CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022890	Bacillus subtilis strain DKU_NT_02 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL	0	0	16	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022890_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022890_1

2948716-2948821

Orphan

Consensus_repeat	Method
CAGCTGATTGCTGGTTTTGTTTTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022890_1

>merge|NZ_CP022890|1|2948716-2948821|CRISPRCasFinder
CAGCTGATTGCTGGTTTTGTTTTCTGACTTGCTGAGCGTTTGTTTCGCTAGCAAATTCAGTGCCAAATTGACCTTGACCAGCAGCTGATTGTTGGTTTTGTTTTCT

>NZ_CP022890|1|1|2948716-2948821|CRISPRCasFinder
CAGCTGATTGCTGGTTTTGTTTTCT	GACTTGCTGAGCGTTTGTTTCGCTAGCAAATTCAGTGCCAAATTGACCTTGACCAG
CAGCTGATTGTTGGTTTTGTTTTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022890.1\|WP_014479220.1\|2956179_2957040_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP022890.1\|WP_014479219.1\|2957026_2957359_-\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP022890.1\|WP_014476212.1\|2951325_2952309_+\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP022890.1\|WP_017697518.1\|2932619_2933396_+\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NZ_CP022890.1\|WP_014479222.1\|2950000_2951110_-\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP022890.1\|WP_014479226.1\|2941454_2941808_+\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP022890.1\|WP_009966836.1\|2945674_2947417_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP022890.1\|WP_003223262.1\|2948934_2949687_-\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP022890.1\|WP_015715541.1\|2943027_2944317_+\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP022890.1\|WP_095010718.1\|2952301_2954887_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP022890.1\|WP_003223272.1\|2947504_2948035_-\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP022890.1\|WP_003223285.1\|2941842_2942280_-\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP022890.1\|WP_014479218.1\|2957443_2957962_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP022890.1\|WP_003233542.1\|2949768_2949993_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022890.1\|WP_003244113.1\|2954958_2955948_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP022890.1\|WP_003233532.1\|2942402_2942876_-\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP022890.1\|WP_003243727.1\|2940362_2941247_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP022890.1\|WP_087614160.1\|2958188_2959339_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP022890.1\|WP_095010717.1\|2944536_2945598_+\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP022890.1\|WP_015252512.1\|2948178_2948523_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951

Protein	Function_ID	Function_description	E-value
NZ_CP022890.1\|WP_014479220.1\|2956179_2957040_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.76887e-38
NZ_CP022890.1\|WP_014479219.1\|2957026_2957359_-\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	7.58487e-27
NZ_CP022890.1\|WP_014476212.1\|2951325_2952309_+\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.46531e-44
NZ_CP022890.1\|WP_017697518.1\|2932619_2933396_+\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	1.09798e-154
NZ_CP022890.1\|WP_014479222.1\|2950000_2951110_-\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.39938e-157
NZ_CP022890.1\|WP_014479226.1\|2941454_2941808_+\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	7.28983e-70
NZ_CP022890.1\|WP_009966836.1\|2945674_2947417_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP022890.1\|WP_003223262.1\|2948934_2949687_-\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP022890.1\|WP_015715541.1\|2943027_2944317_+\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP022890.1\|WP_095010718.1\|2952301_2954887_-\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP022890.1\|WP_003223272.1\|2947504_2948035_-\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NZ_CP022890.1\|WP_003223285.1\|2941842_2942280_-\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP022890.1\|WP_014479218.1\|2957443_2957962_-\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	1.93802e-13
NZ_CP022890.1\|WP_003244113.1\|2954958_2955948_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NZ_CP022890.1\|WP_003233532.1\|2942402_2942876_-\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NZ_CP022890.1\|WP_003243727.1\|2940362_2941247_-\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NZ_CP022890.1\|WP_087614160.1\|2958188_2959339_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	9.5844e-41
NZ_CP022890.1\|WP_095010717.1\|2944536_2945598_+\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.15308e-89
NZ_CP022890.1\|WP_015252512.1\|2948178_2948523_-\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	7.7337e-29

>NZ_CP022890.1|WP_015252512.1|2948178_2948523_-|hypothetical-protein
MSQRVCFTEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP022890.1|WP_003223272.1|2947504_2948035_-|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP022890.1|WP_009966836.1|2945674_2947417_-|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP022890.1|WP_095010717.1|2944536_2945598_+|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAVDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIQYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP022890.1|WP_015715541.1|2943027_2944317_+|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NZ_CP022890.1|WP_003233532.1|2942402_2942876_-|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP022890.1|WP_003223285.1|2941842_2942280_-|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP022890.1|WP_014479226.1|2941454_2941808_+|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP022890.1|WP_003243727.1|2940362_2941247_-|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP022890.1|WP_017697518.1|2932619_2933396_+|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPMTVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFRRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDAEELEEVLEEILDQYAE
>NZ_CP022890.1|WP_003223262.1|2948934_2949687_-|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP022890.1|WP_003233542.1|2949768_2949993_+|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP022890.1|WP_014479222.1|2950000_2951110_-|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAVEAAAISAAP
>NZ_CP022890.1|WP_014476212.1|2951325_2952309_+|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILAGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP022890.1|WP_095010718.1|2952301_2954887_-|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVFGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYLLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFMISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSDLKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKENDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKQSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDRGFALKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NZ_CP022890.1|WP_003244113.1|2954958_2955948_-|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP022890.1|WP_014479220.1|2956179_2957040_-|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYETLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP022890.1|WP_014479219.1|2957026_2957359_-|SdpC-immunity-protein-SpdL
MTDLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NZ_CP022890.1|WP_014479218.1|2957443_2957962_-|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYAPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP022890.1|WP_087614160.1|2958188_2959339_+|IS3-family-transposase
MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQELNIKNNTQIKTWVRWYKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENRYLRQQNEVFKKVQRIGKEVDSQTSVELVEELHSTMTVQDICIHLGISRSSYYRWKKNLKKDHPKRHLEKQIGTLCREHQYRYGYRKITAILKKRMCINHKTVQRIMQKNQWQCRVKVKKRKKNGQPYAVVDNILDRNFQSDHPLEKLVTDITYLPYGQKQLYLSSILDVYNGEVIAFTIGDKQDTDFVLHTLDQLPTLPENCVLHSDQGSVYTSYEYQKAVKTKGITMSMSRKGTPADNASIESFHSSLKSETFYLNSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

129054 : 188157

Bacillus_phage(28.57%)

transposase,coat,lysis,tRNA,holin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614167.1\|129054_130243_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-31	36.6
WP_003244564.1\|130407_131040_+	GTP pyrophosphokinase YwaC	NA	NA	NA	NA
WP_095010532.1\|131069_132437_-	aminopeptidase YwaD	NA	NA	NA	NA
WP_095010533.1\|132592_133834_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_003243598.1\|134084_134600_-	tyrZ transcriptional regulator YwaE	NA	NA	NA	NA
WP_041351281.1\|134750_135464_+	TIGR02206 family membrane protein	NA	NA	NA	NA
WP_069964388.1\|135574_136435_+	glycosyltransferase family 8 protein	A0A2P0VP84	Tetraselmis_virus	1.4e-05	26.4
WP_003227349.1\|136484_137327_-	PRD domain-containing protein	NA	NA	NA	NA
WP_069964387.1\|137380_138760_-	SacY negative regulator SacX	NA	NA	NA	NA
WP_069964385.1\|141349_142672_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_026113710.1\|142763_143441_+	DUF2711 domain-containing protein	NA	NA	NA	NA
WP_003243380.1\|143479_143860_-	glyoxalase GlxA	NA	NA	NA	NA
WP_069964384.1\|143980_145168_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.2e-74	41.7
WP_015385004.1\|145202_145400_-	YwbE family protein	NA	NA	NA	NA
WP_069964383.1\|145433_146636_-	MFS transporter	NA	NA	NA	NA
WP_003227371.1\|146741_147419_-\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
WP_014481281.1\|147400_147787_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_014481280.1\|147892_148798_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_041351284.1\|148805_149624_+	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_014481278.1\|149620_150289_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_014481277.1\|150445_151888_+	ferrous ion permease EfeU	NA	NA	NA	NA
WP_014481276.1\|151884_153042_+	iron uptake system lipoprotein EfeM	NA	NA	NA	NA
WP_014481275.1\|153060_154311_+	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_014481274.1\|154593_155196_+	DsbA family protein	NA	NA	NA	NA
WP_069964382.1\|155225_156767_-	cation acetate symporter	NA	NA	NA	NA
WP_003227392.1\|156763_157072_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_003243648.1\|157514_157673_-	transcriptional regulator SlrA	NA	NA	NA	NA
WP_014481271.1\|158027_158699_+	transcriptional regulator SlrC	NA	NA	NA	NA
WP_003227398.1\|158716_159100_+	GtrA family protein	NA	NA	NA	NA
WP_014481270.1\|159177_160350_+	galactokinase	NA	NA	NA	NA
WP_095010534.1\|160353_161895_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_009968363.1\|161965_162211_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_010886637.1\|162726_163692_+	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_003227407.1\|163719_165669_+	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_003227409.1\|165682_166297_+	Quinol oxidase subunit 3	NA	NA	NA	NA
WP_069837848.1\|166298_166673_+	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_003227411.1\|166714_166978_-	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
WP_069837847.1\|167817_168195_-	hypothetical protein	NA	NA	NA	NA
WP_069837846.1\|168479_169664_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_014478349.1\|169871_170621_+	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_014481266.1\|170794_171796_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_069964381.1\|171833_174254_-\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	6.9e-21	36.8
WP_003222155.1\|174782_175085_+	hypothetical protein	NA	NA	NA	NA
WP_069837843.1\|175124_175955_+	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_014481261.1\|175993_176764_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_014481260.1\|177065_178451_+	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_014481259.1\|178447_179887_+	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.7e-22	26.8
WP_003243437.1\|179980_180229_+	hypothetical protein	NA	NA	NA	NA
WP_071581866.1\|180319_181135_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_038828109.1\|181326_182133_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003242965.1\|182146_182824_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
WP_014481256.1\|182848_184219_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_014481255.1\|184386_184704_+	YwdI family protein	NA	NA	NA	NA
WP_069964376.1\|184723_186046_+	purine permease	NA	NA	NA	NA
WP_003227446.1\|186107_186479_+	DUF423 domain-containing protein	NA	NA	NA	NA
WP_014481253.1\|186522_187068_-\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_015250957.1\|187386_188157_+\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6

DBSCAN-SWA_2

191642 : 247168

Enterobacteria_phage(20.0%)

bacteriocin,tRNA,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041054693.1\|191642_192764_+\|coat	spore coat protein	NA	NA	NA	NA
WP_017696228.1\|192756_193479_+\|coat	spore coat protein	NA	NA	NA	NA
WP_017696229.1\|193481_194501_+\|coat	spore coat protein	NA	NA	NA	NA
WP_017696230.1\|194525_195266_+	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	7.7e-48	42.0
WP_003244201.1\|195265_196213_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_069837836.1\|196226_197078_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.3
WP_069837835.1\|197070_197526_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003227472.1\|197850_198315_+	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_069964374.1\|198492_199767_+	glutamate dehydrogenase	NA	NA	NA	NA
WP_014478322.1\|199993_201541_+	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_014481239.1\|201614_203315_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_015250969.1\|203314_204727_+	amino acid permease	NA	NA	NA	NA
WP_095010536.1\|204936_206175_+	MFS transporter	NA	NA	NA	NA
WP_095010537.1\|206326_206941_+	prephenate decarboxylase	NA	NA	NA	NA
WP_003244300.1\|206930_207638_+	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_003243359.1\|207640_208402_+	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
WP_003242921.1\|208420_209839_+	alanine--anticapsin ligase	NA	NA	NA	NA
WP_014481236.1\|209835_211020_+	bacilysin exporter BacE	NA	NA	NA	NA
WP_095010538.1\|211020_212220_+	transaminase BacF	NA	NA	NA	NA
WP_046160963.1\|212234_213014_-	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_003227507.1\|213146_213911_-	heme-dependent peroxidase	NA	NA	NA	NA
WP_003235941.1\|214180_215152_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_014481233.1\|215297_216197_+	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_014481232.1\|216245_217091_+	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_095010539.1\|217259_218150_+	DMT family transporter	NA	NA	NA	NA
WP_019712820.1\|218293_219070_-	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_003222050.1\|219284_219509_+	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_095010540.1\|219670_220990_+	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	3.3e-25	29.3
WP_003227524.1\|221025_221526_+	YwgA family protein	NA	NA	NA	NA
WP_017696247.1\|221637_222108_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_095010541.1\|222107_223517_+	MFS transporter	NA	NA	NA	NA
WP_095010542.1\|224353_226270_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	8.7e-144	43.4
WP_003227535.1\|226389_226809_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003222038.1\|226851_227040_-	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_003227536.1\|227148_227808_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003244446.1\|227821_228340_+	hypothetical protein	NA	NA	NA	NA
WP_014478299.1\|228478_228913_+	hypothetical protein	NA	NA	NA	NA
WP_014481227.1\|228940_231016_-	penicillin-binding protein	NA	NA	NA	NA
WP_003227543.1\|231217_232048_+	spermidine synthase	NA	NA	NA	NA
WP_003227545.1\|232108_232981_+	agmatinase	NA	NA	NA	NA
WP_009968329.1\|233570_233690_-	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_069837832.1\|233673_234819_-	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	3.2e-77	42.7
WP_069837831.1\|236438_237815_+	YncE family protein	NA	NA	NA	NA
WP_069837830.1\|237820_238522_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_095010543.1\|238518_239799_-	insulinase family protein	NA	NA	NA	NA
WP_072592616.1\|239803_240964_-	insulinase family protein	NA	NA	NA	NA
WP_095010544.1\|240953_242264_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_069837826.1\|242256_242976_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.6
WP_003222006.1\|242972_243134_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_069837825.1\|243146_244493_-	subtilosin maturase AlbA	NA	NA	NA	NA
WP_010886632.1\|244517_244670_-\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_003222002.1\|244626_244758_-\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_014481216.1\|245072_245501_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003227570.1\|245497_247168_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_3

609406 : 617141

Anomala_cuprea_entomopoxvirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243370.1\|609406_610549_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3
WP_003228349.1\|610571_611225_+\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_080478451.1\|611244_612156_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_046160851.1\|612173_612848_+\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_024571735.1\|612879_613413_-	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_014480909.1\|613696_614842_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.7
WP_003228370.1\|614858_615512_+\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_014480908.1\|615523_616444_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014480907.1\|616460_617141_+\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA

DBSCAN-SWA_4

629151 : 637516

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480897.1\|629151_629550_-	helix-turn-helix transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
WP_014480896.1\|629784_629988_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033881244.1\|630039_630231_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
WP_033881245.1\|630255_630474_+	hypothetical protein	NA	NA	NA	NA
WP_014480895.1\|630466_631348_+	phage replisome organiser	V9QKF6	Oenococcus_phage	6.8e-27	33.1
WP_014480894.1\|631331_632159_+	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
WP_014480892.1\|632473_633022_+	hypothetical protein	NA	NA	NA	NA
WP_003237439.1\|633129_633270_+	BH0509 family protein	NA	NA	NA	NA
WP_003220282.1\|633516_633714_+	hypothetical protein	NA	NA	NA	NA
WP_014480888.1\|633756_634119_+	hypothetical protein	NA	NA	NA	NA
WP_014480887.1\|634115_634433_+	hypothetical protein	NA	NA	NA	NA
WP_014480886.1\|634429_634837_+	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
WP_014480885.1\|634833_635091_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
WP_069837783.1\|635208_635865_+	dUTPase	R9TQ23	Paenibacillus_phage	5.8e-39	46.0
WP_014480883.1\|635864_636197_+	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
WP_014480882.1\|636193_636613_+	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
WP_014480881.1\|636609_636810_+	hypothetical protein	NA	NA	NA	NA
WP_031600945.1\|637063_637516_+	hypothetical protein	S6AVV9	Thermus_phage	3.4e-38	56.6

DBSCAN-SWA_5

641200 : 665222

Bacillus_phage(100.0%)

plate,capsid,tail,terminase,portal,holin,head,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046160532.1\|641200_641575_+	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
WP_017697674.1\|641954_642488_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
WP_095010570.1\|642487_644161_+\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	1.1e-307	92.1
WP_033882051.1\|644209_644425_+	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
WP_033882052.1\|644430_645678_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
WP_095010571.1\|645667_646294_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	4.0e-106	92.3
WP_033882054.1\|646330_647533_+\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
WP_031600935.1\|647548_647863_+	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
WP_031600934.1\|647891_648383_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
WP_031600933.1\|648398_648746_+\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
WP_033882056.1\|648678_649050_+\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
WP_033882058.1\|649042_649426_+	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
WP_031600930.1\|649422_649803_+	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
WP_017696306.1\|649803_650415_+\|tail	major tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
WP_003220222.1\|650469_650808_+	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
WP_017696308.1\|650810_650990_+	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
WP_095010572.1\|651002_654881_+\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
WP_031600927.1\|654880_655720_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
WP_031600926.1\|655731_657438_+	hypothetical protein	D6R400	Bacillus_phage	9.4e-267	81.8
WP_080480874.1\|657474_659049_+	hypothetical protein	M4ZSB3	Bacillus_phage	5.3e-264	88.5
WP_069837751.1\|659085_660309_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.1e-179	80.3
WP_031600923.1\|660324_660624_+	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
WP_014480879.1\|660620_660791_+	XkdX family protein	NA	NA	NA	NA
WP_014480878.1\|660844_661267_+\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
WP_014480877.1\|661308_662250_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
WP_105778748.1\|662289_662892_-	hypothetical protein	NA	NA	NA	NA
WP_014480875.1\|663234_663624_-	hypothetical protein	NA	NA	NA	NA
WP_014480874.1\|663638_665222_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7

DBSCAN-SWA_6

941954 : 995633

Bacillus_phage(20.0%)

transposase,coat,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614167.1\|941954_943144_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-31	36.6
WP_003243556.1\|943246_943792_-	biofilm-surface layer protein BslA	NA	NA	NA	NA
WP_014480661.1\|943988_944531_-	transcriptional regulator GbsR	NA	NA	NA	NA
WP_015483611.1\|944729_946202_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_003243227.1\|946218_947427_+\|holin	choline dehydrogenase	NA	NA	NA	NA
WP_069837716.1\|947514_948093_+	molybdenum cofactor sulfurase	NA	NA	NA	NA
WP_033881498.1\|948098_948587_-	DinB family protein	NA	NA	NA	NA
WP_032727091.1\|948754_949279_+	membrane protein	NA	NA	NA	NA
WP_014480656.1\|949299_950829_+	flotillin lipid rafts scaffold protein FloT	A0A2I2L4B2	Orpheovirus	2.7e-07	27.9
WP_014480655.1\|950846_951368_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003228966.1\|951409_951988_-	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_069964279.1\|961534_962677_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_080478420.1\|962700_963732_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_069964278.1\|963728_965183_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_069964277.1\|965169_967566_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	5.8e-12	39.2
WP_003229024.1\|967596_968064_-	TspO/MBR family protein	NA	NA	NA	NA
WP_095010592.1\|968143_969217_-\|coat	spore coat kinase CotI	NA	NA	NA	NA
WP_095010593.1\|969406_970540_+\|coat	spore coat protein CotSA	NA	NA	NA	NA
WP_003229031.1\|970554_971610_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_095010594.1\|971611_972043_+	hypothetical protein	NA	NA	NA	NA
WP_046160769.1\|972116_973340_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_069964271.1\|973342_974293_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	1.3e-31	33.2
WP_004398478.1\|974289_975576_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.0e-71	34.8
WP_069964270.1\|975747_976566_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.7e-51	42.6
WP_069837712.1\|976574_977294_-	yteA family sporulation protein	NA	NA	NA	NA
WP_015251378.1\|977583_978999_+	isochorismate synthase MenF	NA	NA	NA	NA
WP_015251379.1\|978995_980738_+	2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase	NA	NA	NA	NA
WP_069322839.1\|980725_981550_+	2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase	NA	NA	NA	NA
WP_003229054.1\|981584_982400_+	1,4-dihydroxy-2-naphthoyl-CoA synthase	NA	NA	NA	NA
WP_017695439.1\|982490_983951_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.5e-74	32.9
WP_003229057.1\|983947_985063_+	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_041337039.1\|985342_986263_+	manganese ABC transporter substrate-binding protein/adhesin MntA	NA	NA	NA	NA
WP_017695441.1\|986281_987034_+	manganese ABC transporter ATP-binding protein MntB	A0A1V0SE00	Indivirus	6.0e-16	27.1
WP_095010595.1\|987039_988347_+	manganese ABC transporter permease MntC	NA	NA	NA	NA
WP_014480632.1\|989241_989400_-	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_014480631.1\|989453_990494_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_014480630.1\|990537_991869_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_003219346.1\|992074_992323_+	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_003229074.1\|992416_992980_+	carbonic anhydrase	NA	NA	NA	NA
WP_003229076.1\|992976_993204_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.8e-25	70.3
WP_003219361.1\|993332_993806_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_014477743.1\|993925_994363_+	hypothetical protein	NA	NA	NA	NA
WP_080478418.1\|994356_994533_-	YtzI protein	NA	NA	NA	NA
WP_003229083.1\|994625_995063_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.3e-47	61.4
WP_014477741.1\|995228_995633_+\|holin	holin family protein	NA	NA	NA	NA

DBSCAN-SWA_7

1190663 : 1262942

Staphylococcus_phage(20.0%)

transposase,coat,tRNA,integrase,protease

attL 1220339:1220398|attR 1231751:1231813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480507.1\|1190663_1193078_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_014480506.1\|1193271_1194210_-	ribonuclease HIII	NA	NA	NA	NA
WP_003229534.1\|1194343_1194601_+	cell division protein ZapA	NA	NA	NA	NA
WP_003229537.1\|1194607_1195141_+	CvpA family protein	NA	NA	NA	NA
WP_014480504.1\|1195214_1196927_+	DNA polymerase/3'-5' exonuclease PolX	E3T5M9	Cafeteria_roenbergensis_virus	1.4e-12	24.8
WP_014480503.1\|1196947_1199305_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	2.9e-16	43.4
WP_003237674.1\|1199319_1199724_+	DUF350 domain-containing protein	NA	NA	NA	NA
WP_069837670.1\|1199912_1201595_+	long-chain-fatty-acid--CoA ligase LcfA	A0A2H4PQM9	Staphylococcus_phage	6.0e-32	26.3
WP_014477593.1\|1201700_1202285_+	fatty acid metabolism transcriptional regulator FadR	NA	NA	NA	NA
WP_014480501.1\|1202299_1203076_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_014480500.1\|1203090_1203864_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_014480499.1\|1203899_1204877_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_033881448.1\|1205094_1206582_+	alpha-N-arabinofuranosidase	NA	NA	NA	NA
WP_003222500.1\|1206875_1207190_+	thioredoxin	A0A1V0SD63	Indivirus	3.5e-10	43.0
WP_069837669.1\|1207325_1209098_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_014480495.1\|1209467_1210694_+	aspartate kinase	NA	NA	NA	NA
WP_003222508.1\|1210737_1211184_-	YslB family protein	NA	NA	NA	NA
WP_003222512.1\|1211476_1212085_+	succinate dehydrogenase cytochrome B558	NA	NA	NA	NA
WP_003229567.1\|1212118_1213879_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_003229569.1\|1213881_1214643_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_014480494.1\|1214703_1215147_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_003184172.1\|1215262_1215487_+	spore germination protein GerE	A0A290GJH9	Caldibacillus_phage	1.2e-15	78.7
WP_003229573.1\|1215731_1216172_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010886589.1\|1216179_1216998_+	glutamate racemase	NA	NA	NA	NA
WP_003229578.1\|1217112_1218213_+	spore germination protein GerM	NA	NA	NA	NA
WP_014480493.1\|1218323_1219061_+	ribonuclease PH	NA	NA	NA	NA
WP_015251523.1\|1219073_1219670_+	XTP/dITP diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	5.5e-12	33.5
WP_003229585.1\|1219685_1220195_+	metallophosphoesterase	NA	NA	NA	NA
1220339:1220398	attL	NA	NA	NA	NA
WP_105778747.1\|1220663_1221551_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_014480491.1\|1221704_1221881_+	hypothetical protein	NA	NA	NA	NA
WP_033881452.1\|1221888_1222185_+	hypothetical protein	NA	NA	NA	NA
WP_069837668.1\|1222973_1224131_+	hypothetical protein	NA	NA	NA	NA
WP_017418302.1\|1224342_1227549_+	type I restriction-modification system endonuclease	Q5YA94	Bacillus_phage	1.7e-06	29.5
WP_069837667.1\|1227681_1229112_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	5.9e-28	25.9
WP_014480487.1\|1229108_1230428_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.3e-16	35.9
WP_087614160.1\|1231878_1233029_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
1231751:1231813	attR	NA	NA	NA	NA
WP_069837666.1\|1233163_1233988_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_038827685.1\|1234789_1235125_-	hypothetical protein	NA	NA	NA	NA
WP_014480476.1\|1235937_1237662_+	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-60	30.2
WP_004399096.1\|1237658_1238177_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_003222549.1\|1238200_1239229_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_033881607.1\|1239215_1240772_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.0e-10	39.4
WP_014480473.1\|1240792_1241890_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_003229604.1\|1241939_1243358_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_095010611.1\|1243370_1243970_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_014480470.1\|1244088_1245093_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_014480469.1\|1245320_1246595_+	trigger factor	NA	NA	NA	NA
WP_003229613.1\|1246866_1248129_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
WP_095010612.1\|1248282_1249941_+\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_014480468.1\|1250121_1252446_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
WP_003229621.1\|1252442_1253030_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_014477563.1\|1253051_1253549_-	hypothetical protein	NA	NA	NA	NA
WP_004399038.1\|1253778_1255146_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003222575.1\|1255153_1255984_+	protein HemX	NA	NA	NA	NA
WP_014480467.1\|1256016_1256961_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_014480466.1\|1256950_1257739_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_014480465.1\|1257735_1258710_+	porphobilinogen synthase	NA	NA	NA	NA
WP_014480464.1\|1258739_1260032_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_014480463.1\|1260162_1261884_+\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_014480462.1\|1261916_1262942_+\|coat	spore coat protein CotN	NA	NA	NA	NA

DBSCAN-SWA_8

1375062 : 1427282

Corynebacterium_phage(20.0%)

transposase,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229836.1\|1375062_1375572_-\|protease	cysteine protease YraA	NA	NA	NA	NA
WP_014480388.1\|1375704_1376754_-	formaldehyde dehydrogenase AdhA	A0A2K9L339	Tupanvirus	8.6e-69	41.8
WP_014480387.1\|1376884_1377079_-	carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_014480386.1\|1377261_1377684_+	aldehyde stress transcriptional regulator AdhR	NA	NA	NA	NA
WP_003246006.1\|1377946_1378246_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014480384.1\|1378261_1378459_-	hypothetical protein	NA	NA	NA	NA
WP_003229843.1\|1378477_1379614_-	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	2.2e-14	25.1
WP_009967868.1\|1379632_1380001_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_003229845.1\|1380018_1380264_-\|coat	spore coat protein F-like protein YraG	NA	NA	NA	NA
WP_004398984.1\|1380526_1380913_+	VOC family protein	NA	NA	NA	NA
WP_119123071.1\|1381055_1381157_+	hypothetical protein	NA	NA	NA	NA
WP_004399021.1\|1381427_1381787_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_004398671.1\|1381839_1382196_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_038829669.1\|1382602_1383418_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003229850.1\|1383554_1383818_-	hypothetical protein	NA	NA	NA	NA
WP_014480377.1\|1384254_1385070_+	chitosanase	A0A223LHY0	Streptomyces_phage	3.7e-19	33.2
WP_029318151.1\|1385228_1386209_-	aldo/keto reductase	NA	NA	NA	NA
WP_046160630.1\|1386344_1386875_+	RNA polymerase sigma factor SigZ	A0A1V0DZZ1	Clostridioides_phage	2.1e-07	24.8
WP_033881351.1\|1387829_1387991_+	hypothetical protein	NA	NA	NA	NA
WP_072175780.1\|1388277_1388355_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_032726255.1\|1388929_1389637_-	hypothetical protein	NA	NA	NA	NA
WP_014480371.1\|1390017_1390815_-	glutamate racemase	NA	NA	NA	NA
WP_014480369.1\|1392600_1393455_+	aminoglycoside 6-adenylyltransferase AadK	E4ZFP8	Streptococcus_phage	9.7e-95	58.6
WP_014480368.1\|1393674_1394178_+	hypothetical protein	NA	NA	NA	NA
WP_072592606.1\|1395009_1395381_+	YrdB family protein	NA	NA	NA	NA
WP_014480365.1\|1395609_1396176_+	cysteine hydrolase	NA	NA	NA	NA
WP_046160628.1\|1396837_1398070_+	cytochrome P450	NA	NA	NA	NA
WP_017697606.1\|1398339_1398615_+	barnase inhibitor	NA	NA	NA	NA
WP_021480168.1\|1398938_1399412_+	azlBCD operon transcriptional regulator AzlB	NA	NA	NA	NA
WP_095010626.1\|1400680_1402003_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_014480357.1\|1402680_1403616_+	CDF family zinc transporter CzcD	NA	NA	NA	NA
WP_095010627.1\|1403703_1404741_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	8.3e-16	26.5
WP_014480355.1\|1404860_1405727_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014480354.1\|1405852_1406818_+	DMT family transporter	NA	NA	NA	NA
WP_014477437.1\|1406835_1406979_+	YrzO family protein	NA	NA	NA	NA
WP_019712547.1\|1407268_1408573_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_031600262.1\|1408818_1410066_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_014480337.1\|1410500_1410791_-	hypothetical protein	NA	NA	NA	NA
WP_014480339.1\|1410950_1412498_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_014479891.1\|1412494_1413253_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
WP_123772462.1\|1414552_1414756_+	hypothetical protein	NA	NA	NA	NA
WP_014477426.1\|1415063_1415576_-	hypothetical protein	NA	NA	NA	NA
WP_014480334.1\|1415647_1416007_-	hypothetical protein	NA	NA	NA	NA
WP_014480333.1\|1416103_1416556_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_014480332.1\|1416654_1417095_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_014480331.1\|1417497_1417785_-	hypothetical protein	NA	NA	NA	NA
WP_014480328.1\|1419906_1421034_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.0e-91	48.8
WP_046160622.1\|1421772_1422168_-	VOC family protein	NA	NA	NA	NA
WP_014480326.1\|1423108_1423999_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014480325.1\|1424165_1425554_+	class II fumarate hydratase	NA	NA	NA	NA
WP_031600262.1\|1426034_1427282_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6

DBSCAN-SWA_9

1648111 : 1698422

Bacillus_phage(27.78%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031600262.1\|1648111_1649359_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_043857754.1\|1649553_1649859_-	hypothetical protein	NA	NA	NA	NA
WP_095010816.1\|1649871_1651287_-	lipase	NA	NA	NA	NA
WP_031600651.1\|1651336_1651702_+	DUF1433 domain-containing protein	NA	NA	NA	NA
WP_031600262.1\|1651756_1653004_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_033885488.1\|1653125_1653590_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_088272387.1\|1653984_1655100_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	1.9e-146	71.9
WP_069964197.1\|1655456_1655684_+	hypothetical protein	NA	NA	NA	NA
WP_088272385.1\|1655740_1656820_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_031600262.1\|1656906_1658154_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_031600650.1\|1658375_1659098_-	hypothetical protein	NA	NA	NA	NA
WP_031600649.1\|1659381_1660236_+	C1 family peptidase	A0A1X6WFA2	Pacmanvirus	3.4e-23	29.5
WP_033881339.1\|1660259_1660580_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_031600648.1\|1660653_1661619_+	hypothetical protein	NA	NA	NA	NA
WP_031600647.1\|1662003_1662723_-	hypothetical protein	D2XR29	Bacillus_phage	7.2e-43	37.8
WP_003230479.1\|1664781_1664994_-	spore germination protein	NA	NA	NA	NA
WP_003230483.1\|1665157_1665364_+	hypothetical protein	NA	NA	NA	NA
WP_072692690.1\|1665306_1665546_-	hypothetical protein	NA	NA	NA	NA
WP_095010640.1\|1665784_1666336_+	signal peptidase I	NA	NA	NA	NA
WP_003230488.1\|1666570_1666915_+	hypothetical protein	NA	NA	NA	NA
WP_069964193.1\|1667308_1668394_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1
WP_014480161.1\|1668404_1669052_+	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_038828558.1\|1669066_1670263_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
WP_003223915.1\|1670295_1670760_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_003223910.1\|1670872_1671247_+	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_014480159.1\|1671260_1671785_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_014477220.1\|1672064_1672820_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
WP_003223904.1\|1672809_1673403_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_014477219.1\|1673457_1673997_+	YpuI family protein	NA	NA	NA	NA
WP_014480157.1\|1674119_1675268_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.0e-23	29.5
WP_004398980.1\|1675255_1675846_+	spore maturation protein SbmA	NA	NA	NA	NA
WP_003230509.1\|1675850_1676387_+	spore maturation protein SpmB	NA	NA	NA	NA
WP_004398815.1\|1676478_1677213_+	23S rRNA pseudouridine(2605) synthase RluB	NA	NA	NA	NA
WP_014480156.1\|1677306_1677846_+	thiol-disulfide oxidoreductase ResA	NA	NA	NA	NA
WP_014480155.1\|1677842_1679471_+	cytochrome c biogenesis protein ResB	NA	NA	NA	NA
WP_014480154.1\|1679490_1680666_+	cytochrome c biogenesis protein ResC	NA	NA	NA	NA
WP_003246107.1\|1680746_1681469_+	DNA-binding response regulator ResD	W8CYM9	Bacillus_phage	2.7e-45	42.2
WP_095010641.1\|1681465_1683235_+	sensor histidine kinase ResE	W8CYF6	Bacillus_phage	9.2e-39	39.3
WP_003230521.1\|1683437_1684022_+	RNA polymerase sigma factor SigX	NA	NA	NA	NA
WP_069837608.1\|1684094_1685057_+	sigma-X negative effector	NA	NA	NA	NA
WP_014480151.1\|1685168_1685936_+	type I 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_046160519.1\|1685977_1687555_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	5.8e-37	35.4
WP_004399159.1\|1688051_1688624_+	riboflavin transporter FmnP	NA	NA	NA	NA
WP_003225461.1\|1688663_1688912_-	ferredoxin	A0A127AYY7	Bacillus_phage	1.6e-18	56.8
WP_014480149.1\|1689177_1690236_+	hypothetical protein	NA	NA	NA	NA
WP_014480148.1\|1690228_1691719_+	ATP-dependent DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	3.2e-61	39.3
WP_072173318.1\|1691778_1692348_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_004398603.1\|1692298_1693021_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_014480147.1\|1693083_1693527_+	YpbF family protein	NA	NA	NA	NA
WP_003230533.1\|1694549_1695134_+	genetic competence negative regulator	NA	NA	NA	NA
WP_003230536.1\|1695289_1696564_+	NAD-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_014480145.1\|1696671_1697646_+	YpdA family putative bacillithiol disulfide reductase	NA	NA	NA	NA
WP_014480144.1\|1697765_1698422_+\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA

DBSCAN-SWA_10

1897071 : 1907763

Bacillus_phage(75.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154217702.1\|1897071_1898508_-	NAD(P)-binding protein	A0A2K9L022	Tupanvirus	5.7e-07	23.7
WP_015251922.1\|1898635_1899193_+	SMI1/KNR4 family protein	O64022	Bacillus_phage	5.3e-102	95.1
WP_014479999.1\|1899293_1901096_+	type II toxin-antitoxin system toxin ribonuclease YobL	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
WP_003231326.1\|1901105_1901564_+	type II toxin-antitoxin system antitoxin YobK	NA	NA	NA	NA
WP_095010662.1\|1901656_1902115_+	SMI1 / KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	1.2e-67	82.2
WP_014479997.1\|1902170_1902725_+	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
WP_014479996.1\|1902784_1903318_+	GNAT family N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
WP_072592542.1\|1903606_1903690_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_033881859.1\|1903949_1904309_+	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
WP_031600262.1\|1906515_1907763_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6

DBSCAN-SWA_11

1978656 : 2045439

Bacillus_phage(58.82%)

transposase,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072592538.1\|1978656_1979049_+\|coat	outer spore coat protein CotM	NA	NA	NA	NA
WP_003231580.1\|1979282_1979711_+	DUF2621 domain-containing protein	NA	NA	NA	NA
WP_010886519.1\|1979741_1980233_-	CcdC family protein	NA	NA	NA	NA
WP_003245707.1\|1980311_1980674_-	response regulator	NA	NA	NA	NA
WP_003231585.1\|1980762_1981470_-	cytochrome c-type biogenesis protein CcdA	NA	NA	NA	NA
WP_010886518.1\|1981689_1981863_+	aspartyl-phosphate phosphatase YnzD	NA	NA	NA	NA
WP_003221221.1\|1981936_1982155_-	YneF family protein	NA	NA	NA	NA
WP_095010666.1\|1982218_1982683_-	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_014476936.1\|1982835_1984839_-	transketolase	NA	NA	NA	NA
WP_003231595.1\|1985007_1985241_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_014479938.1\|1985304_1985958_-	recombinase family protein	NA	NA	NA	NA
WP_003231598.1\|1985976_1986294_-	cell division suppressor protein YneA	NA	NA	NA	NA
WP_003238209.1\|1986443_1987061_+	repressor LexA	A0A1B2APZ1	Phage_Wrath	2.5e-15	62.3
WP_014479937.1\|1987609_1988029_-	metallothiol transferase FosB	Q2LI91	Bacillus_phage	2.0e-40	66.1
WP_031600569.1\|1988146_1988686_+	YndM family protein	NA	NA	NA	NA
WP_014479934.1\|1988712_1989471_-	gamma-polyglutamate hydrolase PghL	O64134	Bacillus_phage	3.3e-54	52.9
WP_095010667.1\|1990099_1991740_-	YndJ family transporter	NA	NA	NA	NA
WP_014479930.1\|1991721_1992354_-	DUF4166 domain-containing protein	NA	NA	NA	NA
WP_014479929.1\|1992358_1993165_-	hypothetical protein	NA	NA	NA	NA
WP_003231626.1\|1995825_1996014_-	hypothetical protein	NA	NA	NA	NA
WP_009967329.1\|1996819_1997218_-	hypothetical protein	NA	NA	NA	NA
WP_003231634.1\|1997471_1997660_+	twin-arginine translocase TatAC	NA	NA	NA	NA
WP_014479921.1\|1997834_1998035_+\|coat	spore coat protein CotC	NA	NA	NA	NA
WP_014479920.1\|1998280_1998637_+	hypothetical protein	NA	NA	NA	NA
WP_121509411.1\|1999551_1999839_+	hypothetical protein	NA	NA	NA	NA
WP_014479918.1\|1999961_2000801_-	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
WP_003231643.1\|2001075_2001240_-	hypothetical protein	NA	NA	NA	NA
WP_033881937.1\|2001646_2001910_+\|coat	spore coat protein CotU	NA	NA	NA	NA
WP_003245820.1\|2002510_2002945_-	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	2.0e-72	93.0
WP_029317844.1\|2002974_2003436_-	DUF2691 family protein	NA	NA	NA	NA
WP_033881939.1\|2005184_2006600_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_014479910.1\|2007012_2007648_+	endonuclease YncB	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
WP_014479909.1\|2008132_2009632_-	xylulokinase	NA	NA	NA	NA
WP_014479908.1\|2009782_2011120_-	xylose isomerase	NA	NA	NA	NA
WP_046381052.1\|2011357_2012512_+	ROK family protein	NA	NA	NA	NA
WP_014479906.1\|2012649_2014251_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_046381051.1\|2014281_2015673_-	MFS transporter	NA	NA	NA	NA
WP_014479902.1\|2016469_2016940_-	hypothetical protein	NA	NA	NA	NA
WP_014479901.1\|2017079_2017244_-	hypothetical protein	NA	NA	NA	NA
WP_014479898.1\|2018755_2018986_-	helix-turn-helix transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
WP_029726895.1\|2019527_2019908_-	hypothetical protein	NA	NA	NA	NA
WP_046160432.1\|2019985_2020888_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_046160431.1\|2020966_2021503_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_031600262.1\|2022086_2023334_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_072592598.1\|2024262_2024697_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_014479887.1\|2024880_2025132_-	hypothetical protein	NA	NA	NA	NA
WP_014479885.1\|2026462_2026954_-	hypothetical protein	NA	NA	NA	NA
WP_033881290.1\|2027192_2027483_-	hypothetical protein	NA	NA	NA	NA
WP_069964163.1\|2028574_2030458_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.4e-124	61.3
WP_017697662.1\|2030478_2030787_+	hypothetical protein	NA	NA	NA	NA
WP_015483256.1\|2030840_2031140_+	hypothetical protein	NA	NA	NA	NA
WP_095010668.1\|2031178_2031304_-	hypothetical protein	NA	NA	NA	NA
WP_031600540.1\|2031413_2032748_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_003238341.1\|2032806_2033214_-	transcriptional repressor GlnR	NA	NA	NA	NA
WP_014479845.1\|2033323_2034589_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_015483254.1\|2034606_2035869_-	GTPase HflX	NA	NA	NA	NA
WP_003231746.1\|2036001_2036970_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_014479843.1\|2037610_2038378_+	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
WP_087614160.1\|2038463_2039614_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003245105.1\|2039731_2040352_-	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_014478984.1\|2040512_2041865_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_003231754.1\|2041977_2042967_-	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_014479842.1\|2042984_2045087_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231758.1\|2045046_2045439_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3

DBSCAN-SWA_12

2456908 : 2504880

uncultured_Caudovirales_phage(31.82%)

plate,terminase,portal,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479598.1\|2456908_2457868_+\|protease	serine protease Isp	A0A127AWU5	Bacillus_phage	5.6e-75	49.5
WP_069837457.1\|2458283_2460572_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_003245084.1\|2460746_2461217_+	guanine deaminase	S4VYZ2	Pandoravirus	1.8e-26	45.8
WP_014479594.1\|2461464_2461875_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_014479593.1\|2462016_2462460_+	organic hydroperoxide resistance transcriptional regulator OhrR	NA	NA	NA	NA
WP_003232574.1\|2462490_2462916_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_069837456.1\|2463041_2464289_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.3e-99	50.4
WP_014479591.1\|2464300_2465398_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
WP_021479442.1\|2465748_2466651_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_014476583.1\|2466721_2467039_-	multidrug efflux SMR transporter subunit YkkD	NA	NA	NA	NA
WP_015383469.1\|2467038_2467377_-	multidrug efflux SMR transporter subunit YkkC	NA	NA	NA	NA
WP_069964129.1\|2467598_2468117_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014479587.1\|2468106_2468634_-	DinB family protein	NA	NA	NA	NA
WP_095010681.1\|2468725_2469457_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_017695103.1\|2469605_2469830_+	hypothetical protein	NA	NA	NA	NA
WP_069964128.1\|2469906_2471106_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_003232595.1\|2471343_2471862_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_003232599.1\|2472970_2474020_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_003232600.1\|2474062_2475052_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5
WP_014479583.1\|2475064_2475955_-	gamma-D-glutamyl-L-lysine dipeptidyl-peptidase	A0A0A8WIF2	Clostridium_phage	5.3e-19	45.8
WP_014479582.1\|2475971_2477051_-	dipeptide epimerase	NA	NA	NA	NA
WP_031600421.1\|2477047_2478007_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_031600419.1\|2478094_2479744_-	dipeptide ABC transporter substrate-binding protein DppE	NA	NA	NA	NA
WP_014479578.1\|2479746_2480754_-	dipeptide ABC transporter ATP-binding subunit DppD	G9BWD6	Planktothrix_phage	1.8e-15	28.7
WP_069964127.1\|2480758_2481721_-	dipeptide ABC transporter permease DppC	NA	NA	NA	NA
WP_003245446.1\|2481726_2482653_-	dipeptide ABC transporter permease DppB	NA	NA	NA	NA
WP_014479576.1\|2482669_2483494_-	D-aminopeptidase DppA	NA	NA	NA	NA
WP_014479575.1\|2483623_2484442_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_033881739.1\|2484610_2485960_+\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	3.4e-25	34.1
WP_014479573.1\|2486459_2487431_-	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.5e-62	41.3
WP_014479572.1\|2487442_2489593_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_014479571.1\|2489809_2490760_-	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_003218470.1\|2492732_2493350_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_095010682.1\|2493362_2494364_+	inorganic phosphate transporter	E5ES24	Ostreococcus_lucimarinus_virus	8.6e-10	28.7
WP_003244695.1\|2494473_2495220_+	toxin-antitoxin-antitoxin system toxin SpoIISA	NA	NA	NA	NA
WP_003232646.1\|2495219_2495390_+	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
WP_003232648.1\|2495475_2495613_+	hypothetical protein	NA	NA	NA	NA
WP_021479459.1\|2495650_2496544_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.8e-83	69.7
WP_014479566.1\|2496556_2496820_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
WP_069964126.1\|2496832_2497102_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	63.6
WP_014479564.1\|2497154_2497994_-	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_014479563.1\|2498040_2498205_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
WP_046160312.1\|2498201_2498531_-\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.0e-15	42.3
WP_069964125.1\|2498542_2500606_-\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
WP_003232665.1\|2500608_2500881_-	hypothetical protein	NA	NA	NA	NA
WP_014476551.1\|2500877_2501456_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
WP_003232669.1\|2501439_2502486_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_014479560.1\|2502478_2502904_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
WP_003244812.1\|2502961_2503228_-	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_003245730.1\|2503227_2504205_-	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_014479559.1\|2504220_2504880_-	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2

DBSCAN-SWA_13

2510057 : 2527307

Bacillus_phage(35.29%)

portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479556.1\|2510057_2510504_-	hypothetical protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
WP_014479555.1\|2510595_2511039_-	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
WP_014479554.1\|2511040_2512441_-	hypothetical protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
WP_003232679.1\|2512437_2512656_-	hypothetical protein	NA	NA	NA	NA
WP_003232680.1\|2512659_2513100_-	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
WP_003245226.1\|2513112_2513598_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_009967053.1\|2513594_2513951_-	YqbH/XkdH family protein	NA	NA	NA	NA
WP_014479552.1\|2513947_2514331_-	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
WP_003232690.1\|2514352_2515288_-	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_014479551.1\|2515313_2516141_-	hypothetical protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
WP_032725514.1\|2516160_2517648_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_003232697.1\|2517651_2518953_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
WP_003244697.1\|2518949_2519747_-\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
WP_095010683.1\|2519862_2520372_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.4e-21	38.6
WP_121591707.1\|2520492_2520687_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_021479479.1\|2520690_2521041_-	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_003245588.1\|2521125_2521293_-	hypothetical protein	NA	NA	NA	NA
WP_080478406.1\|2521292_2522093_-	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
WP_003232710.1\|2521992_2522829_-	hypothetical protein	S6BFM4	Thermus_phage	6.7e-24	27.8
WP_003232712.1\|2522815_2522995_-	hypothetical protein	NA	NA	NA	NA
WP_003232719.1\|2523173_2523515_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_003232721.1\|2523677_2524274_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_014476529.1\|2525936_2526314_+	PH domain-containing protein	A5GYQ0	Lactococcus_phage	4.7e-17	42.3
WP_014479545.1\|2526353_2527307_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8

DBSCAN-SWA_14

2567821 : 2615958

Bacillus_phage(42.86%)

transposase,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479511.1\|2567821_2568301_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_009967031.1\|2568529_2568925_+	hypothetical protein	NA	NA	NA	NA
WP_014479509.1\|2569143_2569650_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_031600262.1\|2569697_2570945_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_072592525.1\|2571017_2571509_-	YjdF family protein	NA	NA	NA	NA
WP_014479507.1\|2571678_2572626_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_014479506.1\|2572640_2574593_-	PTS mannose transporter subunit IIABC	NA	NA	NA	NA
WP_014479505.1\|2574741_2576688_-	mannose transport/utilization transcriptional regulator ManR	NA	NA	NA	NA
WP_033881593.1\|2576995_2577313_-	hypothetical protein	NA	NA	NA	NA
WP_080480846.1\|2577427_2577745_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_046160292.1\|2579267_2579687_-	hypothetical protein	NA	NA	NA	NA
WP_046160291.1\|2579705_2580209_-	hypothetical protein	NA	NA	NA	NA
WP_046160290.1\|2580600_2581086_+	hypothetical protein	NA	NA	NA	NA
WP_157698102.1\|2581690_2581861_+	hypothetical protein	NA	NA	NA	NA
WP_095010695.1\|2582043_2582436_-	hypothetical protein	NA	NA	NA	NA
WP_095010696.1\|2582450_2582762_-	hypothetical protein	NA	NA	NA	NA
WP_041351654.1\|2582943_2583171_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_153529706.1\|2583232_2583385_+	hypothetical protein	NA	NA	NA	NA
WP_069837436.1\|2583424_2583712_+	hypothetical protein	NA	NA	NA	NA
WP_069837435.1\|2585019_2586435_-	lipase	NA	NA	NA	NA
WP_069837434.1\|2586485_2586851_+	DUF1433 domain-containing protein	NA	NA	NA	NA
WP_069837433.1\|2586890_2587691_-	hypothetical protein	NA	NA	NA	NA
WP_069837432.1\|2587877_2588522_-	hypothetical protein	NA	NA	NA	NA
WP_069837431.1\|2588762_2589545_-	hypothetical protein	NA	NA	NA	NA
WP_014479487.1\|2591845_2592061_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_031600382.1\|2592126_2593644_+	glycosyltransferase	NA	NA	NA	NA
WP_095010697.1\|2595340_2596510_-	hypothetical protein	M4ZSB3	Bacillus_phage	4.1e-88	41.8
WP_106610850.1\|2597449_2597725_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014479481.1\|2597890_2598262_+	helix-turn-helix domain-containing protein	A0A2H4J6F9	uncultured_Caudovirales_phage	5.1e-16	46.8
WP_014479480.1\|2598624_2599146_+	hypothetical protein	NA	NA	NA	NA
WP_010329852.1\|2599158_2599506_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.6e-18	67.6
WP_014479476.1\|2601543_2602734_+	DUF819 domain-containing protein	NA	NA	NA	NA
WP_014479474.1\|2603380_2604553_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_003232857.1\|2604545_2605667_-	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	3.7e-17	26.3
WP_003245358.1\|2606022_2606745_+	esterase family protein	NA	NA	NA	NA
WP_003232861.1\|2606781_2607297_+	hypothetical protein	NA	NA	NA	NA
WP_014479473.1\|2607300_2607723_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_087614160.1\|2607877_2609027_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003232866.1\|2609084_2609339_-	hypothetical protein	NA	NA	NA	NA
WP_014479472.1\|2609455_2611735_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	3.5e-91	34.9
WP_014479471.1\|2611808_2612063_-	sporulation-specific transcription regulator SopVIF	NA	NA	NA	NA
WP_003232872.1\|2612195_2612345_-	sporulation protein YjcZ	NA	NA	NA	NA
WP_014479470.1\|2612426_2612633_-	hypothetical protein	NA	NA	NA	NA
WP_014476457.1\|2612914_2613271_-	sporulation protein YjcA	NA	NA	NA	NA
WP_014479468.1\|2613430_2613817_+\|coat	spore coat protein V	NA	NA	NA	NA
WP_014479467.1\|2613856_2614177_+	hypothetical protein	NA	NA	NA	NA
WP_014479466.1\|2614261_2614744_+\|coat	spore coat protein X	NA	NA	NA	NA
WP_003239243.1\|2614895_2615384_+\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003244982.1\|2615511_2615958_+\|coat	spore coat protein CotZ	NA	NA	NA	NA

DBSCAN-SWA_15

3168136 : 3176502

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479062.1\|3168136_3168724_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
WP_014479061.1\|3168720_3169761_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
WP_003233947.1\|3169862_3171293_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_069837338.1\|3171268_3173497_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.5e-158	40.0
WP_003243954.1\|3173480_3174164_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003219409.1\|3174160_3174415_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_014479060.1\|3174407_3175133_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003233955.1\|3175206_3176502_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7

DBSCAN-SWA_16

3923006 : 3978623

Klosneuvirus(18.75%)

transposase,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481472.1\|3923006_3924209_+\|protease	serine protease HtrC	W5SAB9	Pithovirus	5.9e-13	40.4
WP_157698106.1\|3924229_3924361_+	hypothetical protein	NA	NA	NA	NA
WP_003244510.1\|3924522_3925908_-	arginine utilization regulatory protein RocR	NA	NA	NA	NA
WP_015715052.1\|3926133_3926418_+	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
WP_014481470.1\|3926417_3927053_+	SdpI family protein	NA	NA	NA	NA
WP_015715050.1\|3927236_3927791_+	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
WP_014481469.1\|3927775_3928729_+	hypothetical protein	NA	NA	NA	NA
WP_033882007.1\|3929722_3930928_+	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5
WP_014481465.1\|3931150_3932554_+	amino acid permease	NA	NA	NA	NA
WP_003226959.1\|3932626_3933517_+	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
WP_003226961.1\|3933752_3933869_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_041337908.1\|3933869_3934967_-	response regulator aspartate phosphatase RapG	D6R410	Bacillus_phage	4.6e-73	39.6
WP_014481463.1\|3935077_3935548_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095010801.1\|3935689_3936427_+	hypothetical protein	NA	NA	NA	NA
WP_014481461.1\|3936437_3937595_+	hypothetical protein	NA	NA	NA	NA
WP_014481460.1\|3937610_3937859_+	DUF2651 domain-containing protein	NA	NA	NA	NA
WP_014481459.1\|3937963_3938134_+	hypothetical protein	NA	NA	NA	NA
WP_014481458.1\|3938196_3939423_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	29.3
WP_014481457.1\|3939456_3939870_-	hypothetical protein	NA	NA	NA	NA
WP_014481456.1\|3940054_3940225_+	CxxH/CxxC protein	NA	NA	NA	NA
WP_003226975.1\|3940305_3940785_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_014481455.1\|3941072_3941981_+	hypothetical protein	NA	NA	NA	NA
WP_031601181.1\|3941937_3945060_+	DEAD/DEAH box helicase	A7WKM3	Acidianus_filamentous_virus	6.6e-08	26.4
WP_014479904.1\|3945324_3945642_+\|transposase	transposase	NA	NA	NA	NA
WP_033881055.1\|3945638_3946553_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
WP_033881129.1\|3946936_3947200_+	hypothetical protein	NA	NA	NA	NA
WP_087614191.1\|3947898_3949048_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.8e-151	98.9
WP_031601176.1\|3949565_3951599_+	AAA family ATPase	NA	NA	NA	NA
WP_121591334.1\|3951576_3953463_+	ATP-dependent helicase	S5MMD7	Bacillus_phage	6.6e-19	21.8
WP_031601173.1\|3953852_3955316_-	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
WP_095010802.1\|3955794_3956115_+	hypothetical protein	NA	NA	NA	NA
WP_014480339.1\|3956244_3957792_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_014479891.1\|3957788_3958547_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
WP_014481451.1\|3958966_3959407_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
WP_033880917.1\|3959944_3960238_+	hypothetical protein	NA	NA	NA	NA
WP_069837894.1\|3960688_3962614_-	fructose-bisphosphatase class III	NA	NA	NA	NA
WP_014481448.1\|3963104_3963734_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_014478516.1\|3963754_3964477_+	peptide ABC transporter permease	NA	NA	NA	NA
WP_040081205.1\|3964567_3965278_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_017697260.1\|3965621_3965852_+	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_095010803.1\|3965865_3967305_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_069837893.1\|3967407_3968937_-	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.7e-33	29.3
WP_015483942.1\|3968950_3969514_-	peroxiredoxin	NA	NA	NA	NA
WP_069837892.1\|3969980_3971387_-	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	2.3e-32	30.6
WP_024571486.1\|3971409_3972756_-	gluconate permease GntP	NA	NA	NA	NA
WP_069964431.1\|3972784_3974326_-	gluconokinase	NA	NA	NA	NA
WP_003243132.1\|3974318_3975050_-	gluconate operon transcriptional repressor GntR	NA	NA	NA	NA
WP_088272596.1\|3975245_3976394_+	glycerate kinase	W6LM47	Streptococcus_phage	1.5e-50	42.6
WP_014481442.1\|3976486_3977518_+	general stress protein 30	NA	NA	NA	NA
WP_009968420.1\|3978218_3978623_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage