CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022530	Bacterioplanes sanyensis strain NV9 chromosome, complete genome	1 crisprs	cas3,csa3,WYL,DEDDh,DinG	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022530_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022530_1

1953031-1953185

Orphan

Consensus_repeat	Method
AGCCGGAACCTAAGCCAGAGCCA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP022530_1

>merge|NZ_CP022530|1|1953031-1953185|CRISPRCasFinder
AGCCCGAGCCAGTTCCTGAGCCAACTCCAGAGCCTGAGCCGACTCCTAAACCGGAGCCGAAGCCAGAGCCGGCCCCTGAGCCAGAACCTAAGCCAGAACCTAAGCCAGAGCCACAGCCGGAACCTAAGCCAGAGCCAGAGCCAGAGCCAGAGCCG

>NZ_CP022530|1|1|1953031-1953185|CRISPRCasFinder
AGCCCGAGCCAGTTCCTGAGCCA	ACTCCAGAGCCTGAGCCGACTCCTA
AACCGGAGCCGAAGCCAGAGCCG	GCCCCTGAGCCAGAACCTA
AGCCAGAACCTAAGCCAGAGCCA	CAGCCGGAACCTAAGCCAG
AGCCAGAGCCAGAGCCAGAGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022530.1\|WP_094060044.1\|1959193_1960423_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP022530.1\|WP_157729856.1\|1963252_1963807_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP022530.1\|WP_094060045.1\|1960609_1962193_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP022530.1\|WP_094060048.1\|1963908_1965546_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP022530.1\|WP_094060035.1\|1945256_1947101_+\|DUF885-domain-containing-protein	unknown	unknown	gnl\|CDD\|377577
NZ_CP022530.1\|WP_094060031.1\|1942205_1942571_+\|DUF4266-domain-containing-protein	unknown	unknown	gnl\|CDD\|379460
NZ_CP022530.1\|WP_094060041.1\|1956615_1957041_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022530.1\|WP_094060037.1\|1947931_1948489_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153229
NZ_CP022530.1\|WP_094060050.1\|1966878_1967736_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP022530.1\|WP_094060043.1\|1958058_1958928_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP022530.1\|WP_094060036.1\|1947137_1947926_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270422
NZ_CP022530.1\|WP_094060034.1\|1944366_1944888_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022530.1\|WP_094060032.1\|1942557_1943790_+\|DUF3570-domain-containing-protein	unknown	unknown	gnl\|CDD\|378811
NZ_CP022530.1\|WP_094060038.1\|1948587_1950354_-\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|214510
NZ_CP022530.1\|WP_094060042.1\|1957155_1957947_-\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_CP022530.1\|WP_094060030.1\|1941735_1942209_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP022530.1\|WP_157729857.1\|1965863_1966631_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366132
NZ_CP022530.1\|WP_094060033.1\|1943944_1944298_+\|DUF805-domain-containing-protein	unknown	unknown	gnl\|CDD\|377540
NZ_CP022530.1\|WP_157729855.1\|1962275_1963073_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|139237
NZ_CP022530.1\|WP_157729853.1\|1950481_1951879_-\|N-acetylglucosamine-binding-protein-GbpA	unknown	unknown	gnl\|CDD\|237309

Protein	Function_ID	Function_description	E-value
NZ_CP022530.1\|WP_094060044.1\|1959193_1960423_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.43818e-65
NZ_CP022530.1\|WP_157729856.1\|1963252_1963807_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	4.03428e-25
NZ_CP022530.1\|WP_094060045.1\|1960609_1962193_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	4.79126e-47
NZ_CP022530.1\|WP_094060048.1\|1963908_1965546_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.69384e-73
NZ_CP022530.1\|WP_094060035.1\|1945256_1947101_+\|DUF885-domain-containing-protein	gnl\|CDD\|377577	pfam05960, DUF885, Bacterial protein of unknown function (DUF885). This family consists of several hypothetical bacterial proteins several of which are putative membrane proteins.	0
NZ_CP022530.1\|WP_094060031.1\|1942205_1942571_+\|DUF4266-domain-containing-protein	gnl\|CDD\|379460	pfam14086, DUF4266, Domain of unknown function (DUF4266). This presumed lipoprotein domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 50 amino acids in length.	6.81096e-18
NZ_CP022530.1\|WP_094060037.1\|1947931_1948489_-\|hypothetical-protein	gnl\|CDD\|153229	cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons. DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly conserved cysteine located at the nucelophile elbow region typical of these domains. This cysteine been proposed to be a site of regulation of DJ-1 activity by oxidation. DJ-1 is a dimeric enzyme.	5.6648e-63
NZ_CP022530.1\|WP_094060050.1\|1966878_1967736_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.11464e-15
NZ_CP022530.1\|WP_094060043.1\|1958058_1958928_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.58157e-57
NZ_CP022530.1\|WP_094060036.1\|1947137_1947926_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270422	cd13704, PBP2_HisK, The periplasmic sensor domain of histidine kinase receptors; the type 2 periplasmic binding fold protein. This subfamily includes the periplasmic sensor domain of the histidine kinase receptors (HisK) which are elements of the two-component signal transduction systems commonly found in bacteria and lower eukaryotes. Typically, the two-component system consists of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. The two-component systems serve as a stimulus-response coupling mechanism to enable microorganisms to sense and respond to changes in environmental conditions. Extracellular stimuli such as small molecule ligands and ions are detected by the N-terminal periplasmic sensing domain of the sensor kinase receptor, which regulate the catalytic activity of the cytoplasmic kinase domain and promote ATP-dependent autophosphorylation of a conserved histidine residue. The phosphate is then transferred to a conserved aspartate in the response regulator through a phospho-transfer mechanism, and the activity of the response regulator is in turn regulated. The sensor domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space through their function as an initial high-affinity binding component. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.87975e-23
NZ_CP022530.1\|WP_094060032.1\|1942557_1943790_+\|DUF3570-domain-containing-protein	gnl\|CDD\|378811	pfam12094, DUF3570, Protein of unknown function (DUF3570). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 396 to 444 amino acids in length.	9.05972e-47
NZ_CP022530.1\|WP_094060038.1\|1948587_1950354_-\|PKD-domain-containing-protein	gnl\|CDD\|214510	smart00089, PKD, Repeats in polycystic kidney disease 1 (PKD1) and other proteins. Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.	1.05164e-13
NZ_CP022530.1\|WP_094060042.1\|1957155_1957947_-\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	1.83071e-83
NZ_CP022530.1\|WP_094060030.1\|1941735_1942209_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.07113e-20
NZ_CP022530.1\|WP_157729857.1\|1965863_1966631_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|366132	pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3.	6.68153e-17
NZ_CP022530.1\|WP_094060033.1\|1943944_1944298_+\|DUF805-domain-containing-protein	gnl\|CDD\|377540	pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function.	1.96526e-35
NZ_CP022530.1\|WP_157729855.1\|1962275_1963073_-\|hypothetical-protein	gnl\|CDD\|139237	PRK12802, PRK12802, flagellin; Provisional.	3.35428e-40
NZ_CP022530.1\|WP_157729853.1\|1950481_1951879_-\|N-acetylglucosamine-binding-protein-GbpA	gnl\|CDD\|237309	PRK13211, PRK13211, N-acetylglucosamine-binding protein GbpA.	3.51057e-165

>NZ_CP022530.1|WP_157729853.1|1950481_1951879_-|N-acetylglucosamine-binding-protein-GbpA
MTARSRHWLSSISAGSAIFLSIFSSNNIFAHGYISEPVSRSKLCATGVNSNCGAIQWEPQSVEGPDRYPLTGPKDGEIASGGNAGFSPLNVQTSSRWSKTAISGGPIDVEWTFTAPHVSRDFRYFITKPGWNPNEPLTRQSFSPDPFCSHDGKQQRPANPLRHSCYLPENLSGYHVMLGVWDVGDTVNSFYQVVDLNILKGEQPQWRDIGDIPPGRQVLAGDTVTLHLFDQQQQVKTHAWEFSGQGNWSESFAEWINRSNLGVLAGVLDGQGNITPVTGLNDIFVANASSLQRAEISVQSDEPVSIDLSLNNLQRQYLLSSDSLTLDLDLTSQAELQLDVSIYHAQQLVARSSAALNQQLSLPMTLKTPLPGDYQLIIVASDSNSSRQFSYDFSIALANTDYDYVYPAQHEQYKAGDRVRGKDGRIYQCKPFPYAGWCRIYQAADPAYAPGVGRAWQDAWVLISQ
>NZ_CP022530.1|WP_094060038.1|1948587_1950354_-|PKD-domain-containing-protein
MMKRTTWISAAVMALGLSGVSTVHATEALHPQWVKVAQEHEFSADYQWESGWNNSGSHTLTIDRAGASFIKVHFDQFQLPAGMTLVVSNSDGSEQYRYAGHQPSSMQKATHASSGGFAAMSVSADRVHIRVEGTPTGNDSASVSIGHLQQGFSELELSSGPDMSIMSTCGIMERRDVMCWANSHPTEFERSRPTAKLLFGGGVCTAWRVGEGNRVMTNNHCISSANDVANAEVWFNYQHTDCNGNSLATVTKVTGAQLLATDYELDFTLFTVNNFEQIQSFGHYGLDVREPVLGEGIFIPQHGAGNPKELSIESDKNSSGQCEIDVAVTGGRGSNTDTGYLCDTIGGSSGSPVLADSSNKVIALHHFGGCPNQGVLIDRIWPKISTFFDGIPDNDGGDGGQQAPIANFSVATEKLTAVFNNQSSDRDGTIESYAWDFGDGNTATDANPRHTYAMAGDYDVSLTVTDNDGLTDTSQQRITVQEDDGIPLLNPGETVSDLALQRGEWLMYKVKLPAAASNLSVRMSGGYGDADLYLRAAQQPDRDNYDCRPYSSGNNEACDVASPTAEYYYVGIRAFRSFSGVSLLMTHQ
>NZ_CP022530.1|WP_094060037.1|1947931_1948489_-|hypothetical-protein
MANVVVFIAHGTEEIEALTCIDVCRRAGIDTTIAAVGDELQVKAAHGVTLTADCLAADCVNQTWDAVILPGGMPGAQNLADSPAVSSVLAEQHRQQKWIAAICAAPAVVLAGQQLLSGRRATCYPGFEEALLESATMCVTEPIIVDGHFITSRGPATAMVFALRVVAAVAGDEAARAIAKDLLLA
>NZ_CP022530.1|WP_094060036.1|1947137_1947926_-|transporter-substrate-binding-domain-containing-protein
MTTQTRIQRIFATLLTLLALTAHSEDKQVSIAVGSWPPFLSQEQQHDGYVAHLIRDVFESQGYQVSIQFMPWERAYREAAAGQHDATAVWMDKEERRLDFWYSDPVLSETFVFFHRSSEPFDWQNYSDLSDLTLGGGISYSYGEAMDQAIQDGTITLQRVSTTLQNFNRLAAGYIDAFPEEMSVGYFNLRQLPHVYDEIRHHSKPILQNNSFVLFPRGEAKSQQLRKDFNQGLQKFRDSGRYQNYYNNFNAGRYDLKPNSGQ
>NZ_CP022530.1|WP_094060035.1|1945256_1947101_+|DUF885-domain-containing-protein
MKRLLKWTGAVSLSAVVLASGFAAHEWYAEKPVYLNNFLNRELLKEALTEPQNLTSLGFLETVGIDGHNAKLNDLSPERRDEQHQRMIAGREVLLQYDDAALTEQERLSKAIALYLLDQQIDGYRFRFHDYPVNQLFGVQNWFPSFMDSQHQVTDLTSVEHYLARLGAVELQFQQLLKGLQQREQRGVLPPRFVVDRVLDEMSGFVNTPAKDNILYTSLAKRLAESEVATSQHEELLAATEVAIQSQVYPAYQGLIDYFTAVRPNTSSDDGVWKLPDGDDYYRYQLRRQTTTELSPEAIHAMGLSEVARIQRQILDILQQQGVSDSDDFVIAIDALAQRSDQYYPDTAQGREQILQDYRDIITEIEDNLAGVFGRTPQAGVEVRRIPEFKEKTAPGAYYMHPSIDGSRPGRFFANLYDIKATPKYGMRTLAYHEAVPGHHFQIALAMEAEGIPFLRKASPFTAFTEGWALYAEYLAWEMGMQDQPFDNVGRLQAELFRAVRLVVDTGLHAKRWTREQAIDYMAANTGIAMSDVVSEIERYIVNPGQATAYKVGMMKILELREKAKQQLGEQFNLADFHDEMLRNGAMPMALLEGSVERYIAARASTGLPIASGE
>NZ_CP022530.1|WP_094060034.1|1944366_1944888_+|hypothetical-protein
MTDSQIVYKRNSVWWIATCYLLGTLFLLLAAVGGIVNAGIGGVKTLIEMSGEQEAQRYLAGTVSDQVQVSGFRVNTGQSVPILSAAIDNNSPYTISKIHLEVSLVDDAGIAIASETKWLSDLGSIFPGDRGQVQFPLSEQMAGKLGEYQLRIASFSILDNASLQAMCEQVPDS
>NZ_CP022530.1|WP_094060033.1|1943944_1944298_+|DUF805-domain-containing-protein
MNWYINALKNYFNFSDRARRKEYWMFVLFYIIFYAISAAIDFAVGASGIILMVYALAMLIPSISVGVRRLHDTNRSGWWMLISLVPLVGAIILLVFLVQDSRDEDNRYGDSPKLAAA
>NZ_CP022530.1|WP_094060032.1|1942557_1943790_+|DUF3570-domain-containing-protein
MAAISLSVRTATAWVLLFSMLLHTVCIAAGEWSYHALYYVESDDRVTVEDHVAAFKHSFGVDYDFSMDVGYDAISGASPTLRSNTAVLTQQDAQARQQQVALADEKSDKLILGFDPNADYRRQNVELEDIRRSVNASLLMRDALRNELTVGASFSKEEDYTSSSASVSQLWWADRRKNRSYSVGASVIYNESYVFTDGYADQYIDDNLMWDAEVSVSQVLSDKAHLSLSAYINHDRGYLSNHYQTIVRGIDLNNDQRIDRSEWLLAAEERPDQRTGGGVGALHVWQWNSGITSQLNYRYFDDDWGIASHTLNWALDIPVSDQLTVLPVMRVYQQQAAFFYKDADGSDIVFDGREYGSSDQRLGEYTAWHAQLGAQWRPWPQWRLDASAAFYQQSSDFDAYWLMLGGSYQY
>NZ_CP022530.1|WP_094060031.1|1942205_1942571_+|DUF4266-domain-containing-protein
MNAGVWLMLLLLLSTSAVADIRVVYVAPSDSPRLTAPTLPPLASMSLLENAQLPAPSGWSSYESWLGIEPVKPWQKAILAEPEMKPAGRLPAVAKFNQKVFASKENTRGGTGIGGGGCGCN
>NZ_CP022530.1|WP_094060030.1|1941735_1942209_+|TlpA-family-protein-disulfide-reductase
MMKHWLFTLLLSVLVSTQASALEVGEALPQDLHQELFGDADVVYVVDFFAQWCVSCRIELPEINQLFNQLKDNSQVRFVGVDVDEDVAVAEAFQRSLGLEFPIVNDTQGRVIGAFAPLGMPALYYVVNGQIKGRRLGAIPHIDDVIRSDIQQLGVSL
>NZ_CP022530.1|WP_094060041.1|1956615_1957041_+|hypothetical-protein
MKKTMLLAAAWLFSTSIMAVEIESNGWVFELPEQASEQSNSTARSAKSGKRPQPVLVPGTKVLERQRGEEGVIGNTLLVRTQGDIDAYLDSSASVTRIGESSFMLSYPQDTDMWAEKQRLERLDDVLEVEIEVITNRYRPM
>NZ_CP022530.1|WP_094060042.1|1957155_1957947_-|siderophore-interacting-protein
MVTTSLIARSQSSRFQPLTVRDNQRLSPNMRRLTLSGEVLEHWPEQSAGGYFKLCFEADGQPLQRQPAEGQRPLMRTYTIRRLDTSQQQLEVDVMLHGEHSHSGPASRWAAQVKPGSSIMIAGPGPSKLPTPAQHYLLVGDMTALPAISAHLENLPADVRGDAVIAVPDSDDQLTLQRPSGVNIHWLTGPQPDLLAKVQALSLPADLAVWVACEFDQMRAIRQFVRQQLQLPRQQTYLSSYWKAGRSEDEHKVLKQKDQANDG
>NZ_CP022530.1|WP_094060043.1|1958058_1958928_-|LysR-family-transcriptional-regulator
MDIRHLRYFKAVSDCGSFTRAAEQLHIAQPALSMAIRKLEAELELTLLHRRDRRVRLTDEGQRLYLHAQRMVQASEDAKLEMAELKGLQRGEVRVGVSSMLGSYYFPPVFMAFRQQYPQLTLSVTDAGTDRLRQLLLNGELDLAVIVDEDCPSELQAERFLSEQMLVTCGQDHPFATQHSIRSEDFFAQDLLLFKEGFFHRKVVERMARDGGFKPRISVETNLITLIKTMVSQGFGVSTLLPMVIDKTDNLITRSFAQPVWLHLSLAWRKDGYLSQANRTFADFMLGKR
>NZ_CP022530.1|WP_094060044.1|1959193_1960423_+|MFS-transporter
MNSFSSLSRSYATQAASFWPATLALGLGSFVVFANLYITQPMLPFLVQHFAISPLMAGQTFTITTATLAMSLLVFGPLSEVVGRRPLMLSATAGAVVCTGLLSWADSFSSMLVLRAAQGFFLAGLPAIALAYMREEFEASAFRIAVGVYISANSLGGIGGRLLGGFFIEHFSLSQSFALLAGLSIVLLLPVFIILPQSRGFQQQSWSSLRPRKVAQDIYSHLSNPVLLLAYMIGGLNFFIFVNQFSYATFRLAAAPYELSPSILGMLFLTYLSGTVGAALGGRWLRRWSAPQIMRLGVILLMLGSLVTLSDALPWIIVGFLINALGFFLAHANASGWVSRHAEHTPATASSVYLVCYYLGASSGGYYLDPFWNLAGWPGVVWASIVVLIINLFMTLRLRRYERKMADCR
>NZ_CP022530.1|WP_094060045.1|1960609_1962193_-|methyl-accepting-chemotaxis-protein
MFLRSIRSKAMLGYAGILLVFILMALFLFNNSATIKHRNASFTGTTLPALNAVEDAGLSLKRLHLSAYALYGTTIDAAAFDRTSQQVQQQLSANQAVLPELAQVPFAQVQQALATLRRTMTQSSIDWDGARNQLGAIDRSVAQASEQLGNIKQVLAQQANDSSLQVQQQLERMRNYIWLGAIAIIAIVVAAFVMTQKALVAPMVQLAQHLNLVATQLDLTRQLNLPSEDEVGTAAQGVNRLLNDVRESLHTLHQSVGTLLNSASAMEQLSAESGQQMQQFSSAMTEMMHQIEQIEHSIEETAARSRSASEAASTGARQVQEGSDNVRETASSIKSLSADLETSAAMLEQLKSSGSQVSQVVKSIADIAEQTNLLALNAAIEAARAGESGRGFAVVADEVRNLAKRTYDSTSQINQILEEIVSSINNTVTSMSTNQDNAGAAVELAMSTVESLDVIRTTVTQLSEENRQLASTTEANEQILNQMRHHVDGVRKANEQLAVSTNHTCEEAKQLTSIADTLNQTSRRFKT
>NZ_CP022530.1|WP_157729855.1|1962275_1963073_-|hypothetical-protein
MLSIQPGSFVRADNSSNSTLQPLASGKRINSAADDAAGLAIATRFSSQINATQQAVRNGLDAQSLIQTEDGALSGINDNLLRLKELAVQQGNGILSDSDRQLVAREAEQITAQIQETVAQSQFNGKPLFQAQDSASDFRFQLGSSEQDAVTLSANTLASDIEQTLAGLDFGSADGAAVLSGLGELQQQVTERRTELGAVSNRIDASIDNLRQQNESAQAARSRIEDADFAKVASERAREQFLQQAQISTQSQANANASDVLRLLS
>NZ_CP022530.1|WP_157729856.1|1963252_1963807_+|GNAT-family-N-acetyltransferase
MAMLQQEVLIGERIELRPPEEQWLDDLWAAVESSRAELGQFLDWVPLITSRSAVADNLAIAIDNFVQDKNERRYFIYCQNTQQFLGLIGLHIRDPSVPFYEIGYWLITSAYGRGFMTEAVNLLSDYALQHRQAKRVEIRTAASNASSIRVAERCGYEQEALLKNHRRLPNGQLDHTVIFCRYGE
>NZ_CP022530.1|WP_094060048.1|1963908_1965546_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MIRSLSAIFGTRRPMFGVCIMAVLQLQQFELRLADGRRLFQPIDLVLDRQFYVLTGRNGVGKSLLMAALAGLTNVSCQGQLVRHQPTTYLPQSAMTETETFSAALSLGNPTLEQQLAALKRLRLGIGRIGTGTDDDISLVADNWLLEQQLGEYLPAPLQLYDDWRHLSGGERMRCLLAAKLAGNEFLLLDEPSNHLDHVNKEWLAQQLRTRTTGALVISHDPVLLQAASHILLLTEQGIEVFSAGFEAYQQCLQHRLERQCQQAQQWQRQQRQLLETAQTMRQRAARRTAQGRQQVRDGSQGKALGDFRARRASQSLGGLNRRMAQRLHTHQAQRISMPAAVHNRLYAPHGKNQHSLWLNAVLPISGHPTVQLQMQAGECVWLQGRNGCGKTTLLRCLSGQQSFAAGEYSLPNAFLYLDQHASCLDQALTAMAFLQQALPGTDATELRTLLAGIGLKRERASDTISTLSGGEKMKLALLLAHQQQAWLLLDEPDNHLDAQAQDDLVDWLNRLENGFILVTHNQYLAKKIEGLTTVVMGSDTGEGN
>NZ_CP022530.1|WP_157729857.1|1965863_1966631_-|transporter-substrate-binding-domain-containing-protein
MKTRMFALLLTLALTPLAGAQTLTVVSDNWEGYTNKDGSGLYWEIVQAAFDGTGIEPEFTTMPWKRAEATVRNGDADAIVGVYYEPDVAGYRYPNWHISIEDPVVLYAKSSTSIPTPVAPQSLMGLKLAWIRGYGFNDTVLSGVDMKFQEVTQLGQGVQLVNSGRVDALLDYEVSIKQEAQKLGLPVSGTFQIVPVAPGNKLYIAFHNRPDADNWVELFDQRMHALSSNGKIAEIYKKWQVPETKFGAEYYAPLP
>NZ_CP022530.1|WP_094060050.1|1966878_1967736_+|alpha/beta-hydrolase
MFSVTLPEFQQGDLILFVHGALADARMWQPHIECLGGVCQGYAVSQRYFGAQGQEHSGEFGINQHAQDLLQWLQALPGGIRVHLVGWSYGADVVLAALTHAPSQVASAFVYDPGYPGCLSKDEMGEFMTDAGAMFDPVIPHLEEGRLEQAVAALIDGSGQALGYFHQQPEVLQQQQLDNAHTLVQQMQQAPATDLCAARLSAITVPVTLATGARSRVLFRLVTQSVKPHLAAVRWLQPDANHMWPLEQPTAFVAALHEHLQALAEPWQAQTLSSDTAVLETAAGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	NC_011373	Pseudomonas phage PAJU2, complete genome	5938-5962	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	AP009624	Pseudomonas phage PAJU2 DNA, complete genome	5938-5962	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	NC_031265	Gordonia phage Guacamole, complete genome	30125-30149	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	MH576969	Gordonia phage Zarbodnamra, complete genome	29582-29606	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	MK967389	Gordonia phage JasperJr, complete genome	30125-30149	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	MT723936	Gordonia phage Hitter, complete genome	29859-29883	4	0.84
NZ_CP022530_1	1.1\|1953054\|25\|NZ_CP022530\|CRISPRCasFinder	1953054-1953078	25	NC_031237	Gordonia phage Obliviate, complete genome	28549-28573	4	0.84

1. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to NC_011373 (Pseudomonas phage PAJU2, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
gcacaagagcctgagccgactcctg	Protospacer
.* * *******************.

2. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to AP009624 (Pseudomonas phage PAJU2 DNA, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
gcacaagagcctgagccgactcctg	Protospacer
.* * *******************.

3. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to NC_031265 (Gordonia phage Guacamole, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
actccggagccggagccgactcccg	Protospacer
*****.***** ***********..

4. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to MH576969 (Gordonia phage Zarbodnamra, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
actccggagccggagccgactcccg	Protospacer
*****.***** ***********..

5. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to MK967389 (Gordonia phage JasperJr, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
actccggagccggagccgactcccg	Protospacer
*****.***** ***********..

6. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to MT723936 (Gordonia phage Hitter, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
actccggagccggagccgactcccg	Protospacer
*****.***** ***********..

7. spacer 1.1|1953054|25|NZ_CP022530|CRISPRCasFinder matches to NC_031237 (Gordonia phage Obliviate, complete genome) position: , mismatch: 4, identity: 0.84

actccagagcctgagccgactccta	CRISPR spacer
actccggagccggagccgactcccg	Protospacer
*****.***** ***********..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

583925 : 602636

Sucra_jujuba_nucleopolyhedrovirus(50.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094058566.1\|583925_584324_-\|transposase	transposase	NA	NA	NA	NA
WP_094058567.1\|584320_584704_-\|transposase	transposase	NA	NA	NA	NA
WP_094058847.1\|584965_585838_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_094058848.1\|586218_587952_+	chitinase	A0A097P8Z3	Sucra_jujuba_nucleopolyhedrovirus	5.5e-121	42.5
WP_094058849.1\|588015_590325_+	chitinase	A0A1X9VNM7	Mimivirus	4.6e-30	25.7
WP_094058850.1\|590387_591284_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_094058851.1\|591371_591632_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094058852.1\|591617_592016_-\|transposase	transposase	NA	NA	NA	NA
WP_094058567.1\|592012_592396_-\|transposase	transposase	NA	NA	NA	NA
WP_094058853.1\|592447_592768_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157729735.1\|593620_593827_-	hypothetical protein	NA	NA	NA	NA
WP_094058854.1\|593826_595584_+	hypothetical protein	NA	NA	NA	NA
WP_094058855.1\|595683_597375_-	DNA alkylation response protein	NA	NA	NA	NA
WP_094058856.1\|597385_598021_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157729736.1\|598362_600444_+	hypothetical protein	NA	NA	NA	NA
WP_094058859.1\|601063_601492_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094058860.1\|601513_601933_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094058566.1\|601857_602256_-\|transposase	transposase	NA	NA	NA	NA
WP_094058567.1\|602252_602636_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

827267 : 839671

Vibrio_phage(44.44%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094059068.1\|827267_828167_-	hypothetical protein	A0A1C9LVZ9	Vibrio_phage	1.7e-20	31.3
WP_094059069.1\|828163_833743_-	DUF4214 domain-containing protein	A0A2I7RB22	Vibrio_phage	8.6e-83	37.9
WP_157729764.1\|833735_834056_-	hypothetical protein	D6PGB0	uncultured_phage	1.3e-07	38.7
WP_094059071.1\|834076_834400_-	hypothetical protein	NA	NA	NA	NA
WP_094059072.1\|834410_835346_-	hypothetical protein	G8CLB2	Synechococcus_phage	7.2e-59	41.0
WP_094059073.1\|835369_835747_-	hypothetical protein	NA	NA	NA	NA
WP_094059074.1\|835939_836284_-	DUF2730 family protein	A0A2P9JZI5	Alteromonadaceae_phage	9.2e-12	31.6
WP_094059075.1\|836271_836478_-	hypothetical protein	NA	NA	NA	NA
WP_094059076.1\|836488_836878_-	hypothetical protein	A0A2I7R6R1	Vibrio_phage	1.1e-13	40.0
WP_094061976.1\|836907_837342_-	hypothetical protein	I6R9Z4	Marinomonas_phage	4.8e-26	47.1
WP_157729765.1\|837380_837770_-	hypothetical protein	NA	NA	NA	NA
WP_094059078.1\|838070_838763_+	helix-turn-helix transcriptional regulator	A0A2I7S9A5	Vibrio_phage	1.5e-37	40.6
WP_094059079.1\|838759_839671_+	histone deacetylase	A0A2K9L2T7	Tupanvirus	7.3e-16	28.9

DBSCAN-SWA_3

1543750 : 1584446

Mannheimia_phage(14.29%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094059690.1\|1543750_1544212_+\|protease	activity regulator of membrane protease YbbK	NA	NA	NA	NA
WP_094059691.1\|1544211_1544655_+	DedA family protein	NA	NA	NA	NA
WP_094062011.1\|1544900_1545566_+	RNA pseudouridine synthase	NA	NA	NA	NA
WP_094059692.1\|1545706_1546126_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094062012.1\|1546267_1549321_+	outer membrane lipoprotein-sorting protein	NA	NA	NA	NA
WP_157729812.1\|1549380_1550661_+	hypothetical protein	NA	NA	NA	NA
WP_094059694.1\|1550671_1551538_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_094059695.1\|1551657_1552314_+	helix-turn-helix transcriptional regulator	A0A0M3LPF9	Mannheimia_phage	4.2e-21	33.3
WP_094059697.1\|1554036_1554507_+	hypothetical protein	NA	NA	NA	NA
WP_094059698.1\|1554579_1555956_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-56	34.9
WP_094059699.1\|1556050_1556899_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_094059700.1\|1557010_1557955_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_094059701.1\|1558010_1559546_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_094059702.1\|1559548_1559854_-	hypothetical protein	NA	NA	NA	NA
WP_157729813.1\|1559837_1560131_-	DUF3325 family protein	NA	NA	NA	NA
WP_094059704.1\|1560253_1560739_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059705.1\|1561248_1561968_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157729814.1\|1562019_1563216_-	hypothetical protein	NA	NA	NA	NA
WP_094059707.1\|1563513_1564233_+	hypothetical protein	NA	NA	NA	NA
WP_094059708.1\|1564288_1565959_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	5.4e-33	28.6
WP_094059709.1\|1566318_1567656_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_094059710.1\|1567814_1568432_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_094059711.1\|1568592_1569315_+	riboflavin synthase subunit alpha	A0A1V0SE20	Indivirus	1.6e-13	33.2
WP_094059712.1\|1569314_1570007_+	HAD family hydrolase	NA	NA	NA	NA
WP_094059713.1\|1570198_1570681_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059714.1\|1570687_1571224_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	2.1e-31	44.7
WP_094059715.1\|1571223_1571673_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059716.1\|1571703_1572291_+	HD domain-containing protein	NA	NA	NA	NA
WP_094059717.1\|1572292_1572808_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059718.1\|1572804_1573269_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_094059719.1\|1573265_1573796_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059720.1\|1573797_1574349_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059721.1\|1574740_1575094_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094059722.1\|1575098_1576001_-	allantoinase PuuE	NA	NA	NA	NA
WP_094059723.1\|1576315_1577377_+	hypothetical protein	NA	NA	NA	NA
WP_094059724.1\|1577422_1578919_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.7e-52	32.6
WP_094059726.1\|1579575_1579959_+\|transposase	transposase	NA	NA	NA	NA
WP_157729815.1\|1579862_1580354_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094058567.1\|1581001_1581385_+\|transposase	transposase	NA	NA	NA	NA
WP_094058566.1\|1581381_1581780_+\|transposase	transposase	NA	NA	NA	NA
WP_157729816.1\|1581799_1582684_+	hypothetical protein	NA	NA	NA	NA
WP_094059730.1\|1583371_1584446_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-48	40.1

DBSCAN-SWA_4

1668400 : 1676705

Acinetobacter_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094059794.1\|1668400_1668799_-\|transposase	transposase	NA	NA	NA	NA
WP_094058567.1\|1668795_1669179_-\|transposase	transposase	NA	NA	NA	NA
WP_157729826.1\|1669250_1669580_-	hypothetical protein	NA	NA	NA	NA
WP_157729827.1\|1669668_1672554_-	hypothetical protein	NA	NA	NA	NA
WP_094059797.1\|1672682_1673084_+	hypothetical protein	NA	NA	NA	NA
WP_094059798.1\|1673492_1673801_+\|transposase	transposase	NA	NA	NA	NA
WP_157730021.1\|1674978_1675863_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.6e-54	43.3
WP_094058567.1\|1675926_1676310_+\|transposase	transposase	NA	NA	NA	NA
WP_094059800.1\|1676306_1676705_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

2272954 : 2324236

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094060281.1\|2272954_2273338_+\|transposase	transposase	NA	NA	NA	NA
WP_094060282.1\|2273334_2273733_+\|transposase	transposase	NA	NA	NA	NA
WP_094060283.1\|2273867_2274884_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_094060284.1\|2275049_2275370_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_094060285.1\|2275430_2276813_+	cytochrome P450	NA	NA	NA	NA
WP_094060286.1\|2277004_2277403_-	GFA family protein	NA	NA	NA	NA
WP_094060287.1\|2277493_2277889_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_094062053.1\|2278004_2278946_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_094060288.1\|2279088_2280375_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_094060289.1\|2280517_2281258_-	sporulation protein	NA	NA	NA	NA
WP_094060290.1\|2281473_2282190_-	hypothetical protein	NA	NA	NA	NA
WP_094060291.1\|2282805_2283300_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094060292.1\|2283697_2285056_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_094060293.1\|2285241_2285697_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_094060294.1\|2285786_2286245_+	YaiI/YqxD family protein	NA	NA	NA	NA
WP_094060295.1\|2286195_2288100_-	TRAP transporter fused permease subunit	NA	NA	NA	NA
WP_094060296.1\|2288109_2289045_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_094060297.1\|2289181_2290306_+	hypothetical protein	NA	NA	NA	NA
WP_094060298.1\|2290501_2291740_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_157729876.1\|2291825_2292737_-	signal protein PDZ	NA	NA	NA	NA
WP_094060300.1\|2293050_2293902_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094060301.1\|2294128_2294863_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_094060302.1\|2294875_2295865_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_094060303.1\|2295929_2297663_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	2.8e-32	23.5
WP_094060304.1\|2298616_2299201_-	AAA family ATPase	NA	NA	NA	NA
WP_094060305.1\|2299313_2299628_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_094060306.1\|2299679_2300063_+\|transposase	transposase	NA	NA	NA	NA
WP_094058566.1\|2300059_2300458_+\|transposase	transposase	NA	NA	NA	NA
WP_094060307.1\|2300443_2300794_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_094060308.1\|2301240_2301552_-	cupin	NA	NA	NA	NA
WP_094060309.1\|2301791_2302640_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-72	52.7
WP_094060310.1\|2302723_2304211_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-216	80.3
WP_094060312.1\|2304471_2305197_-	hypothetical protein	NA	NA	NA	NA
WP_094060313.1\|2305171_2306509_-	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_094060314.1\|2306508_2308746_-	DUF1800 family protein	NA	NA	NA	NA
WP_094060315.1\|2309496_2309979_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094060316.1\|2309978_2311820_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-32	26.5
WP_157729877.1\|2311950_2312310_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_094060318.1\|2312306_2312708_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_094062054.1\|2312857_2313415_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_094060319.1\|2313542_2314847_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_094060320.1\|2314839_2315385_+	hypothetical protein	NA	NA	NA	NA
WP_157729878.1\|2315381_2315870_+	hypothetical protein	NA	NA	NA	NA
WP_157729879.1\|2315866_2316460_+	hypothetical protein	NA	NA	NA	NA
WP_094060323.1\|2316616_2317129_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_094060324.1\|2317268_2318168_-	DMT family transporter	NA	NA	NA	NA
WP_094060325.1\|2318338_2319232_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094060326.1\|2319305_2321756_+	TonB-dependent receptor	NA	NA	NA	NA
WP_157729880.1\|2323041_2323821_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.5e-62	49.0
WP_094060327.1\|2323837_2324236_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2619736 : 2649272

Enterobacteria_phage(20.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094058868.1\|2619736_2620021_-\|transposase	transposase	NA	NA	NA	NA
WP_094058567.1\|2620131_2620515_-\|transposase	transposase	NA	NA	NA	NA
WP_094060568.1\|2620677_2620803_-	DUF4372 domain-containing protein	NA	NA	NA	NA
WP_094060570.1\|2621706_2624805_+	DUF4132 domain-containing protein	NA	NA	NA	NA
WP_094060571.1\|2624801_2625884_+	AAA family ATPase	NA	NA	NA	NA
WP_094060572.1\|2625880_2627695_+	hypothetical protein	NA	NA	NA	NA
WP_157729896.1\|2627673_2628135_+	hypothetical protein	NA	NA	NA	NA
WP_094060574.1\|2628131_2629226_+	VWA domain-containing protein	Q9EYF7	Enterobacteria_phage	2.5e-55	39.4
WP_094060575.1\|2629222_2630641_+	hypothetical protein	NA	NA	NA	NA
WP_094060576.1\|2630797_2631082_+	hypothetical protein	NA	NA	NA	NA
WP_094060577.1\|2631562_2632699_-	hypothetical protein	NA	NA	NA	NA
WP_094060578.1\|2633109_2635059_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.5e-87	40.9
WP_094060579.1\|2635217_2635904_+	response regulator transcription factor	NA	NA	NA	NA
WP_094060580.1\|2636129_2637740_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	1.7e-31	29.9
WP_094060581.1\|2637739_2638648_-	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_094060582.1\|2638926_2639562_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_094060583.1\|2639683_2640787_+	cell division protein ZapE	NA	NA	NA	NA
WP_094060584.1\|2640917_2642054_+	porin	NA	NA	NA	NA
WP_094060585.1\|2642516_2643131_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_094060586.1\|2643121_2644576_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_094060587.1\|2644583_2646266_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	9.6e-62	31.0
WP_094060588.1\|2646283_2647213_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_094060589.1\|2647269_2648100_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_094060590.1\|2648102_2649272_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-25	35.7

DBSCAN-SWA_7

3137844 : 3198281

uncultured_Caudovirales_phage(33.33%)

transposase,tRNA,integrase,plate

attL 3180137:3180152|attR 3199523:3199538

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094060989.1\|3137844_3138834_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_094060990.1\|3138957_3140979_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_094060991.1\|3141346_3141730_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_157729932.1\|3141768_3142428_-	hypothetical protein	NA	NA	NA	NA
WP_094060993.1\|3142292_3144515_-	RNA polymerase-associated protein RapA	A0A2H4J643	uncultured_Caudovirales_phage	1.6e-16	22.8
WP_094060994.1\|3144686_3145832_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_094060995.1\|3146364_3146616_+	hypothetical protein	NA	NA	NA	NA
WP_094060996.1\|3146655_3148599_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_094060997.1\|3148640_3149252_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_094060998.1\|3149269_3149623_+	hypothetical protein	NA	NA	NA	NA
WP_094060999.1\|3149635_3151453_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_094061000.1\|3151416_3152475_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_094061001.1\|3152471_3152966_+	hypothetical protein	NA	NA	NA	NA
WP_094061002.1\|3152969_3154391_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_094061003.1\|3154394_3155159_+	hypothetical protein	NA	NA	NA	NA
WP_094061004.1\|3155210_3159365_+	hypothetical protein	NA	NA	NA	NA
WP_094062093.1\|3159438_3160473_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_094061006.1\|3160889_3161870_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_094061007.1\|3162021_3162801_+	hypothetical protein	NA	NA	NA	NA
WP_094061008.1\|3163062_3165945_+	hypothetical protein	NA	NA	NA	NA
WP_094061009.1\|3165951_3168561_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_094061010.1\|3168588_3169638_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_094061011.1\|3169634_3170162_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_094061012.1\|3170167_3170545_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_094061013.1\|3170655_3171258_-	hypothetical protein	NA	NA	NA	NA
WP_094061014.1\|3171254_3171725_-	hypothetical protein	NA	NA	NA	NA
WP_157729933.1\|3171857_3172385_+	hypothetical protein	NA	NA	NA	NA
WP_094061016.1\|3172432_3172996_+	LysE family translocator	NA	NA	NA	NA
WP_094061017.1\|3173911_3174571_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_157729934.1\|3174944_3176150_+	hypothetical protein	NA	NA	NA	NA
WP_094061019.1\|3176167_3177976_+	hypothetical protein	NA	NA	NA	NA
WP_094061020.1\|3177968_3179051_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_094061021.1\|3179064_3179322_-	hypothetical protein	NA	NA	NA	NA
WP_094061022.1\|3179372_3179759_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_094061023.1\|3179877_3180393_+	DUF4269 domain-containing protein	NA	NA	NA	NA
3180137:3180152	attL	NA	NA	NA	NA
WP_157729935.1\|3180504_3181500_+	hypothetical protein	NA	NA	NA	NA
WP_094061025.1\|3181605_3184761_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_157729936.1\|3184750_3185911_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_094061027.1\|3186052_3187054_-	hypothetical protein	NA	NA	NA	NA
WP_094061028.1\|3187050_3187911_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-15	29.4
WP_094062094.1\|3187907_3188225_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_157729937.1\|3188275_3189115_-	hypothetical protein	NA	NA	NA	NA
WP_094062095.1\|3190380_3191583_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_094061030.1\|3191646_3192393_-	acetoacetyl-CoA reductase	NA	NA	NA	NA
WP_094061031.1\|3192726_3194196_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_157729938.1\|3194228_3194942_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_094061033.1\|3195054_3195864_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_094062096.1\|3195932_3196331_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_094062097.1\|3196415_3196874_-	hypothetical protein	NA	NA	NA	NA
WP_094061034.1\|3197097_3198281_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	6.5e-41	37.2
3199523:3199538	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022530

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection