CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	0 crisprs	DEDDh,csa3	0	0
NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	0 crisprs	NA	0	1
NZ_CP022665	Rhizobium leguminosarum bv. viciae strain BIHB 1217 chromosome, complete genome	3 crisprs	WYL,csa3,cas3,DEDDh,Cas9_archaeal,PD-DExK	3	9
NZ_CP022671	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR6, complete sequence	0 crisprs	NA	0	1
NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	0 crisprs	RT	0	0
NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	0 crisprs	csa3,WYL	0	0
NZ_CP022669	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR4, complete sequence	1 crisprs	DEDDh	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

537397 : 546506

Planktothrix_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018247003.1\|537397_538453_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-27	35.0
WP_018247002.1\|538452_539232_+	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	1.4e-07	34.3
WP_018247001.1\|539215_540220_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.1e-18	28.5
WP_018247000.1\|540219_541029_+	inositol phosphatase	NA	NA	NA	NA
WP_018246999.1\|541104_542763_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.8e-20	37.8
WP_172643996.1\|542891_543755_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_018246997.1\|543826_544921_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_018246996.1\|544932_545715_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-17	31.6
WP_018246995.1\|545711_546506_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-16	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022665

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022665_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022665_1

1188880-1188959

Orphan

Consensus_repeat	Method
AAAACCGCTCACACTTTCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022665_1

>merge|NZ_CP022665|1|1188880-1188959|CRISPRCasFinder
AAAACCGCTCACACTTTCCGGCACCATGCTTTAATAGTGGGAGCATGATGTTGCCCGAAAACCGCTCACACTTTTCGGCA

>NZ_CP022665|1|1|1188880-1188959|CRISPRCasFinder
AAAACCGCTCACACTTTCCGGCA	CCATGCTTTAATAGTGGGAGCATGATGTTGCCCG
AAAACCGCTCACACTTTTCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022665.1\|WP_018245049.1\|1195275_1196526_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NZ_CP022665.1\|WP_018245056.1\|1185660_1186596_+\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212541
NZ_CP022665.1\|WP_026188640.1\|1184329_1184938_+\|2'-5'-RNA-ligase-family-protein	unknown	unknown	gnl\|CDD\|379265
NZ_CP022665.1\|WP_018245054.1\|1187916_1188840_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_CP022665.1\|WP_018245063.1\|1178542_1179616_+\|tartrate-dehydrogenase	unknown	unknown	gnl\|CDD\|273963
NZ_CP022665.1\|WP_018245047.1\|1197619_1198375_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NZ_CP022665.1\|WP_018245061.1\|1180919_1182395_+\|pyruvate-kinase	unknown	unknown	gnl\|CDD\|180487
NZ_CP022665.1\|WP_018449328.1\|1191241_1193179_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP022665.1\|WP_018245060.1\|1182647_1184171_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235870
NZ_CP022665.1\|WP_018245058.1\|1184975_1185377_-\|thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP022665.1\|WP_003545921.1\|1186598_1186850_+\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NZ_CP022665.1\|WP_018245050.1\|1194493_1195279_+\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP022665.1\|WP_018245046.1\|1198384_1200163_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP022665.1\|WP_018245048.1\|1196528_1197539_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NZ_CP022665.1\|WP_018245062.1\|1179622_1180891_+\|glycerate-kinase	unknown	unknown	gnl\|CDD\|225254
NZ_CP022665.1\|WP_018245053.1\|1189062_1190979_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|224076
NZ_CP022665.1\|WP_018245051.1\|1193398_1194400_-\|DUF4424-domain-containing-protein	unknown	unknown	gnl\|CDD\|373054
NZ_CP022665.1\|WP_018245055.1\|1186939_1187707_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP022665.1\|WP_003556974.1\|1200371_1201367_+\|transporter	unknown	unknown	gnl\|CDD\|213368
NZ_CP022665.1\|WP_018245044.1\|1201460_1201946_-\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573

Protein	Function_ID	Function_description	E-value
NZ_CP022665.1\|WP_018245049.1\|1195275_1196526_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	3.32563e-121
NZ_CP022665.1\|WP_018245056.1\|1185660_1186596_+\|histone-deacetylase-family-protein	gnl\|CDD\|212541	cd11599, HDAC_classII_2, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes eukaryotic as well as bacterial Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. In D. discoideum, where four homologs (HdaA, HdaB, HdaC, HdaD) have been identified, HDAC activity is important for regulating the timing of gene expression during development. Also, inhibition of HDAC activity by trichostatin A is shown to cause hyperacetylation of the histone and a delay in cell aggregation and differentiation.	7.315e-155
NZ_CP022665.1\|WP_026188640.1\|1184329_1184938_+\|2'-5'-RNA-ligase-family-protein	gnl\|CDD\|379265	pfam13563, 2_5_RNA_ligase2, 2'-5' RNA ligase superfamily. This family contains proteins related to pfam02834. These proteins are likely to be enzymes, but they may not share the RNA ligase activity.	0.000172364
NZ_CP022665.1\|WP_018245054.1\|1187916_1188840_+\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	3.64086e-104
NZ_CP022665.1\|WP_018245063.1\|1178542_1179616_+\|tartrate-dehydrogenase	gnl\|CDD\|273963	TIGR02089, Probable_tartrate_dehydrogenase/decarboxylase, tartrate dehydrogenase. Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate. These enzymes are closely related to the 3-isopropylmalate and isohomocitrate dehydrogenases found in TIGR00169 and TIGR02088, respectively. [Energy metabolism, Other].	0
NZ_CP022665.1\|WP_018245047.1\|1197619_1198375_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	3.96873e-162
NZ_CP022665.1\|WP_018245061.1\|1180919_1182395_+\|pyruvate-kinase	gnl\|CDD\|180487	PRK06247, PRK06247, pyruvate kinase; Provisional.	0
NZ_CP022665.1\|WP_018449328.1\|1191241_1193179_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.05925e-68
NZ_CP022665.1\|WP_018245060.1\|1182647_1184171_+\|FAD-dependent-monooxygenase	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	5.40118e-102
NZ_CP022665.1\|WP_018245058.1\|1184975_1185377_-\|thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	1.95552e-13
NZ_CP022665.1\|WP_003545921.1\|1186598_1186850_+\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.83197e-24
NZ_CP022665.1\|WP_018245050.1\|1194493_1195279_+\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	9.4016e-117
NZ_CP022665.1\|WP_018245046.1\|1198384_1200163_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.58336e-149
NZ_CP022665.1\|WP_018245048.1\|1196528_1197539_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	2.13406e-74
NZ_CP022665.1\|WP_018245062.1\|1179622_1180891_+\|glycerate-kinase	gnl\|CDD\|225254	COG2379, GckA, Putative glycerate kinase [Carbohydrate transport and metabolism].	0
NZ_CP022665.1\|WP_018245053.1\|1189062_1190979_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|224076	COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism].	0
NZ_CP022665.1\|WP_018245051.1\|1193398_1194400_-\|DUF4424-domain-containing-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	3.44854e-130
NZ_CP022665.1\|WP_018245055.1\|1186939_1187707_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.89968e-69
NZ_CP022665.1\|WP_003556974.1\|1200371_1201367_+\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.40768e-112
NZ_CP022665.1\|WP_018245044.1\|1201460_1201946_-\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.84683e-10

>NZ_CP022665.1|WP_018245054.1|1187916_1188840_+|pirin-family-protein
MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPSRQRRLVGPFIFFDRMGPAILKPDEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPGDINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPNDKEEIDPSFAHTEKSAMPLIETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLDLQPGAKFPFGAGHEERAVYVLSGEVVISGDRFAADQLLVFRPGDAITLEAGRDGCHLMLFGGAALNSKRYIWWNFVSSSKERIEQAKEEWRTGRFDIVPGDEEEFVPLPEG
>NZ_CP022665.1|WP_018245055.1|1186939_1187707_+|SDR-family-oxidoreductase
MTDRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNGQAAAETVQAIRDAGGEAEYWTADVSDEAAVIAAVAGVEERYGAVTVLFNHAGTIVIKPFLETTLQEWDWLHAVNVRSMFLMTKAVLPKMIESGGGSIVCTSSISAVAATPMEVLYDTTKGAVHMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGEPEDVARAALYLASDESSFVNGAHLFVDNGFTAI
>NZ_CP022665.1|WP_003545921.1|1186598_1186850_+|exodeoxyribonuclease-VII-small-subunit
MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA
>NZ_CP022665.1|WP_018245056.1|1185660_1186596_+|histone-deacetylase-family-protein
MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERRQAPQANEDAVLLAHPEEHLIAVMREIPEEEGEINQIEADTYASSKSLQAALTGIGGAMAAVDDVFTGRADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQRAHGAERIAIVDWDVHHGNGTQDIFWDDASVLFCSTHQMPLYPGTGAKDEKGTHNTIVNAPLSPNVGSDHFREAFKSRVLPALDDFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRHAKNRVVSLLEGGYDLEGLAESAGMHILRMMKG
>NZ_CP022665.1|WP_018245058.1|1184975_1185377_-|thioesterase
MSQSKRPDVAEIRVPFRDVDMTGQMFLASYISYAESVLASFWSSRPDVDDEPVYSPSKVSCMLHRPLHYDELATFTATVDKIGMHSIGLLVAIDTGEERAAEVEIIWQARTREDQSPASLPEETRDWLYRFLD
>NZ_CP022665.1|WP_026188640.1|1184329_1184938_+|2'-5'-RNA-ligase-family-protein
MIRTKVDTLFKQCCAFHLQFFPDGEALSKLCNLQDRIERDSDAPLSRVPAKSLHMTVVTLVNAAAQFSIPNDEVWKLNGERWKEIVERLVEETPPFELHFHEVAASEAAVFVKAEEPPELRRLRSAISHAICFEQWCPTPPRIAHITLFRFFAEDRLPAVNFDAGLLPTGLKVGSLKLLEERVYPSVEINILSEPLLRGKST
>NZ_CP022665.1|WP_018245060.1|1182647_1184171_+|FAD-dependent-monooxygenase
MNNRHPTSFLFDVVIAGAGPVGLLLACELRLAGVSVLVLEQAESPHSPLKKLPFGMRGLTLPTIEAFYRRGLLDSLEAPGRQAKPEGKPRKQAGHFAGIPFDYDRINPSDWAYRLPSPADSNMAAEMERVETVLADRAQSIGVEIRRGVRVEGLAQSADGVMIQAGDQSFEGRWLVGCDGGRSMVRKGGGFSFVGTDPEFTGYSVQVDLADPEKLKLGRQLTPTGMYFQTQPGHFGMVEFDSGASHRTGPITLAHVQAVLRRISQTDVTLTALRVATSWTDRAQQATEYRKGRVLLAGDAAHIHSPLGGQGLNLGLGDAMNLGWKLAATVRGEAPDGLLDSYFSERHPIGEQILAWSRAQVSIMRPSPHARAMESIIRDLIATRDGATYFADRVWNASMRYDLGDGHALVGRSVPDFEWTDGTRLAALLADGTGLLIDFGDRAPLRSIARRWDDRVKYVEGEVKDRLGLTALLVRPDGIVAWACEGEVNPEDAVEAGSRWFAVHDGG
>NZ_CP022665.1|WP_018245061.1|1180919_1182395_+|pyruvate-kinase
MHRNRRAKIVATVGPASASPDMLKSLFEAGVDTFRLNFSHGSHEDHAAVFRSIRALERETGRPIGILQDLQGPKIRVGRIRNGAISVSKGDRIRFVLGTDEGIADSIPLPHREIFAAVKPGDDLLIDDGRVRVRIDGVGAETITAEVVVGGVISDRKGVNIPGAILDISPLTEKDRRDLEYGLELGVDWVALSFVQKASDMIEARALVSQRAGLIAKIEKPSALDQIDDIIRLSDGIMVARGDLGVEIPPEEVPGRQKELIRACRLAVKPVIVATQMLDSMVAAPTPTRAEASDVAMAIYDGADAVMLSAESATGRFPRETVEIMDRIIRSTEGHKLYRSLIAASEPEIEPSPPHAVASAAADLATAINAPLIAAFTSSGTTAARIARKRPSLPILAITPDELVSRQLCLLWGAVSIHSKEIVTYEDTIDYARQMASRSGLSSPHDNIVVVAGIPFGRPGTTNNLRVVQLKEEAPSEAVLDLHSLSDRAAP
>NZ_CP022665.1|WP_018245062.1|1179622_1180891_+|glycerate-kinase
MSWTDQKARETLHQIFDAAVESASPQRAVLENLPDKPKGRCIVVGAGKASAAMAAALDSAWPNVDLSGVVVTRYGHAVPAGRIRIIEASHPVPDAMSERAAADVLQAVRGLTPDDLVVALVSGGGSALLVAPAGGMTLADKQSVNRALLASGATITEMNAVRKHLSRIKGGRLALAAQPAKVVTLVISDVPGDDPASIASGPTIADESTIDEVRGIISRYRIVLPDTARSVLESGDETPKPADLASDVRIIAAPSLALDSAAKAAANAGLQTLVLGDAIEGEARELGTVMAGIALSAKTKGLPVRGPAVLLSGGEGTVTIGCEAAGRGGRNTEFLLGLAVALKGHAGIWAIAGDTDGIDGTEDAAGAVVTPDTLERGRKKGLDARAYLASHDSYSFFDEIGDLVKTGPTLTNVNDIRAILIV
>NZ_CP022665.1|WP_018245063.1|1178542_1179616_+|tartrate-dehydrogenase
MREYAIATIPADGIGPEVIAAGTRVLAAIEKREGGIKFNLENFDWGSDYYKKHGVMMPTDGLKQLKKFDAIYFGAVGAPDVPDHVTLWGLRLPICQGFDQYANVRPTKILPGITPPLRNCGPGDLDWVIVRENSEGEYSGHGGRAHRGLPEEVGTEVAIFTRVGVTRIMRYAFKLAQSRPRKFLTVVTKSNAQRHGMVMWDEIAAEVAEEFPDVTWDKMLVDAMTVRMTLNPRSLDTIVATNLHADILSDLAGALAGSLGVAPTANIDPERRFPSMFEPIHGSAFDITGKGIANPVATFWTAAQMLDHLGETDASARLMRAVERVTGAGILTPDVGGTANTKEVTDAVVDEIHTSNV
>NZ_CP022665.1|WP_018245053.1|1189062_1190979_+|1-deoxy-D-xylulose-5-phosphate-synthase
MTQLPKTPLLDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNIDRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNGRGPVLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEAALDDKIVGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAELKHMVRTAVAYDGGPISFRYPRGEGVGVDMPARGEILQIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFSSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFRALGRGVAVGVAG
>NZ_CP022665.1|WP_018449328.1|1191241_1193179_-|methyl-accepting-chemotaxis-protein
MSAKNISLNGKLAATFAALILIFVAISAFVYSKATASAAASAEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTATGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNATKGQLDGFRQASAKIKATAREKSNALAAIRADANSDLKTTLLAGGILASLAAAVLAWLMSRTIVRPVVGMTAAMDRLAGGQNDIEVPAVERGDEIGRMAQSVLVFKQAAIEKLRLAGETDRMRDDAERQRRAGDEQKAREEGEIRYAIDALAGGLAELANGDMAGRIQTPFASQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEEVTTTVRDSAKRAEDVGNLVERTRLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVGLVGETGKALEVIVSEVQEINHHVNAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHALAQEANALDELLRQFKLGQAAPAPRAAVVGTSSRPVASPAHALTRTVAKAFGGRQAAATATVQEEWTEF
>NZ_CP022665.1|WP_018245051.1|1193398_1194400_-|DUF4424-domain-containing-protein
MLKLFTLIVAAVIASPALANDTMAEVKTGGLIFAQSDDVSMAEEDLFISASEVRVDYIFENSSDKDVESLVAFPMPDISGQVDNNSAISDYDSDNFLHFSTVQDGRPITAKLQQRVVSLGIDVTDEFAKLGIPVLPYSQKTTEALAKLPETVRKDWISRGVVYPMGAGDAAAGVDLVPLWTLRSTYWWRTTFPAKKKVSVEHRYKPAVGGTVAISFLEGGEPKGDRFEEYSRKYCLDGDFVRVAQQRAREAEAGGANYTESWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVQKIGPTTFRMTSEDFDPTRDFDILILNPPETAQ
>NZ_CP022665.1|WP_018245050.1|1194493_1195279_+|TlyA-family-RNA-methyltransferase
MLATGGFAGHAQPMSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFNADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLLRGAQHVTAIDVGHGQMHPRISGDPRVTNREGLNARNMTAEDIGHPATFIVSDVSFITLKLALAPALEIAEPGAVAILLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>NZ_CP022665.1|WP_018245049.1|1195275_1196526_+|class-I-SAM-dependent-RNA-methyltransferase
MSTETVTIEKLGAQGDGIASSAGGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPPCRHFGPDGVNGTCGGCTLQHMADTPYRAFKRQLVIDALKSKGLTPEVGEIVPARPGERRRVVFAARKTEKDMLVGFNQAESHHIVAIEECPISSAGIIARLPAIRAIAASLATSAEPFRVAVLETLSGLDISVDEVKKLSDPQRRKAIETALGLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGSFTQATKPAEEAMAELVIAHAGKAKRIADLFAGSGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSAVKKIVAVSCNPLTLARDLAILVEGGYRITQVTPIDQFLWTSHVEVVATLEK
>NZ_CP022665.1|WP_018245048.1|1196528_1197539_+|MBL-fold-metallo-hydrolase
MPVGKTKRRNPYYHGPVSDHFDGTHFFNPDGIEPLGFRDLLRWQFGGGRERWPQSVPSPYPAAKPDPCVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERVSPFAFAGPKRVVQPGIAFDDLPPIDLVLVSHNHYDHLDIATLRRLGAKHRPRVVTPLGNDTIIRRAVPDIRTTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHHGINYQAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMKLANAAYVAGHHFATFQLTNEAVDAPARALQDAMSEHDIPPERFRPLRAGEVFNVPAV
>NZ_CP022665.1|WP_018245047.1|1197619_1198375_-|crotonase/enoyl-CoA-hydratase-family-protein
MTDYIIVEQPSAYPGVQSIRFNRPEKKNAITRAMYRTMADALNAANTSPDIRATAFLGTEGCFSAGNDLNDFLAAAMGGRGLEQEILDFLYALVNAEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGHQRAFAMLAAGEAFSADEAKEAGLVWKVVESGEVDSLTLGLAAKLAAKPPEALRIARDLIRGNRGEIIARIDEEARHFSARLKSAEARAAFEAFMRR
>NZ_CP022665.1|WP_018245046.1|1198384_1200163_-|acyl-CoA-dehydrogenase
MYKAPVEEIAFTLKHVAGMDEAISRGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLIDGEVRLPDGWRDLYRHWIAGGWNGLTAPEAFGGQALPHMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSTHGSAALKDKYLEKMVSGEWTGTMNLTEPHAGSDLGVLKARAERRDDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGASGAGMSPIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDASRQWQERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVKGFIAELREIADGVRRSNLDGFGETAARLDAAIADLEQATAWLMKTLAENSTAEALSGATPYQRLFGLVLTGCYLAKGGLAESADGAAENRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>NZ_CP022665.1|WP_003556974.1|1200371_1201367_+|transporter
MDTLPVNIPGFVWAYRFSPEEKTAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLDGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQRDFAQDTNNLGWLHFAMSDRFLITTRLQPLRSVERARALIEKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADDDEMPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVALIVASIAFAWWLLRRVDIL
>NZ_CP022665.1|WP_018245044.1|1201460_1201946_-|BA14K-family-protein
MIGLRNKIATAVLAAAVVLTGFAPSQAIQMPTAPQVEKSSAVENVQYRRYYRPGYRPGAYYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRHYNGYWYPLAAFGAGAVIGGAIVAQPRYVDPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022665_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022665_2

1241034-1241121

Orphan

Consensus_repeat	Method
TTTTACGCAATTCCGGACGGAAGACCGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022665_2

>merge|NZ_CP022665|2|1241034-1241121|CRISPRCasFinder
TTTTACGCAATTCCGGACGGAAGACCGCGCCACACTTTTCCTGGAATTGCCTCTAACCTTTTACGCAATTCCGGACGGAAAACCGCGC

>NZ_CP022665|2|2|1241034-1241121|CRISPRCasFinder
TTTTACGCAATTCCGGACGGAAGACCGCGC	CACACTTTTCCTGGAATTGCCTCTAACC
TTTTACGCAATTCCGGACGGAAAACCGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022665.1\|WP_018245006.1\|1245000_1246212_-\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NZ_CP022665.1\|WP_003545854.1\|1243280_1243508_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|181027
NZ_CP022665.1\|WP_018245009.1\|1242084_1242576_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169691
NZ_CP022665.1\|WP_018245018.1\|1233044_1233821_-\|methyltransferase	unknown	unknown	gnl\|CDD\|226608
NZ_CP022665.1\|WP_018245019.1\|1231686_1233027_+\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP022665.1\|WP_018245007.1\|1243575_1244328_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|223433
NZ_CP022665.1\|WP_018516570.1\|1238126_1238678_+\|molybdenum-cofactor-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|131715
NZ_CP022665.1\|WP_018245016.1\|1235313_1237146_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP022665.1\|WP_018245013.1\|1238712_1239027_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022665.1\|WP_003545870.1\|1233827_1234055_-\|DUF2007-domain-containing-protein	unknown	unknown	gnl\|CDD\|378182
NZ_CP022665.1\|WP_018245017.1\|1234163_1235180_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP022665.1\|WP_018449360.1\|1246365_1248264_-\|potassium-transporter-Kup	unknown	unknown	gnl\|CDD\|225700
NZ_CP022665.1\|WP_018245012.1\|1239209_1239728_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|237556
NZ_CP022665.1\|WP_018245015.1\|1237215_1238127_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|237765
NZ_CP022665.1\|WP_018245010.1\|1241302_1241992_+\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|234574
NZ_CP022665.1\|WP_018245011.1\|1239867_1241025_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP022665.1\|WP_018245004.1\|1248282_1249281_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213371
NZ_CP022665.1\|WP_018245008.1\|1242579_1243203_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169692
NZ_CP022665.1\|WP_012756239.1\|1244390_1244729_-\|F0F1-ATP-synthase-assembly-protein	unknown	unknown	gnl\|CDD\|227641
NZ_CP022665.1\|WP_018245003.1\|1249299_1249536_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022665.1\|WP_018245006.1\|1245000_1246212_-\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	3.6325e-86
NZ_CP022665.1\|WP_003545854.1\|1243280_1243508_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|181027	PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated.	7.89276e-27
NZ_CP022665.1\|WP_018245016.1\|1235313_1237146_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	8.40845e-25
NZ_CP022665.1\|WP_018245018.1\|1233044_1233821_-\|methyltransferase	gnl\|CDD\|226608	COG4123, COG4123, Predicted O-methyltransferase [General function prediction only].	3.98311e-83
NZ_CP022665.1\|WP_018245019.1\|1231686_1233027_+\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	0
NZ_CP022665.1\|WP_018245007.1\|1243575_1244328_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|223433	COG0356, AtpB, F0F1-type ATP synthase, subunit a [Energy production and conversion].	1.3456e-65
NZ_CP022665.1\|WP_018516570.1\|1238126_1238678_+\|molybdenum-cofactor-biosynthesis-protein-B	gnl\|CDD\|131715	TIGR02667, Molybdenum_cofactor_biosynthesis_protein_B., molybdenum cofactor biosynthesis protein B, proteobacterial. This model represents the MoaB protein molybdopterin biosynthesis regions in Proteobacteria. This crystallized but incompletely characterized protein is thought to be involved in, though not required for, early steps in molybdopterin biosynthesis. It may bind a molybdopterin precursor. A distinctive conserved motif PCN near the C-terminus helps distinguish this clade from other homologs, including sets of proteins designated MogA. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	1.5737e-95
NZ_CP022665.1\|WP_018245009.1\|1242084_1242576_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169691	PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated.	1.94282e-71
NZ_CP022665.1\|WP_003545870.1\|1233827_1234055_-\|DUF2007-domain-containing-protein	gnl\|CDD\|378182	pfam09413, DUF2007, Putative prokaryotic signal transducing protein. This is a family of putative prokaryotic signal transducing proteins of Pii-type.	3.811e-22
NZ_CP022665.1\|WP_018245017.1\|1234163_1235180_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	2.47616e-108
NZ_CP022665.1\|WP_018449360.1\|1246365_1248264_-\|potassium-transporter-Kup	gnl\|CDD\|225700	COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism].	0
NZ_CP022665.1\|WP_018245012.1\|1239209_1239728_-\|glycosyl-transferase	gnl\|CDD\|237556	PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional.	4.88503e-06
NZ_CP022665.1\|WP_018245015.1\|1237215_1238127_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|237765	PRK14608, PRK14608, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	4.74195e-150
NZ_CP022665.1\|WP_018245010.1\|1241302_1241992_+\|ribonuclease-HII	gnl\|CDD\|234574	PRK00015, rnhB, ribonuclease HII; Validated.	6.4154e-104
NZ_CP022665.1\|WP_018245011.1\|1239867_1241025_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	2.13014e-24
NZ_CP022665.1\|WP_018245004.1\|1248282_1249281_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	4.61724e-155
NZ_CP022665.1\|WP_018245008.1\|1242579_1243203_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169692	PRK09174, PRK09174, F0F1 ATP synthase subunit B.	4.41887e-88
NZ_CP022665.1\|WP_012756239.1\|1244390_1244729_-\|F0F1-ATP-synthase-assembly-protein	gnl\|CDD\|227641	COG5336, COG5336, Uncharacterized protein conserved in bacteria [Function unknown].	1.04393e-37

>NZ_CP022665.1|WP_018245011.1|1239867_1241025_+|PA0069-family-radical-SAM-protein
MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLNPTGRFEALQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDIPFDRSINPYRGCEHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRVIAIGTNTDPYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTTLDRKLARTMEPRAATPPRRLETIRTLAEAGVQTAVMAAPLIPALNDHELERILESAKAAGAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGAGPYAWQIARRFEMAARRFGLTRRSVPLRDDLFVPPDGSGVQLSLL
>NZ_CP022665.1|WP_018245012.1|1239209_1239728_-|glycosyl-transferase
MLTVVLECQDQESELAQTLSVLVAGAVEGLVSDVVVLDHGSRDGTSRVADAAGCRFHSQWDIKDIVRSARGEWLLFVEPGARPQAGWIDEIAEYVALNKLPARFTASRGYRRPFFQRVGRAVPPLELGFLLPKKQALAIAKSGMRLTEFVKGQKPRKLASELIPSWVARAAR
>NZ_CP022665.1|WP_018245013.1|1238712_1239027_-|hypothetical-protein
MVRNMIYGLIAVILPTLVIAHPHSAASQMMRSCAGRPEIVNFLDKNFAEKLTAVGLINENAILEVYAAESGTWTLIVTDVHGISCVLLSGDSWDTMPVLPGLAT
>NZ_CP022665.1|WP_018516570.1|1238126_1238678_+|molybdenum-cofactor-biosynthesis-protein-B
MAGLDEKRPFIAVGIAVLTISDTRTPETDKSGDTLAARITEAGHRLVDRGIVPDDRAEIAARVKAWTDREDIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGFSAIFHRISYEKIGTATIQSRATAGVANSTFIFVLPGSPGACRDAWDGILKGQLDYRSAPCNFVEIMPRLDEHLKRGATK
>NZ_CP022665.1|WP_018245015.1|1237215_1238127_+|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MMSSENRSDFSASCSSISEEARAKINLALHVTGQRPDGYHLLDMLVTFTDHGDRLDFMRSPTDEFTLSGRFGETLAGDGGTNLVLKARDLLREAIGPLAFPVRIQLEKNLPVASGIGGGSADAAATLRGLMRLWGTSLPEEALAALALKLGADVPMCLASRPLIARGIGEKIEPVPELPVLAMVLANPLKGVSTPEVFRQLATKNNPALSLPPSRPLAADWLAAIAAARNDLEPPARELVPEIAAISAMLQANGALLTRMSGSGATCFGIFATMAAAEDAAAALHDERPDWYFQATETVSGGA
>NZ_CP022665.1|WP_018245016.1|1235313_1237146_+|tetratricopeptide-repeat-protein
MRQRLAIRLLTSAALAAVLSLGSVGGVNAEDAAKADDAGTAAHFDADSVTSFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKEGVKYANDLKGDPSVERITTIVRGMDAVRRDDYKTAESILKYKGPNDLDRMMNDLLLAWARVGAGRGKEALAMVEKMKGPDWFRIFQNYNAGAIAIAIGDVKSARQHLNDAVLDKEGGATAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSVEKNEKQEQQVKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQMDRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALIASDPKDIRSYLAYGSVLSDAKDYQAMATNYDKAVDAIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKALELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFDDAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALSSEPEAAEIPKIKDKVANGLPPASDDAKAADKKQPDPAPVIPPPVDKKS
>NZ_CP022665.1|WP_018245017.1|1234163_1235180_+|polyprenyl-synthetase-family-protein
MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASLFDYRGENHVKLATSVEFMHTATLLHDDVVDESDLRRSKPTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDANLEKALGLITKYGTLSDTIGRAIHYGTIARDALAPLPDTVWKSALMEVIDFCIERVN
>NZ_CP022665.1|WP_003545870.1|1233827_1234055_-|DUF2007-domain-containing-protein
MHELIRANDPVLLSYAESLMKDAGIHCFIADQGMSVLEGSLGMLSRRLLVDEEMADQARRILTDAGLGGELRERK
>NZ_CP022665.1|WP_018245018.1|1233044_1233821_-|methyltransferase
MTGETADTIDAFHRGAFHVVQPKGRGHRSGMDAMLLAALVADDRPVRVADLGAGAGAAGLAVASRLADSQVVLFERSAEMADYARRSILLPDNAHIANRVSVVEADVTLTAKARNDAGLTDESFHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPGGQMSLIARPQSIAEIVAACGRRFGGIEITAIHPRPGENAVRILVTGIKGSRARLSLRAPLIMHEEGSHKFSPLVDDFNNGRAAYARL
>NZ_CP022665.1|WP_018245019.1|1231686_1233027_+|Nramp-family-divalent-metal-transporter
MDVLNPNAKSGWRHERGEGSLSDVYRTVGTGRHSSRWRRAAAFAGPGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQALCARLAIASGRDLAQACRDAFPRYVSVPLWALAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFVILFLQKLGFRWVEAFIIAMLGVIAVCFGVQILLADPQWGAVLTGFFPTTDIVTNPEMLYLALGILGATVMPHNLYLHSGIVQTRAYGHTVPEKKEALTFATIDSTVALCFALLINASILILAAAAFNAHGKTDVVELGEAHSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQIVMEGFLKIRLKPWIRRLITRAIAIVPAAIVTIWYGDQGTAQLLILTQVVLSLQLSFAVFPLVMFTASKAKMGELVAPRWLSGIAYLIAVVIAGLNVKLLFDFVTG
>NZ_CP022665.1|WP_018245010.1|1241302_1241992_+|ribonuclease-HII
MKPRTSPDSPLLFDTVPLVPDFRLELKARKAGHWPVAGADEAGRGPLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDETDIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVAKVTRDRMMARAHNVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKVEDGPETDELLSQ
>NZ_CP022665.1|WP_018245009.1|1242084_1242576_-|F0F1-ATP-synthase-subunit-B
MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVTNRTALSEQKIKQAEAEAMKAVRSAAVDLAIAAAETVLAKQADAKVQSELFGNAVGQVKTRLN
>NZ_CP022665.1|WP_018245008.1|1242579_1243203_-|F0F1-ATP-synthase-subunit-B
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAARLKAEADAAVRTYEGELAAARAKSNAIGAAARDAAKAKAEEDRRAVEASLSEKIKAAELRIGEIKAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA
>NZ_CP022665.1|WP_003545854.1|1243280_1243508_-|F0F1-ATP-synthase-subunit-C
MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFSLLVALLLLFAV
>NZ_CP022665.1|WP_018245007.1|1243575_1244328_-|F0F1-ATP-synthase-subunit-A
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAASAAVAVGFLYFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFTFVLTANLLGMFPYFFTVTSQIIVTFALALLVIGTVLVYGFYKHGFHFLNVFVPSGVPGVLLPLVVTIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMYLNDAIHPGGH
>NZ_CP022665.1|WP_012756239.1|1244390_1244729_-|F0F1-ATP-synthase-assembly-protein
MADDREESLEKRRAQLGAKLATKGVETGEDEAREARAEVSRKGYAQAMKLSSEFISAIVVGALLGYLLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHPLDDKDDKK
>NZ_CP022665.1|WP_018245006.1|1245000_1246212_-|cell-wall-hydrolase
MECSRVPCPESVLRRKSPSRSKLRLIPENWVSPVIFGLAGWLIFPSVASHADLAAMLAGLDHEGENWRMVLTNSPAGSIHQAELAFAEPMVTGSISAGAGMVLPDGRKVAFTTKDKGHEDTPDEDRVNRSTKKGRVVAVEKMQPPKDFSAGSILERTKMLFTPSFDLKDRSAFVKPKIQGKEIQIATSFYKTQPVVTDNGVPAMLASLVTSNKADVLATAYAPATPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCLASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSEYHWRVARDVAMAVTSGKIWLPQVGSATHYHAVYVRPKWAKTMEKVGRIGLHVFYRTYGGGWS
>NZ_CP022665.1|WP_018449360.1|1246365_1248264_-|potassium-transporter-Kup
MSEESHPNERHMTPRKLFYLGLGSVGVVYGDIGTSPLYAFREALKPVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANGHTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPSLAEYIVPISVVILALLFVVQSRGTGAVAKFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGVVVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFLLVFPALTLNYLGQGALVLGNPMTMSDPFYLMYPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETNTGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNWSLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKTRHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVILTIRTINKPRVPSHDRYKVEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMSTSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII
>NZ_CP022665.1|WP_018245004.1|1248282_1249281_-|magnesium-transporter-CorA-family-protein
MQPERLPVITAYCSNCKSVEIRDLSHAASFPEDVVWIDMIEPTRDEELYVEKILGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEISVSRLDILSTHVFGDRARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAKELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLVASIYGMNFQIMPELTWVAGYPYSLALMVISAVIPFFFFRWKGWL
>NZ_CP022665.1|WP_018245003.1|1249299_1249536_+|hypothetical-protein
MRIVLNRIAVPNPSIDKTTPNLQAGRLFETKTTVIEHLQQNAIMAPRHMKQSREIIKTSSVKRGFSPRFPHNLGYPPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022665_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022665_3

1678963-1679036

Orphan

Consensus_repeat	Method
GGAAAACCGCTTCACACTTTTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022665_3

>merge|NZ_CP022665|3|1678963-1679036|CRISPRCasFinder
GGAAAACCGCTTCACACTTTTCCGATTGATTTGAAGTACGCAATCCCGGACGGAAAACCGCTTCACACTTTTCC

>NZ_CP022665|3|3|1678963-1679036|CRISPRCasFinder
GGAAAACCGCTTCACACTTTTCC	GATTGATTTGAAGTACGCAATCCCGGAC
GGAAAACCGCTTCACACTTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022665.1\|WP_018244618.1\|1677437_1678940_+\|altronate-dehydratase	unknown	unknown	gnl\|CDD\|377287
NZ_CP022665.1\|WP_018244623.1\|1671852_1672230_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP022665.1\|WP_018244624.1\|1671461_1671713_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022665.1\|WP_018244610.1\|1687767_1688496_-\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684
NZ_CP022665.1\|WP_018244611.1\|1685774_1686152_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022665.1\|WP_018244616.1\|1680112_1680559_+\|fucose-binding-protein	unknown	unknown	gnl\|CDD\|226632
NZ_CP022665.1\|WP_018244620.1\|1674956_1676081_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP022665.1\|WP_018244617.1\|1679083_1680103_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381387
NZ_CP022665.1\|WP_018244615.1\|1680767_1681757_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380663
NZ_CP022665.1\|WP_018244621.1\|1672840_1674838_-\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|226646
NZ_CP022665.1\|WP_018244614.1\|1681864_1683418_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP022665.1\|WP_018244612.1\|1684487_1685507_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176222
NZ_CP022665.1\|WP_018244626.1\|1669664_1670240_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379082
NZ_CP022665.1\|WP_018241007.1\|1686361_1687465_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP022665.1\|WP_018244619.1\|1676310_1677210_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP022665.1\|WP_018244622.1\|1672356_1672815_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP022665.1\|WP_026188604.1\|1688492_1689740_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP022665.1\|WP_018244613.1\|1683445_1684420_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP022665.1\|WP_018244625.1\|1670338_1671184_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225136
NZ_CP022665.1\|WP_018244627.1\|1669160_1669601_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022665.1\|WP_018244618.1\|1677437_1678940_+\|altronate-dehydratase	gnl\|CDD\|377287	pfam04295, GD_AH_C, D-galactarate dehydratase / Altronate hydrolase, C-terminus. Family members include the C termini of D-galactarate dehydratase (EC:4.2.1.42) which is thought to catalyze the reaction D-galactarate = 5-keto-4-deoxy-D-glucarate + H2O, and altronate hydrolase (altronic acid hydratase, EC:4.2.1.7), which catalyzes D-altronate = 2-keto-2-deoxygluconate + H2O. As purified, both enzymes are catalytically inactive in the absence of added Fe2+, Mn2+, and beta-mercaptoethanol. Synergistic activation of altronate hydrolase activity is seen in the presence of both iron and manganese ions, suggesting that the enzyme may have two ion binding sites. Mn2+ appears to be part of the enzyme active centre, but the function of the single bound Fe2+ ion is unknown. The hydratase has no Fe-S core.	0
NZ_CP022665.1\|WP_018244623.1\|1671852_1672230_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	9.48296e-10
NZ_CP022665.1\|WP_018244612.1\|1684487_1685507_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176222	cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.35184e-153
NZ_CP022665.1\|WP_018241007.1\|1686361_1687465_+\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	2.71501e-07
NZ_CP022665.1\|WP_018244616.1\|1680112_1680559_+\|fucose-binding-protein	gnl\|CDD\|226632	COG4154, FucU, Fucose dissimilation pathway protein FucU [Carbohydrate transport and metabolism].	3.03858e-63
NZ_CP022665.1\|WP_018244620.1\|1674956_1676081_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	0.000639885
NZ_CP022665.1\|WP_018244617.1\|1679083_1680103_+\|aldo/keto-reductase	gnl\|CDD\|381387	cd19161, AKR_AKR15A1, Microbacterium luteolum pyridoxal 4-dehydrogenase (PLD) and similar proteins. Microbacterium luteolum PLD (EC1.1.1.107) is a founding member of aldo-keto reductase family 15 member A1 (AKR15A1). It catalyzes irreversible oxidation of pyridoxal.	2.69297e-165
NZ_CP022665.1\|WP_018244615.1\|1680767_1681757_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380663	cd20008, PBP1_ABC_sugar_binding-like, monosaccharide ABC transporter substrate-binding protein such as CUT2. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	9.54327e-115
NZ_CP022665.1\|WP_018244621.1\|1672840_1674838_-\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_CP022665.1\|WP_018244614.1\|1681864_1683418_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP022665.1\|WP_018244626.1\|1669664_1670240_+\|AAA-family-ATPase	gnl\|CDD\|379082	pfam13238, AAA_18, AAA domain.	2.26164e-06
NZ_CP022665.1\|WP_018244610.1\|1687767_1688496_-\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	5.03372e-88
NZ_CP022665.1\|WP_018244619.1\|1676310_1677210_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.23397e-37
NZ_CP022665.1\|WP_018244622.1\|1672356_1672815_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	3.04258e-14
NZ_CP022665.1\|WP_026188604.1\|1688492_1689740_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.48155e-26
NZ_CP022665.1\|WP_018244613.1\|1683445_1684420_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	2.45636e-82
NZ_CP022665.1\|WP_018244625.1\|1670338_1671184_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|225136	COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].	3.53723e-31

>NZ_CP022665.1|WP_018244618.1|1677437_1678940_+|altronate-dehydratase
MDKLPWIILSAGDNVAVATAAIAPGSTVAGIQTREKIDPGHKVAIADIPLGSPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLAATANSAPETATTDDKARTFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYEGIDGFVPIVHDQGCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNIQDAGGSRRAVERAMGMLREIAADVGKERRVAMSIGEIIIGLQCGGSDGFSGITANPALGVAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVAKKLDDKIAWWEDYVALHGASLDNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVSATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDATISGKGREIFDLIVDTASGKKTKSELFGYGDNEFVPWHLGATL
>NZ_CP022665.1|WP_018244619.1|1676310_1677210_-|GntR-family-transcriptional-regulator
MARQNTVFKEAYNRYAAALRTDTALPSEPEIAAQLGVSRSTARAILTRLSEEGIIRWNKRQKIVLRQPTDHDLFPSEETDSLHDIIERSFMQRILADDAAPGMQINELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFELHSAAEFGRLSRDNQSWADLAAIRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNRFIADFYDAIAIVFHYHYQWNKTAARQRNERAIHEHLDYIAALESRDQAAIETACRAHLHSARQTLLQSLPQIATETA
>NZ_CP022665.1|WP_018244620.1|1674956_1676081_-|MFS-transporter
MENTFAPSSNIEWTLADFLSTYRYWALFFSSLLLAIGGQGFSTVLPLISQMTGSSAQTIGIFYFGSTLGWVAGAFLAFIVASRHGRSALISPILVCAIVAISFLPAPALWGSPAFLFLFGVVFGTVRAVFPLAIAIFLVGGQPGKIDFGCALTLLSTTILISAFAPIGASWLYGLDLGAVPVVSAFLACLLLAVILLVPAGNLAFDEAPRPRHTPLAPRRRSPLLVAVILFTPPILILLMAFGVHLFQANDADVTSSPVTLLLALLVFGIAVAAFIYLAYWVYRTHGELAGAARSQRLLTPLAGMLIAILVPLGLPVLVMTLGDLLNDRARDRGHGSLISIAWLGIWSFILPPVAIGMIQNAANESYGMGSDAA
>NZ_CP022665.1|WP_018244621.1|1672840_1674838_-|ABC-transporter-ATP-binding-protein/permease
MADAKLKPKSVDGTEPHGAEKSRQETASTAEVALPPDAIDPDPELTPEEAEQARRRYLLKRFWISARRYWGRGGDKLAWPCTIGLLTLIGMNVGFQYGINLWNRAIFDALEQHNARTVYFLSVVFLPLALGTAALVTTQVALRMMIQRRWRSWLTTAVIARWLASGRYYQLNLIGGDHKNPEARIAEDLRIATEAPVDFISGVIAAFLSASTFIVVLWTIGGALTVTIAGWTVTIPGFLVVTAVLYAAITSSSMTVIGRHFVRVSEAKNQAEAEFRYTLTHVRENGESIALLGGEEEERNDLGKTFANVLRQWALLARQHMRTALVSQGSSLFAPVVPVLLCAPKFLEGSMTLGQVMQAASAFAIVQSAFGWLVDNYPRLADWNACARRIASLMMSLDGLERAEQSNALGRIKRGETEGDAMLSLNDLSVSLDDGTAVVKETQVVIEPGERVLVAGESGSGKSTLVRAIAGLWPWGEGSVNFHADRRLFMLPQRPYIPSGTLRRAVAYPGAADSWTPDEIKAALDKVGLDYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHHPDIIVLDEATSALDEKSQDKMMQMVIDELPEVTIVSVAHRAELEAFHSRKITLERREGGAKLVSDIDLVPRKRKRNLLSRVLKNPSLPKNSTTSNKDSAVPE
>NZ_CP022665.1|WP_018244622.1|1672356_1672815_+|winged-helix-turn-helix-transcriptional-regulator
MNEDVLSTPGHLISLAARGFARLSESRLKPLGFGVGQLPVLVALQNGKASTQRDLARFARIEQPPMAQMLARMERDGLIERTRDPADGRSSRIVLTRTAQERMPEAITTLFQGNREALTGFTGAEAGQLVDLLKRLIENLDQIANAEASSGD
>NZ_CP022665.1|WP_018244623.1|1671852_1672230_-|nuclear-transport-factor-2-family-protein
MSNNDVEMIKRIYASFNARDIDAVLAVLSDDVAWANGMDGGHINGREAVRDYWGRQWAMISPHVEPVAFEETEEGAVAVEVIQSVFDLDGRPLEGQAHGLKDKTVTHIFRMEGDKIVRFDIQDAL
>NZ_CP022665.1|WP_018244624.1|1671461_1671713_+|hypothetical-protein
MQPGCMHQPWRNKIIKIMVLLHSADGMAWQSPPKGTSLKTLSEAEEQGFILIRGEFQKRQFRLTELGSDYVERDKRRLEARRL
>NZ_CP022665.1|WP_018244625.1|1670338_1671184_-|methyltransferase-domain-containing-protein
MSANLDDIRNQQRETWDKFSAGWKKWDSLVLGWLAPFGDAMLRRANLSNGFSVLDIAAGTGEPGLTAAAAIPEGQVVVTDLSENMLTAAAENAARRGLKNFETRLCDAGALPFADASFDAVLCRFGFMFFPDIAAAAREMARVAKPGARVCAAVWSAPAKNPWATTIMGTIARHVDMPPPPSGSPGLFRCAGEGMMVETFKEAGLLDVAVEEVSAMMVHDAPASYWDFMTEIAAPVVAGLSRADAATREKICREVLELALQSVSDGKVHLLSTATVITGTR
>NZ_CP022665.1|WP_018244626.1|1669664_1670240_+|AAA-family-ATPase
MGVFVLLLGFPGVGKLTIAKELGSLLSAKIIDNHWFNNPILRLLDEDQTAPLPKGVWEYTGRVRQAVLDAIATYSGPSANFIFTHAGVEGDERSTRTYQQFVDAARQRAAVFVPVRLLCAEEELARRVSSPARRDYLKTTDVETSRNRSQQAVVLDIPHQHALTLDVTFTSPLESAAAIRDHVVTCLPNGS
>NZ_CP022665.1|WP_018244627.1|1669160_1669601_+|hypothetical-protein
MGYDLHITRKANWFDASPSIALDEWLEYVASDPEIQHDGFAETPAADGGVLRVEQAGICVWKGYSRGENRKNAAWLWWSGDNIVVKNPDQEIRRKMWLIAQSLEAKVQGEEGEYYDHDGEMIVMKAILAPEPSMPPDPKRPWWKFW
>NZ_CP022665.1|WP_018244617.1|1679083_1680103_+|aldo/keto-reductase
MKKRRIGKTKLEVTEISFGAAALGGLYRACPREQAMDTLQAAWDSGIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPLSFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDLGVYTHGAAKNAVHQKQFLDSGVKALEELKSSGAISAFGLGVNEVPVCLDVMRHSDLDCILLAGRYTLLDRSAVAELLPLCRQKGTSLVVGGVFNSGILATGPVPGSHFDYMPADDDVLAKVGAMEAIAKSHGVPLAAPALQFPLREAIVASVLIGTAKPSSLTRNMEIVEPRLADEIYAEFEPYTLVAPPLGAEAVRV
>NZ_CP022665.1|WP_018244616.1|1680112_1680559_+|fucose-binding-protein
MLKGIHPLLGPDLLHALKTMGHGDDIVISDANFPSGSMGPPVIRADGVSATAMAEAILTHMPLDTFVPEAAWRMEVVGDPDAMPEVCTEFQQIVSKHAGDFRIVPVERFAFYAMARKATYIVATTEFRLYGNLILKKGVVHPDEVDMA
>NZ_CP022665.1|WP_018244615.1|1680767_1681757_+|ABC-transporter-substrate-binding-protein
MSIVKSLLSRRAFTALAGAAVIATAMPATSFAADVTIPIIVKDTTSFYWQIVLAGARKAGKDLGVNVPELGAQAESDVNGQISILENAVAGKPAAVVISPTEFKALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKEMTGKEEGDIVILTNLPGVGSLEQRREGFLDQIKTKHPGLKVIADKYGDGQATTGLNMMTDLITANPNLVGVFASNLILAQGVGQAIAENKLGDKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYRMGYDGIKTALAVSKGEKVPENVDTGANLVTKANMADPKIDALLNPKIK
>NZ_CP022665.1|WP_018244614.1|1681864_1683418_+|sugar-ABC-transporter-ATP-binding-protein
MIGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQALKPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVGLSTPNEAIARGINAVHQEVVLCRHLTVAANLFLGDEVNRYGLMRKKQMEKMAQAVLDDLGFGLPAGALLSSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYISHRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELIALMINRSIEQIYHKEEIAIGETIVEVKGLSGPGFEDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPISAGEIHWRGKRVDIRNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHARESANADKQIRDLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIYRLFAKLLKDGAGIILISSYLPEVYELADRLHVFRAGKIVASHDFHAATHEQVLSEAIGV
>NZ_CP022665.1|WP_018244613.1|1683445_1684420_+|ABC-transporter-permease
MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLAVVTPSFWTPLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPVWGAIALTLLMGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTINITNEGFSNFARADLLSIPSLFWMVILVAVPSFIFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLAYILSASFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGAFILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRKSN
>NZ_CP022665.1|WP_018244612.1|1684487_1685507_+|zinc-binding-alcohol-dehydrogenase-family-protein
MKAVLCREPGVLDIVERPSPAAPAAGWVRLAVSHVGICGTDYHIFEGKHPFLEYPRVMGHEISATVLEAGDGVAMAVGTPVIVNPYLSCGQCIACRQDKPNCCTNIKVLGVHTDGAFCEEISVPAENLYAAKGVSLEAAATTEFLAIGAHAVRRSMTGAGKRALVIGAGPIGLGAAIFSRIAGHEVTLLDTSTERLQMASERFGFISGIVANEATAEAVREKTNGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGSRNATRVDFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKNGLIKAVISVGA
>NZ_CP022665.1|WP_018244611.1|1685774_1686152_+|hypothetical-protein
MKMRIASLAMTIALTMPLVVPARAQVVIQEGQGSEFYADPDDNQTETDFLQRWNRHHDQRSGWRPGRDNFGPDDAVRLLERRGYRVRDVRDVGERYLIRAWRDGDDLLVSVSRRGEIMGVVHDRE
>NZ_CP022665.1|WP_018241007.1|1686361_1687465_+|IS4-family-transposase
MSDLLQALDWDELVGRLGSAEELEASARKAGALLRKRQVGGAVDLLRLCFAYVLGRFSLRTLAAWADQRALASMSDVAMLKRLKASADWVGCLVSELLAERCPEAFAGVHSDLRLMAVDATVVAPPGPKRAYWMVHTVFDLSRLTLCSVEVTDRHEAERLSRGVKAGELRIADRAHAKAADLAEVVEAGADFLVRAPSNYPRLLDSDGQLLDRLALCREAGEKGMLDRCVMIQDGKSKVEAAARVVILPLPPEAAEKARRRARRLAAKARYRPSQAGIEMAGYLVLLTSLTADDWPPERLASTYRLRWQIELAFKRMKSLIGLEDLRAKDADLARLWINTALLAALLAEDDLPALDPEAPDSLPLAA
>NZ_CP022665.1|WP_018244610.1|1687767_1688496_-|copper-homeostasis-protein-CutC
MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMKIAARAPIPVYAMIRPHAGPFIFDGADEEAMMIDIDAVRAAGLAGVVIGANRPDGTLDMPLIHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGCERILTSGCALKATDGLDTLKRISAKAAGRIAIMPGSGIRPANVGEILQATGAREVHGSCSSPIESADPRAVAFGFEAKSTNKTDVAVVRQMRRAIEAVAG
>NZ_CP022665.1|WP_026188604.1|1688492_1689740_-|LysR-family-transcriptional-regulator
MHLGALFIASHVLTSGSVRETARRFQLSPSTVSTAIHNLETELAMKLTERASGELATLIASGRVLEGLEPIMAAIAELGQWAGHDGSAAGINEAWASRIPVKIVTMERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLGHRLFERQAQGSVLTEEGRRAYQIFMAISQAWNDLKSSADERYRRTARSLRIGSIIPTGSESWVARCLGTLVSEWNARRNNNAISLVSMTADDLREALKSGRIDVAILDSVFGLENFRHRELLQTDMVVIAPPDSTETSVADLVAGHPICMPSPRTGLGHAAMAFSYERAPNWRLRGQDITAADSLPVIVDLVANHGYVSFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACTVIIEVAARITSETVARTIRPTDAGARETAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	954009-954036	4	0.857
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	706492-706519	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	181656-181683	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	704241-704268	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	222756-222783	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1493215-1493242	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1944454-1944481	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1372448-1372475	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	367050-367077	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	865856-865883	5	0.821
NZ_CP022665_3	3.1\|1678986\|28\|NZ_CP022665\|CRISPRCasFinder	1678986-1679013	28	NZ_CP011518	Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence	168375-168402	5	0.821
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1350916-1350943	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1321840-1321867	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1324318-1324345	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021032	Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence	622202-622229	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	258416-258443	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	30844-30871	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	29755-29782	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	253950-253977	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	253944-253971	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	399798-399825	6	0.786
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	898771-898798	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	627482-627509	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	163510-163537	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	899770-899797	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	163305-163332	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	224931-224958	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	530981-531008	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1398593-1398620	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	157355-157382	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	627484-627511	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	524866-524893	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	203335-203362	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	41479-41506	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	106596-106623	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	412720-412747	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	501809-501836	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	408468-408495	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1268104-1268131	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	37297-37324	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	806481-806508	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	946149-946176	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	858468-858495	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	160074-160101	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	111114-111141	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1474887-1474914	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	224942-224969	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	529765-529792	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	104502-104529	7	0.75
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	311183-311210	8	0.714
NZ_CP022665_2	2.1\|1241064\|28\|NZ_CP022665\|CRISPRCasFinder	1241064-1241091	28	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	2033659-2033686	8	0.714
NZ_CP022665_1	1.1\|1188903\|34\|NZ_CP022665\|CRISPRCasFinder	1188903-1188936	34	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	179879-179912	9	0.735

1. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 4, identity: 0.857

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcttctagct	Protospacer
*.******************.****.*.

2. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

3. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcttttaata	Protospacer
*.******************.*.***.

4. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

5. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

6. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

7. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctccaagcg	Protospacer
********************..* *.*

8. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

9. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcttcagccc	Protospacer
*.******************.** . **

10. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.821

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaagtgccctaatcc	Protospacer
**************** ****.. * **

11. spacer 3.1|1678986|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP011518 (Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence) position: , mismatch: 5, identity: 0.821

gattgatttgaagtacgcaatcccggac	CRISPR spacer
ccgtgatttgaagtgcggaatcccggac	Protospacer
   ***********.** **********

12. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgccccagggt	Protospacer
*********************.* .. .

13. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctgaaattgcctcagaga	Protospacer
*.***********.********* .*

14. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctgaaattgcctcagaga	Protospacer
*.***********.********* .*

15. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021032 (Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaagcg	Protospacer
********************... *.*

16. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaaag	Protospacer
********************... **

17. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc--	CRISPR spacer
cacacttttcctggaattgc--tcaattga	Protospacer
********************  ..**..

18. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc--	CRISPR spacer
cacacttttcctggaattgc--tcaattga	Protospacer
********************  ..**..

19. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaaag	Protospacer
********************... **

20. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaaag	Protospacer
********************... **

21. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 6, identity: 0.786

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcttttagaa	Protospacer
*.******************.*.**.

22. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcctgaggat	Protospacer
*.********************  .. .

23. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

24. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

25. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cgcacttttcctggaattgcctgaggat	Protospacer
*.********************  .. .

26. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaggtc	Protospacer
********************... ...*

27. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaggtc	Protospacer
********************... ...*

28. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

29. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

30. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

31. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

32. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

33. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

34. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctggatg	Protospacer
********************... .*.

35. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

36. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaggtc	Protospacer
********************... ...*

37. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

38. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

39. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

40. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

41. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

42. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

43. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

44. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaggtc	Protospacer
********************... ...*

45. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

46. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctagttc	Protospacer
********************... . .*

47. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctaggtc	Protospacer
********************... ...*

48. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctctgaggg	Protospacer
********************... *.

49. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.75

cacacttttcctggaattgcctctaacc	CRISPR spacer
tacacttttcctggaagtgcctagcttc	Protospacer
.*************** *****    .*

50. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.714

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctggaggag	Protospacer
********************.   ..

51. spacer 2.1|1241064|28|NZ_CP022665|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.714

cacacttttcctggaattgcctctaacc	CRISPR spacer
cacacttttcctggaattgctggaggag	Protospacer
********************.   ..

52. spacer 1.1|1188903|34|NZ_CP022665|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.735

ccatgctttaatagtgggagcatgatgttgcccg	CRISPR spacer
tctaaattatatagttggagcatgatgttgtccg	Protospacer
.*  . **  ***** **************.***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5490 : 12469

uncultured_Caudovirales_phage(16.67%)

integrase

attL 4854:4868|attR 19522:19536

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4854:4868	attL	NA	NA	NA	NA
WP_094230631.1\|5490_6456_+	hypothetical protein	A0A2H4J6I3	uncultured_Caudovirales_phage	6.6e-15	33.7
WP_094230632.1\|6458_6869_+	recombination protein NinB	A0A076GCY8	Sinorhizobium_phage	1.6e-66	89.0
WP_094230633.1\|6865_7108_+	hypothetical protein	NA	NA	NA	NA
WP_131586062.1\|7104_7296_+	hypothetical protein	NA	NA	NA	NA
WP_094230634.1\|7292_7733_+	hypothetical protein	A0A1X9HW49	Ruegeria_phage	3.9e-23	42.2
WP_094230635.1\|7719_8067_+	HNH endonuclease	A0A0U2C107	Paracoccus_phage	1.2e-30	63.5
WP_094230636.1\|8086_8599_+	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_094230637.1\|8595_8880_+	hypothetical protein	NA	NA	NA	NA
WP_094230638.1\|8883_9066_+	hypothetical protein	NA	NA	NA	NA
WP_094230639.1\|9065_10154_+\|integrase	tyrosine-type recombinase/integrase	G8DH71	Emiliania_huxleyi_virus	3.2e-26	31.0
WP_018241855.1\|10296_10602_-	ETC complex I subunit	NA	NA	NA	NA
WP_018241852.1\|11400_11889_-	DUF192 domain-containing protein	NA	NA	NA	NA
WP_018241851.1\|11890_12469_-	CspA family cold shock protein	A0A1W6JNX5	Morganella_phage	3.9e-07	42.4
19522:19536	attR	NA	NA	NA	NA

DBSCAN-SWA_2

59892 : 73274

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018241803.1\|59892_62433_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.2e-57	48.2
WP_003558894.1\|62478_62826_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_018241802.1\|63032_63905_+	ATP-binding protein	NA	NA	NA	NA
WP_026188371.1\|64053_65658_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_018241800.1\|65898_66552_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.5e-15	34.1
WP_018241799.1\|66548_67322_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-23	30.2
WP_018241798.1\|67326_68610_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.3
WP_018241797.1\|68809_69637_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.5
WP_018241796.1\|69633_70245_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003538990.1\|70296_70488_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_018241795.1\|70671_71388_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
WP_018241794.1\|71384_72242_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-34	38.5
WP_026188370.1\|72260_73274_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.6e-24	42.6

DBSCAN-SWA_3

418997 : 429707

Synechococcus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018241582.1\|418997_421208_-	esterase-like activity of phytase family protein	E3SJA5	Synechococcus_phage	1.3e-61	35.6
WP_026188360.1\|421291_422191_-	DMT family transporter	NA	NA	NA	NA
WP_003558438.1\|422564_422840_-	DNA-binding protein HupB	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
WP_017959927.1\|423046_425464_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
WP_017963839.1\|425866_427144_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-132	58.4
WP_003547334.1\|427447_428077_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
WP_018241580.1\|428291_429707_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-12	34.1

DBSCAN-SWA_4

2787634 : 2797567

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018243701.1\|2787634_2789908_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.4e-126	41.1
WP_018243700.1\|2790560_2790782_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	52.1
WP_018243699.1\|2790796_2791201_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.5e-17	43.1
WP_018243698.1\|2791179_2793384_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.6e-211	51.4
WP_026188536.1\|2793471_2794446_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	7.3e-139	75.1
WP_018243696.1\|2794550_2795771_+	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	5.4e-14	29.7
WP_018243695.1\|2795775_2796504_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	2.9e-39	37.6
WP_026188535.1\|2796500_2796857_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_018243693.1\|2796856_2797567_-	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	2.3e-49	48.7

DBSCAN-SWA_5

3135011 : 3150804

Sinorhizobium_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094230773.1\|3135011_3135407_+	hypothetical protein	S0A5I0	Cellulophaga_phage	5.1e-06	52.2
WP_094230774.1\|3135403_3135682_+	hypothetical protein	NA	NA	NA	NA
WP_189587391.1\|3135678_3135849_+	hypothetical protein	NA	NA	NA	NA
WP_094230775.1\|3135848_3136091_+	hypothetical protein	NA	NA	NA	NA
WP_094230776.1\|3136431_3136788_+	hypothetical protein	NA	NA	NA	NA
WP_094230777.1\|3136791_3137046_+	hypothetical protein	NA	NA	NA	NA
WP_094230778.1\|3137055_3137400_+	hypothetical protein	NA	NA	NA	NA
WP_094230779.1\|3137434_3137647_+	hypothetical protein	NA	NA	NA	NA
WP_094231040.1\|3137721_3138012_+	DUF1064 domain-containing protein	B0VK09	Azospirillum_phage	3.0e-16	44.2
WP_094230780.1\|3138011_3138533_+	hypothetical protein	Q8W6G4	Sinorhizobium_phage	1.4e-40	45.6
WP_094230781.1\|3138529_3138904_+	HNH endonuclease	W8NNJ6	Microbacterium_phage	6.3e-06	29.3
WP_094230782.1\|3138900_3139263_+	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	1.2e-09	38.5
WP_145960247.1\|3139204_3139846_+	hypothetical protein	NA	NA	NA	NA
WP_189587392.1\|3139926_3140091_+	response regulator transcription factor	NA	NA	NA	NA
WP_094231041.1\|3140093_3140300_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094230785.1\|3140312_3140930_+	transcription termination/antitermination NusG family protein	A0A076G6H3	Sinorhizobium_phage	3.2e-07	25.2
WP_094230786.1\|3141531_3141756_+	hypothetical protein	NA	NA	NA	NA
WP_094230788.1\|3142288_3142552_+	hypothetical protein	NA	NA	NA	NA
WP_094230789.1\|3142593_3142842_+	hypothetical protein	NA	NA	NA	NA
WP_094231042.1\|3142834_3144376_+	hypothetical protein	A0A2I7RHB5	Vibrio_phage	3.2e-112	46.0
WP_094230790.1\|3144379_3146422_+	hypothetical protein	I3PUX6	Vibrio_phage	3.3e-125	43.3
WP_145960248.1\|3146431_3147010_-	HNH endonuclease	A0A2H5BGX6	Vibrio_virus	1.5e-22	37.2
WP_094230792.1\|3147086_3147965_+	hypothetical protein	A0A1B1INR5	uncultured_Mediterranean_phage	5.6e-05	24.5
WP_094230793.1\|3147993_3149241_+	hypothetical protein	A0A0E3M0Y6	Rhodoferax_phage	8.4e-55	36.8
WP_094230794.1\|3149262_3149496_+	hypothetical protein	NA	NA	NA	NA
WP_094230795.1\|3149492_3150173_+	hypothetical protein	NA	NA	NA	NA
WP_094230796.1\|3150162_3150804_+	hypothetical protein	A0A1B1IQM3	uncultured_Mediterranean_phage	8.2e-06	27.6

DBSCAN-SWA_6

3693507 : 3707310

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026230698.1\|3693507_3694713_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.1e-40	33.2
WP_018242983.1\|3694986_3695442_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.9e-15	38.7
WP_018242982.1\|3695445_3696336_-	hypothetical protein	NA	NA	NA	NA
WP_018242981.1\|3697005_3699015_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.9e-89	41.9
WP_018242980.1\|3699014_3700895_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.9e-72	34.6
WP_018242979.1\|3700943_3701672_+	methyltransferase domain-containing protein	A0A1X9I6N4	Streptococcus_phage	1.2e-48	42.0
WP_018242978.1\|3701836_3703024_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	2.6e-37	28.3
WP_018242977.1\|3703286_3704324_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	9.2e-15	66.7
WP_011652885.1\|3705252_3707310_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6

DBSCAN-SWA_7

4226850 : 4284123

Rhizobium_phage(30.77%)

terminase,portal,capsid,integrase,protease,plate,tail,tRNA,head

attL 4223687:4223702|attR 4238141:4238156

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4223687:4223702	attL	NA	NA	NA	NA
WP_104891249.1\|4226850_4227015_+\|terminase	terminase small subunit	NA	NA	NA	NA
WP_077988626.1\|4226987_4227554_+\|terminase	terminase small subunit	NA	NA	NA	NA
WP_018242541.1\|4227577_4227787_-	hypothetical protein	NA	NA	NA	NA
WP_018242540.1\|4227980_4228271_-	hypothetical protein	NA	NA	NA	NA
WP_018242539.1\|4228264_4228480_-	hypothetical protein	NA	NA	NA	NA
WP_018242538.1\|4228584_4229421_-	alpha/beta hydrolase	A0A0Y0ADV3	Mycobacterium_phage	2.0e-12	28.6
WP_018242537.1\|4230047_4231004_+	trypsin-like peptidase domain-containing protein	A0A1B1IRH0	uncultured_Mediterranean_phage	2.1e-13	32.7
WP_094230888.1\|4231016_4232057_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_094230889.1\|4232151_4233285_+\|integrase	site-specific integrase	I6NSG1	Burkholderia_phage	2.3e-120	58.3
WP_145960253.1\|4233318_4233501_-	hypothetical protein	NA	NA	NA	NA
WP_094230890.1\|4233487_4234780_-	hypothetical protein	NA	NA	NA	NA
WP_094230891.1\|4234852_4235137_-	pyocin activator PrtN family protein	I6NSR8	Burkholderia_phage	3.9e-24	64.7
WP_094230892.1\|4235133_4235415_-	hypothetical protein	NA	NA	NA	NA
WP_094230893.1\|4235411_4236428_-	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	4.7e-88	53.8
WP_094230894.1\|4236420_4236609_-	hypothetical protein	NA	NA	NA	NA
WP_094230895.1\|4236608_4237100_-	ASCH domain-containing protein	A0A291AUQ6	Sinorhizobium_phage	1.7e-19	42.2
WP_094231050.1\|4237103_4237307_-	hypothetical protein	R9TN97	Rhizobium_phage	1.0e-23	77.6
WP_094230896.1\|4237933_4238611_-	FAD-dependent thymidylate synthase	A0A1C9C5C1	Heterosigma_akashiwo_virus	7.3e-45	46.6
4238141:4238156	attR	NA	NA	NA	NA
WP_163927886.1\|4238607_4238838_-	DUF3310 domain-containing protein	A0A286S1S0	Arthrobacter_phage	2.6e-10	49.3
WP_094230898.1\|4238837_4239035_-	hypothetical protein	NA	NA	NA	NA
WP_094230899.1\|4239045_4240161_-	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	3.0e-88	50.4
WP_094230900.1\|4240213_4241131_-	DUF2303 family protein	R9TSA8	Rhizobium_phage	2.0e-106	62.8
WP_094230901.1\|4241154_4241499_-	hypothetical protein	R9TQI8	Rhizobium_phage	3.9e-39	66.4
WP_094230902.1\|4241535_4242051_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	8.8e-51	61.7
WP_094230903.1\|4242058_4242685_-	hypothetical protein	R9TQJ1	Rhizobium_phage	6.1e-30	40.5
WP_094230904.1\|4242681_4242990_-	hypothetical protein	NA	NA	NA	NA
WP_094230905.1\|4242989_4243199_-	hypothetical protein	NA	NA	NA	NA
WP_094230906.1\|4243278_4243485_-	hypothetical protein	NA	NA	NA	NA
WP_189587400.1\|4243617_4244400_-	S24 family peptidase	NA	NA	NA	NA
WP_163927882.1\|4244389_4244557_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_094230908.1\|4244876_4245341_+	hypothetical protein	NA	NA	NA	NA
WP_094230909.1\|4245337_4245559_+	hypothetical protein	NA	NA	NA	NA
WP_094230910.1\|4245558_4245741_+	hypothetical protein	NA	NA	NA	NA
WP_094230911.1\|4245737_4246304_+	hypothetical protein	NA	NA	NA	NA
WP_094230912.1\|4246305_4248921_+	DNA methylase N-4	R9TRS8	Rhizobium_phage	0.0e+00	78.2
WP_094230913.1\|4248917_4249373_+	hypothetical protein	NA	NA	NA	NA
WP_145960254.1\|4249363_4249879_+	hypothetical protein	NA	NA	NA	NA
WP_094230915.1\|4249882_4250083_+	hypothetical protein	NA	NA	NA	NA
WP_094230916.1\|4250079_4250376_+	hypothetical protein	R9TQK2	Rhizobium_phage	2.6e-15	47.2
WP_094230917.1\|4250365_4250587_+	hypothetical protein	NA	NA	NA	NA
WP_094230918.1\|4250579_4252007_-	hypothetical protein	NA	NA	NA	NA
WP_094230919.1\|4252102_4253317_+	hypothetical protein	R9TNC4	Rhizobium_phage	3.9e-97	49.4
WP_094231051.1\|4253345_4255151_+	DNA primase	A0A0A8IN90	Aurantimonas_phage	2.8e-59	30.7
WP_094231052.1\|4255464_4256271_+	hypothetical protein	R9TRT9	Rhizobium_phage	9.5e-60	45.8
WP_094230920.1\|4256395_4256965_+	hypothetical protein	NA	NA	NA	NA
WP_094230921.1\|4257140_4257755_+	hypothetical protein	NA	NA	NA	NA
WP_094231053.1\|4257820_4259869_+\|terminase	phage terminase large subunit family protein	G8DH41	Emiliania_huxleyi_virus	4.5e-98	34.5
WP_094230922.1\|4259850_4261527_+\|portal	phage portal protein	A0A0A8IK73	Aurantimonas_phage	4.1e-113	43.5
WP_094230923.1\|4261526_4261784_+	hypothetical protein	NA	NA	NA	NA
WP_094230924.1\|4261794_4262853_+\|protease	Clp protease ClpP	A0A0A8IKZ4	Aurantimonas_phage	1.5e-100	58.2
WP_094230925.1\|4262868_4263240_+\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	1.4e-34	64.5
WP_094230926.1\|4263252_4264281_+\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	1.0e-135	69.0
WP_094230927.1\|4264328_4264547_+	hypothetical protein	A0A0A8IK76	Aurantimonas_phage	9.6e-07	47.9
WP_094230928.1\|4264546_4264933_+	hypothetical protein	NA	NA	NA	NA
WP_094230929.1\|4264932_4265733_+	hypothetical protein	A0A0A8IKZ7	Aurantimonas_phage	1.2e-43	43.4
WP_094231054.1\|4265732_4266263_+\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_094230930.1\|4266272_4266647_+	GPW/gp25 family protein	K4I3Z7	Acidithiobacillus_phage	6.4e-19	46.6
WP_094230931.1\|4266655_4267540_+\|plate	baseplate J/gp47 family protein	A0A219VH98	Ochrobactrum_phage	3.2e-40	37.9
WP_094230932.1\|4267539_4268664_+	hypothetical protein	K4I1F8	Acidithiobacillus_phage	1.2e-20	36.6
WP_094230933.1\|4268663_4271876_+	DUF4815 domain-containing protein	A0A219VHA1	Ochrobactrum_phage	4.5e-153	32.9
WP_145960255.1\|4272047_4273094_+	hypothetical protein	NA	NA	NA	NA
WP_094230935.1\|4273096_4273576_+	hypothetical protein	A0A240F4S3	Ochrobactrum_phage	4.5e-25	52.8
WP_094230936.1\|4273621_4275085_+\|tail	phage tail protein	D5LGY7	Escherichia_phage	5.6e-42	38.1
WP_094230937.1\|4275098_4275611_+\|tail	phage major tail tube protein	Q75QK9	Wolbachia_phage	2.5e-21	37.9
WP_094230938.1\|4275677_4275953_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_094230939.1\|4276080_4278159_+\|tail	phage tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	2.4e-14	32.7
WP_094230940.1\|4278172_4278712_-	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_094230941.1\|4278778_4279237_+\|tail	phage tail protein	NA	NA	NA	NA
WP_094231055.1\|4279241_4279454_+\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	3.2e-15	56.2
WP_094230942.1\|4279455_4280595_+	phage late control D family protein	D5LGY1	Escherichia_phage	5.9e-31	29.6
WP_094230943.1\|4280608_4281067_+	hypothetical protein	NA	NA	NA	NA
WP_094230944.1\|4281068_4282058_+	hypothetical protein	A0A068C9A9	Rhizobium_phage	2.1e-80	82.9
WP_094230945.1\|4282059_4283277_+	SGNH/GDSL hydrolase family protein	A0A068CDE5	Rhizobium_phage	5.8e-202	93.2
WP_094230946.1\|4283358_4284123_+	lysozyme	A0A1B1IHU6	Skeletonema_virus	8.0e-16	39.6

DBSCAN-SWA_8

4830926 : 4841192

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003559389.1\|4830926_4831436_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4
WP_003586475.1\|4831465_4832038_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.7e-42	52.0
WP_018242018.1\|4832096_4832591_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.1e-25	37.2
WP_018242017.1\|4832727_4833003_+	hypothetical protein	NA	NA	NA	NA
WP_003539654.1\|4833145_4833301_+	hypothetical protein	NA	NA	NA	NA
WP_018242016.1\|4833655_4836493_-	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	2.0e-75	42.2
WP_018242015.1\|4836729_4837377_+	MarC family protein	NA	NA	NA	NA
WP_018242013.1\|4837477_4837987_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.6e-44	72.9
WP_018242012.1\|4838270_4841192_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1

DBSCAN-SWA_9

5034677 : 5064097

Sinorhizobium_phage(75.0%)

tail,terminase,coat,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094230982.1\|5034677_5036444_-	hypothetical protein	A0A076G7H5	Sinorhizobium_phage	3.2e-52	56.1
WP_094230983.1\|5036459_5038664_-	hypothetical protein	A0A076G8H4	Sinorhizobium_phage	8.2e-263	64.6
WP_094230984.1\|5038660_5039077_-	hypothetical protein	A0A076G6J4	Sinorhizobium_phage	7.9e-34	52.2
WP_094230985.1\|5039083_5039698_-	hypothetical protein	A0A076G707	Sinorhizobium_phage	1.0e-74	65.7
WP_094230986.1\|5039698_5040433_-	hypothetical protein	A0A076GD29	Sinorhizobium_phage	3.3e-75	56.6
WP_094230987.1\|5040435_5043285_-\|tail	phage tail length tape measure family protein	A0A076G7H2	Sinorhizobium_phage	3.6e-271	57.9
WP_094230988.1\|5043289_5043580_-	hypothetical protein	A0A076G6J1	Sinorhizobium_phage	5.1e-32	67.0
WP_094230989.1\|5043633_5044047_-	hypothetical protein	A0A076G701	Sinorhizobium_phage	7.8e-50	73.0
WP_094230990.1\|5044046_5044784_-	hypothetical protein	A0A076GD25	Sinorhizobium_phage	3.5e-101	75.1
WP_094230991.1\|5044842_5045274_-	hypothetical protein	A0A076G7G6	Sinorhizobium_phage	2.7e-61	78.3
WP_094230992.1\|5045291_5045510_+	hypothetical protein	NA	NA	NA	NA
WP_094230993.1\|5045463_5045925_-	hypothetical protein	A0A076G8G8	Sinorhizobium_phage	4.9e-45	61.4
WP_094230994.1\|5045924_5046977_-\|head	head morphogenesis protein	A0A076G6I6	Sinorhizobium_phage	2.2e-112	62.7
WP_165504651.1\|5046976_5047147_-	hypothetical protein	NA	NA	NA	NA
WP_094230995.1\|5047143_5047512_-	hypothetical protein	A0A076G8G5	Sinorhizobium_phage	2.0e-28	51.7
WP_094230996.1\|5047504_5048014_-	hypothetical protein	A0A076G6I4	Sinorhizobium_phage	1.6e-57	70.3
WP_094230997.1\|5048207_5048414_+	hypothetical protein	NA	NA	NA	NA
WP_094230998.1\|5048432_5049659_-	hypothetical protein	NA	NA	NA	NA
WP_165504652.1\|5049698_5049983_-	hypothetical protein	A0A076G6Z4	Sinorhizobium_phage	1.5e-28	65.3
WP_094231000.1\|5050134_5051169_-\|coat	coat protein	A0A076GD16	Sinorhizobium_phage	7.5e-134	67.4
WP_094231001.1\|5051181_5051628_-	hypothetical protein	A0A076G7F5	Sinorhizobium_phage	6.7e-47	62.5
WP_094231002.1\|5051629_5052751_-	hypothetical protein	A0A076G8G2	Sinorhizobium_phage	5.3e-141	71.6
WP_094231003.1\|5052757_5054134_-	DUF1073 domain-containing protein	A0A076G6H8	Sinorhizobium_phage	2.7e-187	69.0
WP_094231004.1\|5054130_5055534_-\|terminase	phage terminase large subunit	A0A0S4KXH6	Pseudomonas_phage	1.7e-75	36.8
WP_094231005.1\|5055520_5055985_-	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	5.3e-39	58.5
WP_131586068.1\|5056023_5056272_+	hypothetical protein	NA	NA	NA	NA
WP_189587402.1\|5056268_5056892_-	hypothetical protein	A0A059VJU8	Pseudomonas_phage	3.0e-53	50.0
WP_094231006.1\|5057050_5057359_+	hypothetical protein	NA	NA	NA	NA
WP_094231008.1\|5058092_5058782_-	hypothetical protein	A0A076G6H3	Sinorhizobium_phage	1.9e-32	41.7
WP_094231009.1\|5058814_5059276_-	hypothetical protein	NA	NA	NA	NA
WP_094231010.1\|5059275_5059572_-	GcrA cell cycle regulator	NA	NA	NA	NA
WP_094231011.1\|5059568_5060330_-	YdaU family protein	A0A0U2RT81	Escherichia_phage	4.0e-15	41.1
WP_094231012.1\|5060326_5060758_-	RusA family crossover junction endodeoxyribonuclease	NA	NA	NA	NA
WP_162769093.1\|5060754_5060907_-	hypothetical protein	NA	NA	NA	NA
WP_094231013.1\|5060903_5061686_-	hypothetical protein	A0A076G8E9	Sinorhizobium_phage	1.2e-110	74.7
WP_165504649.1\|5061682_5061838_-	hypothetical protein	NA	NA	NA	NA
WP_094231014.1\|5061834_5062413_-	DNA methyltransferase	M4SPS7	Rhodobacter_phage	1.6e-37	43.2
WP_094231015.1\|5062502_5062742_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_094231016.1\|5062771_5062972_-	hypothetical protein	NA	NA	NA	NA
WP_094231017.1\|5062968_5063634_-	HNH endonuclease	NA	NA	NA	NA
WP_027685080.1\|5063630_5063909_-	hypothetical protein	A0A2H4JCC5	uncultured_Caudovirales_phage	6.5e-08	51.8
WP_131712683.1\|5063905_5064097_-	hypothetical protein	A0A240F4W3	Ochrobactrum_phage	5.2e-09	60.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP022669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022669_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022669_1

136387-136494

Orphan

Consensus_repeat	Method
CGTCTTTCCCCAGATCGCCAACGAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022669_1

>merge|NZ_CP022669|1|136387-136494|CRISPRCasFinder
CGTCTTTCCCCAGATCGCCAACGAAACGCTCTAGTTCAGTATCAGACATCTTTAATCTCCTTCACGTATTCCAGCAGGCTGACGTCTTTCCCCAGATCGCCAACAAAA

>NZ_CP022669|1|1|136387-136494|CRISPRCasFinder
CGTCTTTCCCCAGATCGCCAACGAAA	CGCTCTAGTTCAGTATCAGACATCTTTAATCTCCTTCACGTATTCCAGCAGGCTGA
CGTCTTTCCCCAGATCGCCAACAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022669.1\|WP_077988141.1\|133875_134109_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022669.1\|WP_183628100.1\|135410_136046_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275310
NZ_CP022669.1\|WP_077988136.1\|142394_143501_+\|class-III-poly(R)-hydroxyalkanoic-acid-synthase-subunit-PhaC	unknown	unknown	gnl\|CDD\|130895
NZ_CP022669.1\|WP_077988132.1\|148474_149725_+\|plasmid-partitioning-protein-RepA	unknown	unknown	gnl\|CDD\|274585
NZ_CP022669.1\|WP_077988142.1\|130556_131408_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	unknown	unknown	gnl\|CDD\|224997
NZ_CP022669.1\|WP_077988145.1\|126045_127605_-\|nif-specific-transcriptional-activator-NifA	unknown	unknown	gnl\|CDD\|273817
NZ_CP022669.1\|WP_025393262.1\|133145_133325_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022669.1\|WP_077988224.1\|147135_147798_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022669.1\|WP_077988047.1\|151309_151951_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223943
NZ_CP022669.1\|WP_077988135.1\|144410_145127_-\|NPP1-family-protein	unknown	unknown	gnl\|CDD\|368532
NZ_CP022669.1\|WP_077988138.1\|139220_140447_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236239
NZ_CP022669.1\|WP_018068357.1\|127800_128097_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|225289
NZ_CP022669.1\|WP_077988225.1\|141807_142398_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370627
NZ_CP022669.1\|WP_077988144.1\|128108_129416_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|182194
NZ_CP022669.1\|WP_094231186.1\|134221_134973_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP022669.1\|WP_028756140.1\|150483_151323_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379741
NZ_CP022669.1\|WP_131706237.1\|136737_136881_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349759
NZ_CP022669.1\|WP_183628098.1\|132192_132372_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022669.1\|WP_077988137.1\|140502_141684_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341472
NZ_CP022669.1\|WP_077988143.1\|129402_130539_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	unknown	unknown	gnl\|CDD\|224936

Protein	Function_ID	Function_description	E-value
NZ_CP022669.1\|WP_094231186.1\|134221_134973_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	3.77225e-26
NZ_CP022669.1\|WP_183628100.1\|135410_136046_-\|hypothetical-protein	gnl\|CDD\|275310	TIGR04517, hypothetical_protein_RLEG3_02865, radical SAM family RiPP maturation amino acid epimerase. This model describes PoyD and its homologs. These are divergent putative radical SAM enzymes, with the classical CxxxCxxC motif but with few members approaching the cutoff score of pfam04055. PoyD appears responsible for catalyzing a unidirectional L-to-D epimerization of 18 the 48 residues in the core peptide of the first characterized polytheonamide. The RiPP (ribosomally translated natural product) precursor, and peptides encoded near many other members of this family, belong to the nitrile hydratase leader peptide (NHLP) family.	5.4674e-77
NZ_CP022669.1\|WP_077988136.1\|142394_143501_+\|class-III-poly(R)-hydroxyalkanoic-acid-synthase-subunit-PhaC	gnl\|CDD\|130895	TIGR01836, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit. This model represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (TIGR01834) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerize short-chain-length hydroxyalkanoates. [Fatty acid and phospholipid metabolism, Biosynthesis].	4.69659e-135
NZ_CP022669.1\|WP_077988142.1\|130556_131408_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	3.49354e-92
NZ_CP022669.1\|WP_077988145.1\|126045_127605_-\|nif-specific-transcriptional-activator-NifA	gnl\|CDD\|273817	TIGR01817, Nif-specific_regulatory_protein, Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, DNA interactions].	0
NZ_CP022669.1\|WP_077988138.1\|139220_140447_+\|hypothetical-protein	gnl\|CDD\|236239	PRK08322, PRK08322, acetolactate synthase large subunit.	1.5981e-161
NZ_CP022669.1\|WP_077988047.1\|151309_151951_-\|HAD-family-hydrolase	gnl\|CDD\|223943	COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only].	5.32674e-18
NZ_CP022669.1\|WP_077988135.1\|144410_145127_-\|NPP1-family-protein	gnl\|CDD\|368532	pfam05630, NPP1, Necrosis inducing protein (NPP1). This family consists of several NPP1 like necrosis inducing proteins from oomycetes, fungi and bacteria. Infiltration of NPP1 into leaves of Arabidopsis thaliana plants result in transcript accumulation of pathogenesis-related (PR) genes, production of ROS and ethylene, callose apposition, and HR-like cell death.	6.57784e-61
NZ_CP022669.1\|WP_018068357.1\|127800_128097_-\|ferredoxin-family-protein	gnl\|CDD\|225289	COG2440, FixX, Ferredoxin-like protein [Energy production and conversion].	5.43808e-43
NZ_CP022669.1\|WP_077988144.1\|128108_129416_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|182194	PRK10015, PRK10015, oxidoreductase; Provisional.	1.27088e-88
NZ_CP022669.1\|WP_077988225.1\|141807_142398_+\|hypothetical-protein	gnl\|CDD\|370627	pfam09712, PHA_synth_III_E, Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E). This entry represents the PhaE subunit of the heterodimeric class (class III) of polymerase for poly(R)-hydroxyalkanoic acids (PHAs), carbon and energy storage polymers of many bacteria. The most common PHA is polyhydroxybutyrate but about 150 different constituent hydroxyalkanoic acids (HAs) have been identified in various species.	2.00399e-11
NZ_CP022669.1\|WP_028756140.1\|150483_151323_-\|hypothetical-protein	gnl\|CDD\|379741	pfam15610, PRTase_3, PRTase ComF-like. This PRTase family is related to the ComF PRTases. These genes are found in the smaller biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress-response.	2.34496e-51
NZ_CP022669.1\|WP_131706237.1\|136737_136881_-\|hypothetical-protein	gnl\|CDD\|349759	cd02040, NifH, nitrogenase component II NifH. NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.	1.95139e-08
NZ_CP022669.1\|WP_077988132.1\|148474_149725_+\|plasmid-partitioning-protein-RepA	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	8.30106e-136
NZ_CP022669.1\|WP_077988137.1\|140502_141684_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341472	cd08193, HVD, 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. 5-hydroxyvalerate dehydrogenase (HVD) is an iron-containing (type III) NAD-dependent alcohol dehydrogenase. It plays a role in the cyclopentanol metabolism biochemical pathway. It catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. This cyclopentanol (cpn) degradation pathway is present in some bacteria which can use cyclopentanol as sole carbon source. In Comamonas sp. strain NCIMB 9872, this enzyme is encoded by the CpnD gene.	0
NZ_CP022669.1\|WP_077988143.1\|129402_130539_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.23896e-121

>NZ_CP022669.1|WP_183628100.1|135410_136046_-|hypothetical-protein
MVHSAKEHYRQIFNRRTTGEVRTLAHIKRFLECLGGDVAFKSALSENVDNPRSVTARYGIEVDPMEMLPLWHSSYRKFYREPECASWPLAVTWREYMDEMVCHRDILRDQGNMSVASPRFHAWRERQMRRCDDVLGTSAESITHPVIAFELSEGCTGGCWFCGLSAGQFKGYFEYSKEHAHLWRGVAAAVPNSSRKSRSGGLAWNRHSNVD
>NZ_CP022669.1|WP_094231186.1|134221_134973_-|IS5-family-transposase
MAGEFWLDDQQWAVIAPLLPTNQPGAHRTDDRRVISGIIHVLRSGCRWQDCPTCYGPSTTIYNRFHRWSAKGIWRRLFEALAQTTDRDLHMIDSTTAKAHRSAAGGKGGPDAEAIGRSRGGRSTKIHAVVDGCGRPIALRITPGQRGDAPVAVPLLTPLPASRLCAADTAYDSDTLRDFLTARGTQPVIPNNPTRKRIQPFDPIAYKRRNIIERTFCRLKDWRRIATRYDKLMINFEATCYIAALVIWWA
>NZ_CP022669.1|WP_077988141.1|133875_134109_+|hypothetical-protein
MTVQSISWEQDGIDSGWFFAKDVGSVRSSSRYHPGGWWFLPKWLPDTGENDVGPFKTKAAAMAQAEALTARQLANQH
>NZ_CP022669.1|WP_025393262.1|133145_133325_-|hypothetical-protein
MRSRNTLVPASGRQLDLIFKTRTLDGLSDKDRKKAISTLACLLMQAAGLAVEELNDDQH
>NZ_CP022669.1|WP_183628098.1|132192_132372_+|hypothetical-protein
MSSENMLQQAVTRLADAAKHLNIESTILERWEYPREINASPSDDPNGRRLTQVLSGLAL
>NZ_CP022669.1|WP_077988142.1|130556_131408_-|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein
MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEALQVRDRYGGEVTVLTMGPPMAEQALRKALTHGADRAVLLTDRHFAGSDTLATSYALSQAVAKIGESYGAPDIVFTGKQTIDGDTAQVGPGIAKRLNLQQLTYVTKIVSIDPTSRELMVERHAESGTQMLKSTLPCLITVLEGVNAIRRGSLDDAFRAARSPVLKWGAADAGIGELTKCGLRGSPTVVKRVFAPGPRAEKAMQMDINDKTLAEVAADTVAAIFAREPVLERKLTSHGDR
>NZ_CP022669.1|WP_077988143.1|129402_130539_-|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein
MVARKNETPANAVGRASSGKKLLKCFEDHRHVWVFMELERGKVHPVSIELLGEGRRLADKLGVQLAGVILGSSEGVGTKPAIEEAFAYGADVAYLVESPLLANYRNEPFTKALTDLVTTHKPEILLLGATTLGRDLAGAVATTLQTGLTADCTELDVDGDGSLAATRPTFGGSLLCTIYTLNSRPQMATVRSRVMATPQREDKPIGRVIQHELTMVEEAIVTKVLAFLCNDGSEQSDLANSDIVVGGGLGLGAAGNLQYLRNLATTIGGGVGCSRPLVQKGWMPADRQIGQSGHTIRPKLYIAAGISGAVQHRVGVEGADLIVAINLDQNAPIFDFAHIGVVACALEFLPALTEAFARRMPPHNSIKGMDRGRLDDQE
>NZ_CP022669.1|WP_077988144.1|128108_129416_-|FAD-dependent-oxidoreductase
MTKSKFDAIVIGAGMSGNAAAYSMARRGLKVLQLERGEHSGSKNVQGAILYANMLEAIIPNFRDDAPLERHLVEQRFWLMDDSSHTGVHYRSDDFNELKPNRYTIIRAQFDKWFSSKVREAGGTVLCETTATKLARDRSGSVIGVYTDREGGVILADVVVLAEGVNGLLGTRAGLRDMPKPENVALAVKEMHFMPEEVIAERFGLNGSEGCVIEAGGTISRGMAGLGFLYTNKESISVGIGCLVSGLAEGMENPYRLLDAFKQHPSIRPLLAGSEIKEYAAHLIPEGGFKAIPQLFGNGWVVVGDAAQLNNAVHREGSNLAMTSGLMAGEAIFQIKSRGGLMTKRNLSLYKGILDKSFVMKDLIKHKDLPSLLHTDSNNFFMTYPTLISQAAQNFVRVDGAPKINREKATAASFINARSRWGLISDAVRSAVSWR
>NZ_CP022669.1|WP_018068357.1|127800_128097_-|ferredoxin-family-protein
MKATIIERIEDKLYQNRYLVDTGRPHITVRPHLSPSPNLLALTQICPAKCYEVNEIGQVAIVSDGCLECGTCRVLCEASGDIKWNYPRGGFGVLFKFG
>NZ_CP022669.1|WP_077988145.1|126045_127605_-|nif-specific-transcriptional-activator-NifA
MIKPEARLHILYDISKELISSFPLDNLLKAAMNALVEHLRLRDGGIVIHDSGGEPWISVRAPIGHDVRSRSLTIEQADAINRVIVSGEKHFGKNSAVLPVKVNRKAIGALWIDFAQKSGDQDETLLAMIAVLIGLTCQRYHELCSDGGSVAEEQQAGQIPKIKPKSHPTQIDKIDWIVGESPALKRVLAITRIVAATNSAVLLRGESGTGKECFARAIHALSIRKSKAFIKLNCAALSETVLESELFGHEKGAFTGALLQRAGRFELANGGTLLLDEIGDVSPQFQAKLLRVLQEGEFERLGGTKTLKVDVRVICATNKNLEMAVLRGEFRADLYYRINVVPIILPPLRQRDGDISRLAQVFLEQFNKANDRNCDFGPSAIDILSKCAFPGNVRELDNCVQRTATLASSNTITSSDFACQQDQCSSALLRKADGDGIGNDAMHGLDPRDTMSGGLGAHAGTPSGAAATIEAAGLTERDRLINAMERAGWVQAKAARILGKTPRQVGYALRRHRIDVKKE
>NZ_CP022669.1|WP_131706237.1|136737_136881_-|hypothetical-protein
MAALRQIAFYGKGGIGKSTTKIVSAAVAKGLAPMEPVILLARQLNGR
>NZ_CP022669.1|WP_077988138.1|139220_140447_+|hypothetical-protein
MTRQRKNTRSPEGEKRMVKGSDLLHQFERPIASDATLNQIAARITEAKSPLLIFGAAASRAAASNLGLAADMAQFVIRTGIPFLTTQMGKGTVSESSHLYMGTPALSEGEDVHEVIDKADLILPIGHDTTEKPPFIMRKGGQEVIHIAEQRAPFEPVYSPQYQLIGEIGHSLKALGDRLEGKLPNAQALLYLREPILERTAARATEDSFALQRLVNDISEVMTPHDSILVLDNGQYKISVARNYQTNAPNTLLLDNALATMGAGLPSGIVAAMLYPLHRVMALCGDGGFQMTSQELETAVRLKLNLVIVILNNKDYGMISCKQASKGYKNFGTKFDNPDFVKLAESYHAKGTRVETPDDLVPALEAAFEGGGVHVVEVAIVHSDYKRGLTDKPRSRKAKPTKRLSDLG
>NZ_CP022669.1|WP_077988137.1|140502_141684_+|iron-containing-alcohol-dehydrogenase
MKAFTFQTPTNIRFGAGASSKIGELLKGYKAAHVLLVTDEKVWAAGLTRNAEAAIAEAGIALTVFDGVVVDAPSHVIEAAAEICRERGVDTVVAIGGGSALDTAKLVAYLAKTPDKLDAIYGVDRATGDRLPLLLVPTTAGTGSEVTPVSIVKTPNNEKKAVISPRLLPDCAILDPELTLGLPPHLTAQTGIDAMAHAIEAYTGKIKKNPISDQLALKALALLSANLRKVCADGSDLEARSEMLLGSMLAGMAFAHSPVAAVHALAYPIGEIFHEAHGLSVALVLPYVLEFNRPAAEALYAELSDVIQPGYRRQSDAADAVAFIAEIEAICRDCGVPGSLSAVGIGEGDLSKLAEDAMKQKDRLLVNNPRELDCDQARAIYASALAGRGPAAD
>NZ_CP022669.1|WP_077988225.1|141807_142398_+|hypothetical-protein
MMPFLTTRAADSSLFAVAQCGEISKTIKRMAEAPRLADMWNLDRQVYALMAAWMDVSQCMAAYHAIASVPWSKAYERYSATLADTKEGDAKDFGWRKAFDKWRDIANKELISNLRSKDFLAAQRELLLAGLELRTRQQQMTDSVAKLLGVPSQHDFDELTRQFTELRREVRASRRAQRDEAEDARGLATQPGRDES
>NZ_CP022669.1|WP_077988136.1|142394_143501_+|class-III-poly(R)-hydroxyalkanoic-acid-synthase-subunit-PhaC
MTEPRETAFNSFLKDFAENVGKFHKGADVLAGIRDEDVDVGATPKTLVMRRDKVELFRYEPTAKRIVETPVLIVYGLIGRYTIADLQPDRSLVRSLLAKGIDVWLIDWGKPGRAERWLTMDDYVDDYIHEAVHRICRETGHDKVTLLGICEGGFFATCYAALHPEKVKNLVLTITPIDFHADIDDPAASQGLLNIWTRSLAPEDIDRMVDALGVIPGEFMSLIFSLMTPMQSLTKYNVNLIDIAGDKDLLMNCLRMEKWLADRPDHPGAAGRQWLKELYQGNRLVKGRFELSGRIVDLHAIDVPVLNIYALNDHIIPPACSKALGGKIGSTDYMEIPLLSGHVGLFVSSKSQGTLTKSMVEWLQARDG
>NZ_CP022669.1|WP_077988135.1|144410_145127_-|NPP1-family-protein
MALTLPHNRRTLLTALISLCALSGPTRAADVIDHDKVQGFPDSTSGFLKTFQPYLKVYNGCVPFPAVDAAGNVSGGLNPSGAMDGHCSRSIGQVYVRAESSFRGQCAIMYAWYFPKEQNVDGPGNLGHRSGWQNVVVWTASCDSQARVNAVSYSSHGHYNRKTEPHMSGTHPLVAYQRNPFPLNPSLVDTRTRGGMQPAINWFDMTPAARHTLDTYVFGKGVPFNDYNFYYNLSKALL
>NZ_CP022669.1|WP_077988224.1|147135_147798_+|hypothetical-protein
MEVKANWVPADEVDSADYYVSEAPDGKKYALIAMHISSKVLPNWTWATFEHQNNPGRCDYTGCHDAYGAVVADVDANDVPDRPYSACAKNDALKAMMGSAGLSPVWEHYCLKGSQTDFVSATGLPTHLGNSVTEAGFADTSSCITCHARAAVNAKGIKTTPAGFVDPPMPALCPNPSGSCSPNGAPDPNWFWTNPGKLDKAAVAMQTDFIWSIARFAIGD
>NZ_CP022669.1|WP_077988132.1|148474_149725_+|plasmid-partitioning-protein-RepA
MPPTENPPQMETTSERIERRINELWDRLRERGAPDFRDRDDRTLRSFSLGEVAEILGVSGSYLRQLSIDGLGPTPGLGTAGRRSYTLRQINELRAYLASARPKEALKFCPRRREGEKLQIISVASGSASTTTSYYLAQGLALQGYRVLAIDLDPKGSLSKMFGYYFPDIGCPDHPTTMYGALRYDDDRVSMSSVIRPTHFDGLDLVPGTFELEIFERESTKRFDNEDLRHPDASIRMVDALKEVEQGYDVVVIHCGRGGFLTAGAYEAATGVLVTVRPQWPEIKSMGLSLYRFSHLVSLIEKAGRSVNYDFTKYLVTGHDPRDVSQQEAVALLRDWLGDDLLTATVWESDAIRQAWMKNRSLYELSAGEVGRSAYEQAMETLNSTNAEVMDLIAEVWGRPPMYVSRASRTAGKASS
>NZ_CP022669.1|WP_028756140.1|150483_151323_-|hypothetical-protein
MTQFEEFALYEFQSIEDAPFRPEQYSRLKFGCDEAAREMGHQMADAFFEKNASTILNGRCLMIPSPFNFVPNAANVMTMHLLDRLNNHIVDAKGNHVEYATVPRKISYMDDYGFLSGEDRKSLIAGDRFYFNSQHFEGRCLLFIDDVKITGTHQNKLVELMREQQLENKTFFLYFARYTGDRPNIESELNFAAVKSIKDLNRIVVEPSHHMTARTIKYILSADPDDLYNHFLRFRSHRYLKALYFNCLNEGYYKIQKYQANIDLIRNVVKLAEQQIPKC
>NZ_CP022669.1|WP_077988047.1|151309_151951_-|HAD-family-hydrolase
MISHISFDVWNTLVTANPSHATRRTKFLATCFDKEEAAVRNAYAEVKKWVNQQAIETGYAPSLSENIRLLMMRCNVQKDPGLIAKAFEHVFENCKPVVLDTTVRLIRSLADDGFTLSIGSNSSFISGTTMHNFLESTFGCVFRFGIYSDLLGYAKPNEAFFNKIIKSCGVAADNILHVGDDAICDLQGARSAGMRGALVGRSEDIQEAVYDAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022669_1	1.1\|136413\|56\|NZ_CP022669\|CRISPRCasFinder	136413-136468	56	NZ_CP022669	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR4, complete sequence	136413-136468	0	1.0
NZ_CP022669_1	1.1\|136413\|56\|NZ_CP022669\|CRISPRCasFinder	136413-136468	56	NZ_CP016292	Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence	228302-228357	2	0.964
NZ_CP022669_1	1.1\|136413\|56\|NZ_CP022669\|CRISPRCasFinder	136413-136468	56	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	237420-237475	5	0.911

1. spacer 1.1|136413|56|NZ_CP022669|CRISPRCasFinder matches to NZ_CP022669 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR4, complete sequence) position: , mismatch: 0, identity: 1.0

cgctctagttcagtatcagacatctttaatctccttcacgtattccagcaggctga	CRISPR spacer
cgctctagttcagtatcagacatctttaatctccttcacgtattccagcaggctga	Protospacer
********************************************************

2. spacer 1.1|136413|56|NZ_CP022669|CRISPRCasFinder matches to NZ_CP016292 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.964

cgctctagttcagtatcagacatctttaatctccttcacgtattccagcaggctga	CRISPR spacer
cgctctagttcaatatcagacatgtttaatctccttcacgtattccagcaggctga	Protospacer
************.********** ********************************

3. spacer 1.1|136413|56|NZ_CP022669|CRISPRCasFinder matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 5, identity: 0.911

cgctctagttcagtatcagacatctttaatctccttcacgtattccagcaggctga	CRISPR spacer
ggtactagttcaatatcagacatgtttaatctccttcacgtattccagcaggctga	Protospacer
 *. ********.********** ********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP022671

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4165 : 12380

Sinorhizobium_phage(50.0%)

integrase

attL 4381:4394|attR 13993:14006

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094231020.1\|4165_4852_+	helix-turn-helix transcriptional regulator	A0A291AUR9	Sinorhizobium_phage	7.1e-56	64.3
4381:4394	attL	NA	NA	NA	NA
WP_094230624.1\|5095_5404_-	hypothetical protein	A0A291AUR7	Sinorhizobium_phage	1.1e-19	48.4
WP_094230626.1\|5800_6058_+	hypothetical protein	NA	NA	NA	NA
WP_094230627.1\|6050_6260_+	hypothetical protein	NA	NA	NA	NA
WP_094230628.1\|6252_6483_+	hypothetical protein	NA	NA	NA	NA
WP_094230629.1\|6470_7481_+	hypothetical protein	NA	NA	NA	NA
WP_094230630.1\|7480_7720_+	hypothetical protein	NA	NA	NA	NA
WP_094230631.1\|7716_8682_+	hypothetical protein	A0A1B1IWT1	uncultured_Mediterranean_phage	1.0e-15	32.8
WP_094230632.1\|8684_9095_+	recombination protein NinB	A0A076GCY8	Sinorhizobium_phage	1.6e-66	89.0
WP_094230633.1\|9091_9334_+	hypothetical protein	NA	NA	NA	NA
WP_131586062.1\|9330_9522_+	hypothetical protein	NA	NA	NA	NA
WP_094230634.1\|9518_9959_+	hypothetical protein	A0A1X9HW49	Ruegeria_phage	3.9e-23	42.2
WP_094230635.1\|9945_10293_+	HNH endonuclease	A0A0U2C107	Paracoccus_phage	1.2e-30	63.5
WP_094230636.1\|10312_10825_+	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	2.8e-25	40.6
WP_094230637.1\|10821_11106_+	hypothetical protein	NA	NA	NA	NA
WP_094230638.1\|11109_11292_+	hypothetical protein	NA	NA	NA	NA
WP_094230639.1\|11291_12380_+\|integrase	tyrosine-type recombinase/integrase	A0A291AUF0	Sinorhizobium_phage	9.3e-42	34.7
13993:14006	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022668

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022665

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP022669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP022671

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection