276598_1277825_+	hypothetical protein	A0A0S2GLF9	Bacillus_phage	2.9e-31	47.1
WP_094023890.1\|1277839_1280614_+	hypothetical protein	Q5YA57	Bacillus_phage	2.5e-99	41.7
1282351:1282368	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1409648 : 1500997

104

Bacillus_phage(77.08%)

protease,terminase,tRNA,holin,head,portal,tail,capsid,plate,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003184083.1\|1409648_1410914_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.2e-147	63.5
WP_003184080.1\|1411096_1412752_+\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	1.4e-17	35.7
WP_009329308.1\|1412970_1415295_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-186	45.2
WP_003184076.1\|1415291_1415879_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003184074.1\|1415927_1416413_-	hypothetical protein	NA	NA	NA	NA
WP_009329306.1\|1416601_1417963_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_011198166.1\|1417968_1418799_+	cytochrome c	NA	NA	NA	NA
WP_009329302.1\|1418838_1419780_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_009329300.1\|1419769_1420561_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_009329298.1\|1420564_1421539_+	porphobilinogen synthase	NA	NA	NA	NA
WP_009329296.1\|1421564_1422860_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_075218431.1\|1423008_1424508_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_016885545.1\|1424535_1425558_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_003184058.1\|1425577_1425769_-	hypothetical protein	NA	NA	NA	NA
WP_003184055.1\|1426230_1428873_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.8e-161	42.3
WP_003184054.1\|1428948_1430253_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_003184052.1\|1430395_1431145_+	prepilin peptidase	NA	NA	NA	NA
WP_003184050.1\|1431348_1432380_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_003184048.1\|1432533_1433106_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_009329283.1\|1433160_1433547_+	DNA repair protein RadC	NA	NA	NA	NA
WP_009329281.1\|1433559_1434948_-	recombinase family protein	Q9T200	Bacillus_phage	2.0e-158	60.6
WP_106070692.1\|1434987_1435395_-	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.1e-35	59.7
WP_009329277.1\|1435499_1435943_-	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	6.4e-42	63.3
WP_009329275.1\|1436190_1436430_+	helix-turn-helix transcriptional regulator	D6R414	Bacillus_phage	1.1e-16	62.0
WP_009329273.1\|1436580_1436772_+	hypothetical protein	NA	NA	NA	NA
WP_009329271.1\|1436768_1437035_+	hypothetical protein	Q9ZXC9	Bacillus_phage	3.6e-16	50.0
WP_009329269.1\|1437128_1437398_+	hypothetical protein	NA	NA	NA	NA
WP_009329267.1\|1437463_1438021_+	hypothetical protein	Q9ZXC8	Bacillus_phage	4.9e-71	73.0
WP_009329265.1\|1438024_1438957_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	2.7e-151	87.8
WP_009329263.1\|1438956_1439394_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	8.2e-74	90.3
WP_075218358.1\|1439454_1441872_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	84.7
WP_009329257.1\|1442247_1442619_+	hypothetical protein	NA	NA	NA	NA
WP_009329255.1\|1442596_1443034_+	hypothetical protein	Q9ZXC3	Bacillus_phage	2.5e-62	76.6
WP_009329253.1\|1443030_1443570_+	hypothetical protein	Q9ZXC2	Bacillus_phage	5.9e-90	91.1
WP_009329251.1\|1443566_1443737_+	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	1.1e-07	54.7
WP_009329249.1\|1443739_1444255_+	hypothetical protein	D6R425	Bacillus_phage	1.1e-82	83.6
WP_009329247.1\|1444270_1444666_+	hypothetical protein	R4JMS5	Bacillus_phage	3.3e-29	89.2
WP_009329245.1\|1444662_1444935_+	DUF5052 family protein	F8WQ63	Bacillus_phage	2.9e-29	71.4
WP_009329244.1\|1445061_1445442_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	8.8e-48	82.9
WP_003185368.1\|1446191_1446416_+\|coat	spore coat protein	NA	NA	NA	NA
WP_073461324.1\|1446610_1446823_+	hypothetical protein	NA	NA	NA	NA
WP_009329242.1\|1446901_1447540_+	hypothetical protein	NA	NA	NA	NA
WP_009330415.1\|1447699_1448074_+	HNH endonuclease	Q38456	Bacillus_phage	2.6e-60	80.6
WP_009330377.1\|1448455_1448989_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	2.8e-68	80.2
WP_009330392.1\|1450883_1452128_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.4e-206	83.4
WP_025807960.1\|1452117_1452747_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	6.0e-94	81.8
WP_017475036.1\|1452787_1454104_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	7.9e-96	50.0
WP_009329208.1\|1454129_1454579_+	collagen-like protein	D6R3Z0	Bacillus_phage	4.0e-15	53.3
WP_009329207.1\|1454594_1454945_+\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	1.3e-32	60.0
WP_009329206.1\|1454874_1455249_+\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	1.2e-36	63.9
WP_009329205.1\|1455241_1455625_+	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	4.1e-45	70.9
WP_009329204.1\|1455621_1456002_+	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	3.0e-32	55.6
WP_009329203.1\|1456001_1456610_+\|tail	major tail protein	Q9ZXE9	Bacillus_phage	8.2e-56	54.6
WP_009329202.1\|1456670_1457006_+	hypothetical protein	Q9ZXE8	Bacillus_phage	5.0e-31	58.9
WP_025807965.1\|1457203_1461094_+\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	62.7
WP_009330398.1\|1461093_1461930_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	2.0e-113	71.8
WP_069500674.1\|1461942_1463652_+	alkaline phosphatase	D6R400	Bacillus_phage	6.6e-220	69.4
WP_139308922.1\|1463688_1465734_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-46	31.5
WP_003185328.1\|1465754_1467092_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	5.5e-113	68.7
WP_003185326.1\|1467104_1467428_+	bZIP transcription factor	M4ZR44	Bacillus_phage	2.0e-13	47.4
WP_003185324.1\|1467424_1467610_+	XkdX family protein	NA	NA	NA	NA
WP_009327757.1\|1467672_1467942_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	2.1e-24	61.8
WP_009327758.1\|1467957_1468221_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	7.9e-32	75.9
WP_009327759.1\|1468273_1469353_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	2.5e-47	57.3
WP_009327760.1\|1469510_1470098_+	hypothetical protein	NA	NA	NA	NA
WP_009327761.1\|1470130_1470361_-	hypothetical protein	NA	NA	NA	NA
WP_009327763.1\|1470869_1471115_+	helix-turn-helix domain-containing protein	A0A2H4JDR0	uncultured_Caudovirales_phage	1.7e-23	67.5
WP_034291696.1\|1471139_1471460_-	YolD-like family protein	O64030	Bacillus_phage	5.0e-12	37.3
WP_009327765.1\|1471597_1472410_-	hypothetical protein	NA	NA	NA	NA
WP_003184042.1\|1473009_1474020_+	rod shape-determining protein	NA	NA	NA	NA
WP_003184040.1\|1474050_1474959_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003184039.1\|1474955_1475474_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_011198163.1\|1475529_1476210_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_003184035.1\|1476212_1477019_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_061578553.1\|1477063_1477384_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003184032.1\|1477383_1477812_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_094023894.1\|1477957_1478749_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_003184028.1\|1478741_1479608_+	stage IV sporulation protein FB	NA	NA	NA	NA
WP_003184027.1\|1479764_1480073_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_003184025.1\|1480085_1480427_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003184023.1\|1480439_1480721_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_003184022.1\|1480946_1481525_+	sporulation protein	NA	NA	NA	NA
WP_003184021.1\|1481557_1482844_+	GTPase ObgE	NA	NA	NA	NA
WP_003184018.1\|1482957_1483401_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003184017.1\|1483409_1484279_+	prephenate dehydratase	NA	NA	NA	NA
WP_003184015.1\|1484322_1484865_-	transcription repressor NadR	NA	NA	NA	NA
WP_009327768.1\|1484833_1486012_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	1.2e-31	25.3
WP_003184010.1\|1486112_1487687_+	L-aspartate oxidase	NA	NA	NA	NA
WP_009327769.1\|1487667_1488507_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_016885542.1\|1488528_1489638_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_016885541.1\|1489753_1490806_+\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_003183995.1\|1491735_1492458_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003183994.1\|1492605_1492932_+	hypothetical protein	NA	NA	NA	NA
WP_003183993.1\|1493023_1493203_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-21	76.3
WP_003183992.1\|1493616_1494327_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.0e-49	55.9
WP_003183991.1\|1494387_1494852_+	DNA damage-inducible protein DinB	NA	NA	NA	NA
WP_003183990.1\|1494947_1495127_+	small acid-soluble spore protein H	NA	NA	NA	NA
WP_003183988.1\|1495404_1496055_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_003183987.1\|1496297_1496819_+	intercompartmental signaling factor BofC	NA	NA	NA	NA
WP_003183986.1\|1496941_1497547_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003183985.1\|1497556_1498561_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.2e-06	30.3
WP_003183984.1\|1498553_1498754_+	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_069500660.1\|1498794_1499823_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003183980.1\|1499851_1500997_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	5.5e-85	43.2

DBSCAN-SWA_4

1877866 : 1890047

Staphylococcus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003183133.1\|1877866_1878304_+	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	5.4e-17	44.6
WP_009327959.1\|1878535_1879666_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.4e-77	43.3
WP_003183128.1\|1879655_1879961_+	hypothetical protein	NA	NA	NA	NA
WP_003183127.1\|1880119_1880557_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_075218375.1\|1880683_1882870_+	AAA family ATPase	A0A220BYT7	Staphylococcus_phage	1.9e-150	41.3
WP_003183123.1\|1883132_1883477_+	hypothetical protein	NA	NA	NA	NA
WP_011198083.1\|1883837_1884926_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-64	38.1
WP_075218376.1\|1884937_1885585_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.4e-39	41.5
WP_025808100.1\|1885606_1886803_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.7e-116	53.9
WP_003183115.1\|1886837_1887302_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-45	70.7
WP_003183113.1\|1887403_1887778_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003183111.1\|1887788_1888310_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003183108.1\|1888430_1888526_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009327962.1\|1888708_1889464_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-07	23.6
WP_003183104.1\|1889453_1890047_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-14	37.6

DBSCAN-SWA_5

2749282 : 2797340

uncultured_Caudovirales_phage(29.03%)

protease,integrase,portal,tail,plate,holin

attL 2782980:2782997|attR 2799175:2799192

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003181196.1\|2749282_2750428_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	3.6e-44	33.6
WP_021837439.1\|2750754_2751003_-	hypothetical protein	NA	NA	NA	NA
WP_021837438.1\|2751294_2751855_-	hypothetical protein	NA	NA	NA	NA
WP_021837437.1\|2751862_2752132_-	hypothetical protein	U5PSW1	Bacillus_phage	4.3e-09	72.5
WP_003181194.1\|2752374_2752605_-\|holin	phage holin	A0A1D6Z272	Staphylococcus_phage	1.1e-18	59.2
WP_003181192.1\|2752625_2753618_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	8.1e-69	72.4
WP_003181190.1\|2753684_2753948_-\|holin	holin	NA	NA	NA	NA
WP_003181188.1\|2753951_2754146_-	XkdX family protein	NA	NA	NA	NA
WP_003181186.1\|2754146_2754440_-	hypothetical protein	M4ZR44	Bacillus_phage	1.0e-40	79.2
WP_003181185.1\|2754455_2755679_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	6.0e-130	61.1
WP_003181184.1\|2757286_2758657_-	endopeptidase	A6M966	Geobacillus_virus	6.6e-45	35.5
WP_003181183.1\|2758667_2759510_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.4e-61	44.6
WP_003181182.1\|2759527_2761981_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	7.1e-74	40.9
WP_051503409.1\|2762125_2762533_-	HNH endonuclease	A0A1X9SG40	Bacillus_phage	4.7e-23	53.3
WP_003181177.1\|2763514_2763883_-	hypothetical protein	NA	NA	NA	NA
WP_003181175.1\|2763940_2764486_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	6.2e-55	63.0
WP_003181173.1\|2764524_2764899_-	hypothetical protein	NA	NA	NA	NA
WP_003181172.1\|2764902_2765313_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	1.1e-30	54.4
WP_003181170.1\|2765309_2765648_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	1.9e-17	43.8
WP_003181168.1\|2765648_2766035_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	1.9e-26	48.8
WP_125150312.1\|2766049_2766262_-	hypothetical protein	NA	NA	NA	NA
WP_003181166.1\|2766316_2767408_-	hypothetical protein	A0A2H4J2M3	uncultured_Caudovirales_phage	1.3e-128	66.6
WP_021837431.1\|2767461_2768193_-	OmpH family outer membrane protein	A0A2H4IZP8	uncultured_Caudovirales_phage	2.1e-26	59.5
WP_111327956.1\|2768307_2768682_-	hypothetical protein	NA	NA	NA	NA
WP_021837429.1\|2768858_2769683_-	type IV secretion protein Rhs	A0A0N9SJR1	Paenibacillus_phage	1.8e-77	54.2
WP_003181162.1\|2769682_2771290_-\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	8.9e-166	58.0
WP_003181160.1\|2771292_2771721_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	6.4e-31	52.2
WP_021837428.1\|2771736_2773491_-	hypothetical protein	A0A2H4J484	uncultured_Caudovirales_phage	4.0e-252	72.6
WP_003181154.1\|2773596_2774142_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	8.5e-28	44.1
WP_003181152.1\|2774138_2774363_-	hypothetical protein	NA	NA	NA	NA
WP_003181149.1\|2774498_2774786_-	hypothetical protein	A6MAI4	Lactococcus_virus	2.8e-22	59.8
WP_021837427.1\|2774902_2775175_-	hypothetical protein	NA	NA	NA	NA
WP_021837426.1\|2775198_2775345_-	hypothetical protein	A0A2H4J4P7	uncultured_Caudovirales_phage	3.1e-09	68.1
WP_025808393.1\|2775341_2775536_-	hypothetical protein	NA	NA	NA	NA
WP_003181147.1\|2777064_2777253_-	hypothetical protein	NA	NA	NA	NA
WP_025808391.1\|2777291_2777564_-	hypothetical protein	NA	NA	NA	NA
WP_003181143.1\|2777594_2777930_-	hypothetical protein	NA	NA	NA	NA
WP_003181141.1\|2777997_2778369_-	DUF134 domain-containing protein	A0A0N9RZI0	Paenibacillus_phage	1.5e-15	44.1
WP_111327957.1\|2778471_2778648_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025808385.1\|2780009_2780405_-	hypothetical protein	NA	NA	NA	NA
WP_025808384.1\|2780391_2780739_-	hypothetical protein	NA	NA	NA	NA
WP_021837419.1\|2780735_2780933_-	hypothetical protein	NA	NA	NA	NA
WP_021837418.1\|2780929_2781268_-	hypothetical protein	NA	NA	NA	NA
WP_025808382.1\|2781264_2781615_-	hypothetical protein	NA	NA	NA	NA
WP_031314606.1\|2781800_2781986_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021837415.1\|2782295_2783819_+	hypothetical protein	NA	NA	NA	NA
2782980:2782997	attL	NA	NA	NA	NA
WP_003181131.1\|2783830_2784193_+	hypothetical protein	NA	NA	NA	NA
WP_003181130.1\|2784427_2784646_-	helix-turn-helix transcriptional regulator	D0R7I7	Paenibacillus_phage	5.6e-07	65.7
WP_003181127.1\|2785116_2785317_+	hypothetical protein	NA	NA	NA	NA
WP_003181125.1\|2785309_2785642_+	hypothetical protein	NA	NA	NA	NA
WP_025808379.1\|2785714_2785897_+	hypothetical protein	NA	NA	NA	NA
WP_003181120.1\|2786221_2786395_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	4.0e-24	89.1
WP_003181118.1\|2786426_2786741_-	DUF1433 domain-containing protein	NA	NA	NA	NA
WP_003181116.1\|2786798_2788238_+	lipase	NA	NA	NA	NA
WP_011197895.1\|2788249_2788582_+	hypothetical protein	NA	NA	NA	NA
WP_080574625.1\|2788730_2788946_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_003181109.1\|2788990_2789707_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_075218307.1\|2789715_2790774_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	1.2e-25	25.8
WP_009328607.1\|2791378_2791876_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	6.1e-57	74.1
WP_003181103.1\|2791897_2792629_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	9.6e-59	48.0
WP_003181100.1\|2792621_2793062_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003181098.1\|2793064_2793724_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	6.6e-67	59.9
WP_003181096.1\|2793988_2795023_-	hypothetical protein	NA	NA	NA	NA
WP_071583722.1\|2795243_2797340_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	2.6e-125	40.4
2799175:2799192	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2908511 : 2975771

Bacillus_phage(27.78%)

terminase,tail,portal,plate,holin,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003180861.1\|2908511_2909576_-	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	1.1e-44	50.8
WP_003180859.1\|2909626_2909890_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.3e-28	67.8
WP_003180856.1\|2909904_2910174_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	64.0
WP_003180853.1\|2910276_2911308_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.0e-18	48.2
WP_003180851.1\|2911345_2912551_-	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	9.3e-27	48.3
WP_003180850.1\|2912566_2912953_-	hypothetical protein	NA	NA	NA	NA
WP_009328731.1\|2912966_2913887_-	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	5.0e-12	28.3
WP_009328732.1\|2913873_2914917_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.7e-73	44.3
WP_003180844.1\|2914909_2915335_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	5.4e-14	39.0
WP_003180843.1\|2915353_2915662_-	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.0e-06	37.3
WP_009328734.1\|2915658_2916639_-	hypothetical protein	H7BV96	unidentified_phage	9.2e-41	32.3
WP_003180838.1\|2916695_2917352_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	4.0e-24	32.6
WP_061565950.1\|2917344_2921127_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.7e-42	45.3
WP_003180833.1\|2921130_2921268_-	hypothetical protein	NA	NA	NA	NA
WP_003180832.1\|2921309_2921759_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
WP_003180830.1\|2921941_2922385_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.1e-24	44.7
WP_011197804.1\|2922386_2923733_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	1.5e-78	40.2
WP_003180826.1\|2923732_2923957_-	hypothetical protein	NA	NA	NA	NA
WP_003180824.1\|2923957_2924398_-	hypothetical protein	NA	NA	NA	NA
WP_003180822.1\|2924410_2924899_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.9e-34	44.6
WP_009328738.1\|2924895_2925252_-	YqbH/XkdH family protein	NA	NA	NA	NA
WP_011201613.1\|2925248_2925629_-	DUF3199 family protein	NA	NA	NA	NA
WP_009328739.1\|2925716_2926652_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	1.1e-102	64.1
WP_009328740.1\|2926669_2927518_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-57	62.8
WP_003180808.1\|2927525_2929040_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.4e-143	55.5
WP_025808348.1\|2929043_2930342_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	1.2e-149	60.2
WP_003180804.1\|2930338_2931139_-\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	5.7e-65	51.4
WP_003180803.1\|2931281_2931785_-	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	1.4e-21	38.7
WP_003180800.1\|2931905_2932109_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.9e-12	54.7
WP_003180798.1\|2932105_2932447_-	hypothetical protein	NA	NA	NA	NA
WP_011197802.1\|2932717_2933518_-	ATP-binding protein	A6XMI1	Bacillus_virus	3.6e-59	48.1
WP_003180792.1\|2933417_2934248_-	hypothetical protein	S6BFM4	Thermus_phage	1.3e-27	31.0
WP_003180790.1\|2934248_2934545_-	hypothetical protein	NA	NA	NA	NA
WP_021837294.1\|2934534_2934795_-	helix-turn-helix transcriptional regulator	S5MA07	Brevibacillus_phage	2.3e-07	41.2
WP_003180787.1\|2934967_2935321_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.7e-19	49.6
WP_016885893.1\|2935509_2936166_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.1e-40	49.7
WP_071583829.1\|2936179_2936827_-	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	1.2e-44	47.0
WP_003180781.1\|2939100_2939583_+	DUF600 family protein	NA	NA	NA	NA
WP_003180779.1\|2939957_2940371_+	hypothetical protein	NA	NA	NA	NA
WP_003180778.1\|2940399_2940735_+	hypothetical protein	NA	NA	NA	NA
WP_003180775.1\|2940747_2941326_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_069500407.1\|2941341_2942766_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	5.1e-16	24.6
WP_003180772.1\|2942821_2943556_-	LysM peptidoglycan-binding domain-containing protein	A0A217ER34	Bacillus_phage	4.2e-30	60.8
WP_003180770.1\|2944008_2944557_+	hypothetical protein	NA	NA	NA	NA
WP_003180768.1\|2944600_2944978_-	glyoxalase	NA	NA	NA	NA
WP_003180767.1\|2945025_2945898_-	DMT family transporter	NA	NA	NA	NA
WP_003180765.1\|2945989_2946877_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003180762.1\|2946934_2948653_-	assimilatory sulfite reductase (NADPH) hemoprotein subunit	NA	NA	NA	NA
WP_003180760.1\|2948680_2950510_-	assimilatory sulfite reductase (NADPH) flavoprotein subunit	NA	NA	NA	NA
WP_003180759.1\|2950830_2951721_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016885896.1\|2951928_2952216_+	hypothetical protein	NA	NA	NA	NA
WP_003180754.1\|2952307_2952886_-	maltose O-acetyltransferase	NA	NA	NA	NA
WP_003180752.1\|2952919_2953099_-	hypothetical protein	NA	NA	NA	NA
WP_016885898.1\|2953537_2953621_+	hypothetical protein	NA	NA	NA	NA
WP_025808333.1\|2954223_2955210_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_155266214.1\|2955291_2955453_-	hypothetical protein	NA	NA	NA	NA
WP_009328774.1\|2957050_2957335_-	hypothetical protein	NA	NA	NA	NA
WP_009328776.1\|2957324_2957894_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011197789.1\|2958066_2959257_+	DUF819 domain-containing protein	NA	NA	NA	NA
WP_009328782.1\|2959302_2960478_-	cystathionine beta-lyase	A0A0B5JD48	Pandoravirus	6.7e-22	29.3
WP_009328785.1\|2960467_2961592_-	methionine biosynthesis PLP-dependent protein	A0A0B5JD48	Pandoravirus	5.3e-16	25.6
WP_009328787.1\|2961900_2962848_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_011197787.1\|2962928_2963417_+	DNA damage-inducible protein DinB	NA	NA	NA	NA
WP_011197786.1\|2963610_2963943_+	hypothetical protein	NA	NA	NA	NA
WP_009328793.1\|2963933_2964656_+	esterase family protein	NA	NA	NA	NA
WP_009328796.1\|2964720_2965230_+	hypothetical protein	NA	NA	NA	NA
WP_009328797.1\|2965239_2965659_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011197785.1\|2965823_2966219_+	GtrA family protein	NA	NA	NA	NA
WP_009328799.1\|2966241_2967132_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-84	55.6
WP_061576213.1\|2967128_2968115_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.1e-53	38.4
WP_009328801.1\|2968210_2968798_+	DedA family protein	NA	NA	NA	NA
WP_009328802.1\|2968837_2969095_-	hypothetical protein	NA	NA	NA	NA
WP_071583758.1\|2969216_2971499_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	3.9e-90	35.4
WP_009328805.1\|2971537_2971795_-	sporulation protein	NA	NA	NA	NA
WP_071583757.1\|2971924_2972056_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009328806.1\|2972135_2972345_-	hypothetical protein	NA	NA	NA	NA
WP_011197779.1\|2972631_2972988_-	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_009328807.1\|2973134_2973521_+\|coat	spore coat protein	NA	NA	NA	NA
WP_009328808.1\|2973569_2973968_+	hypothetical protein	NA	NA	NA	NA
WP_009328809.1\|2974038_2974551_+\|coat	spore coat protein	NA	NA	NA	NA
WP_011197778.1\|2974682_2975171_+\|coat	spore coat protein	NA	NA	NA	NA
WP_009328811.1\|2975321_2975771_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_7

3542578 : 3550967

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003179538.1\|3542578_3543166_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.4e-28	41.1
WP_011197613.1\|3543162_3544203_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
WP_016886478.1\|3544326_3545757_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.4e-52	32.9
WP_009329142.1\|3545732_3547961_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.2e-158	41.5
WP_003179533.1\|3547944_3548628_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_016886477.1\|3548624_3548879_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_016886476.1\|3548880_3549597_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.4e-46	42.4
WP_003179530.1\|3549671_3550967_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1

DBSCAN-SWA_8

3565674 : 3594899

Enterococcus_phage(44.0%)

head,terminase,integrase,portal

attL 3564560:3564578|attR 3593995:3594013

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3564560:3564578	attL	NA	NA	NA	NA
WP_146842148.1\|3565674_3567708_-	hypothetical protein	M1IFB6	Streptococcus_phage	6.6e-57	63.8
WP_094023914.1\|3568685_3569336_-	hypothetical protein	NA	NA	NA	NA
WP_094023915.1\|3569335_3572590_-	hypothetical protein	D2J070	Enterococcus_phage	1.8e-80	57.5
WP_146842145.1\|3572591_3572840_-	peptide methionine sulfoxide reductase	NA	NA	NA	NA
WP_094023917.1\|3572905_3573319_-	hypothetical protein	D2J068	Enterococcus_phage	1.1e-32	53.8
WP_094023918.1\|3573335_3573962_-	hypothetical protein	D2J067	Enterococcus_phage	5.0e-48	52.3
WP_094023920.1\|3574334_3574766_-	hypothetical protein	D2J065	Enterococcus_phage	3.2e-38	54.3
WP_094023921.1\|3574758_3575091_-\|head	phage head closure protein	D2J064	Enterococcus_phage	1.3e-31	62.5
WP_094023922.1\|3575081_3575615_-	hypothetical protein	D2J063	Enterococcus_phage	3.4e-45	52.2
WP_094023923.1\|3575652_3575898_-	hypothetical protein	A0A1S5SAN9	Streptococcus_phage	5.9e-05	36.7
WP_094023924.1\|3575911_3576832_-	hypothetical protein	A0A1S5SAH3	Streptococcus_phage	8.8e-94	57.3
WP_157675226.1\|3576850_3577423_-	scaffolding protein	D2J060	Enterococcus_phage	5.2e-20	34.7
WP_094023926.1\|3577631_3577811_-	hypothetical protein	NA	NA	NA	NA
WP_157675228.1\|3577867_3578032_-	hypothetical protein	NA	NA	NA	NA
WP_094023927.1\|3578038_3579730_-	hypothetical protein	D2J057	Enterococcus_phage	2.1e-77	45.5
WP_094023928.1\|3579704_3581189_-\|portal	phage portal protein	D2J056	Enterococcus_phage	6.3e-166	60.0
WP_094023929.1\|3581201_3582413_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.3e-158	65.3
WP_094023930.1\|3582399_3583233_-\|terminase	terminase small subunit	Q5YA77	Bacillus_phage	7.3e-47	45.8
WP_094023931.1\|3583380_3583803_-	hypothetical protein	A0A141VTT8	Staphylococcus_phage	7.8e-13	32.6
WP_146842146.1\|3583815_3584019_-	hypothetical protein	NA	NA	NA	NA
WP_094023933.1\|3584030_3584456_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157675230.1\|3584483_3584654_-	hypothetical protein	NA	NA	NA	NA
WP_094023934.1\|3584665_3584866_-	hypothetical protein	A0A1P8BMQ1	Lactococcus_phage	5.1e-23	77.3
WP_094023935.1\|3584862_3585108_-	hypothetical protein	NA	NA	NA	NA
WP_094023936.1\|3585104_3585323_-	hypothetical protein	NA	NA	NA	NA
WP_094023937.1\|3585336_3585828_-	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	3.7e-38	49.7
WP_094023938.1\|3585850_3586156_-	hypothetical protein	NA	NA	NA	NA
WP_094023939.1\|3586209_3587043_-	ATP-binding protein	F0PII2	Enterococcus_phage	1.1e-45	37.7
WP_094023940.1\|3587011_3587788_-	helix-turn-helix domain-containing protein	A0A0D4DCE1	Staphylococcus_phage	6.9e-23	60.0
WP_094023941.1\|3588161_3588824_-	hypothetical protein	A0A0P0IZA2	Lactobacillus_phage	7.4e-34	38.1
WP_157675232.1\|3588836_3589778_-	DUF1351 domain-containing protein	NA	NA	NA	NA
WP_094023943.1\|3589789_3590566_-	ERF family protein	A0A2H4J439	uncultured_Caudovirales_phage	1.7e-21	41.9
WP_157675234.1\|3590664_3590808_-	hypothetical protein	NA	NA	NA	NA
WP_094023944.1\|3590878_3591058_-	transcriptional regulator	Q8SBM7	Clostridium_phage	2.9e-09	61.2
WP_094023945.1\|3591094_3591298_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094023946.1\|3591459_3592077_+	LexA family transcriptional regulator	Q4ZB06	Staphylococcus_virus	6.9e-18	33.0
WP_094023947.1\|3592203_3593328_+\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	8.0e-97	49.6
WP_003179516.1\|3593357_3594899_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	4.0e-22	31.6
3593995:3594013	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022477

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection