CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022957	Maribacter cobaltidurans strain B1 chromosome, complete genome	3 crisprs	DEDDh,csa3,cas3,RT,WYL	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022957_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022957_1

1169240-1169343

Orphan

Consensus_repeat	Method
CGTGTCTACCAATTCCACCACGCCCGCATTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022957_1

>merge|NZ_CP022957|1|1169240-1169343|CRISPRCasFinder
CGTGTCTACCAATTCCACCACGCCCGCATTTTAATATTTTAACGTTTTTTATTTCGCTATGTCCTAAGTCTAGCGTGTCTACCAATTCCACCACGCCTGCATTT

>NZ_CP022957|1|1|1169240-1169343|CRISPRCasFinder
CGTGTCTACCAATTCCACCACGCCCGCATTT	TAATATTTTAACGTTTTTTATTTCGCTATGTCCTAAGTCTAG
CGTGTCTACCAATTCCACCACGCCTGCATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022957.1\|WP_094996252.1\|1167015_1168803_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP022957.1\|WP_008610764.1\|1164272_1164470_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094996248.1\|1160815_1162396_-\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NZ_CP022957.1\|WP_094996247.1\|1160064_1160799_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381087
NZ_CP022957.1\|WP_094996251.1\|1164939_1165284_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|273179
NZ_CP022957.1\|WP_094996257.1\|1173380_1175408_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|320700
NZ_CP022957.1\|WP_094996250.1\|1164481_1164862_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094996259.1\|1176626_1176989_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP022957.1\|WP_094996253.1\|1169540_1170929_+\|dipeptidase	unknown	unknown	gnl\|CDD\|349929
NZ_CP022957.1\|WP_094996258.1\|1175525_1176626_+\|DUF4407-domain-containing-protein	unknown	unknown	gnl\|CDD\|379583
NZ_CP022957.1\|WP_094996260.1\|1177283_1182266_+\|translocation/assembly-module-TamB	unknown	unknown	gnl\|CDD\|367909
NZ_CP022957.1\|WP_008610923.1\|1163448_1163829_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_008610761.1\|1165357_1165702_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|366099
NZ_CP022957.1\|WP_094996254.1\|1170950_1171838_+\|esterase	unknown	unknown	gnl\|CDD\|225256
NZ_CP022957.1\|WP_158657088.1\|1166590_1166752_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094996249.1\|1162405_1163437_-\|mobilization-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094996261.1\|1182282_1184607_+\|BamA/TamA-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|366466
NZ_CP022957.1\|WP_094996256.1\|1173015_1173381_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP022957.1\|WP_094996255.1\|1171860_1172283_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094999121.1\|1172298_1172877_-\|PhnA-protein	unknown	unknown	gnl\|CDD\|377140

Protein	Function_ID	Function_description	E-value
NZ_CP022957.1\|WP_094996252.1\|1167015_1168803_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	2.88101e-43
NZ_CP022957.1\|WP_094996247.1\|1160064_1160799_+\|response-regulator-transcription-factor	gnl\|CDD\|381087	cd17532, REC_LytTR_AlgR-like, phosphoacceptor receiver (REC) domain of LytTR/AlgR family response regulators similar to AlgR. Members of the LytTR/AlgR family of response regulators contain a REC domain and a unique LytTR DNA-binding output domain that lacks the helix-turn-helix motif and consists mostly of beta-strands. Transcriptional regulators with the LytTR-type output domains are involved in biosynthesis of extracellular polysaccharides, fimbriation, expression of exoproteins, including toxins, and quorum sensing. Included in this AlgR-like group of LytTR/AlgR family response regulators are Streptococcus agalactiae sensory transduction protein LytR, Pseudomonas aeruginosa positive alginate biosynthesis regulatory protein AlgR, Bacillus subtilis sensory transduction protein LytT, and Escherichia coli transcriptional regulatory protein BtsR, which are members of two-component regulatory systems. LytR and LytT are components of regulatory systems that regulate genes involved in cell wall metabolism. AlgR positively regulates the algD gene, which codes for a GDP-mannose dehydrogenase, a key enzyme in the alginate biosynthesis pathway. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	4.92072e-31
NZ_CP022957.1\|WP_094996251.1\|1164939_1165284_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|273179	TIGR00621, Single-stranded_DNA-binding_protein, single stranded DNA-binding protein (ssb). All proteins in this family for which functions are known are single-stranded DNA binding proteins that function in many processes including transcription, repair, replication and recombination. Members encoded between genes for ribosomal proteins S6 and S18 should be annotated as primosomal protein N (PriB). Forms in gamma-protoeobacteria are much shorter and poorly recognized by this model. Additional members of this family include phage proteins. Eukaryotic members are organellar proteins. [DNA metabolism, DNA replication, recombination, and repair].	3.73928e-37
NZ_CP022957.1\|WP_094996257.1\|1173380_1175408_+\|hypothetical-protein	gnl\|CDD\|320700	cd07341, M56_BlaR1_MecR1_like, Peptidase M56-like including those in BlaR1 and MecR1, integral membrane metallopeptidase. This family contains peptidase M56, which includes zinc metalloprotease domain in MecR1 as well as BlaR1. MecR1 is a transmembrane beta-lactam sensor/signal transducer protein that regulates the expression of an altered penicillin-binding protein PBP2a, which resists inactivation by beta-lactam antibiotics, in methicillin-resistant Staphylococcus aureus (MRSA). BlaR1 regulates the inducible expression of a class A beta-lactamase that hydrolytically destroys certain ?-lactam antibiotics in MRSA. Both, MecR1 and BlaR1, are transmembrane proteins that consist of four transmembrane helices, a cytoplasmic zinc protease domain, and the soluble C-terminal extracellular sensor domain, and are highly similar in sequence and function. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. All members contain the zinc metalloprotease motif (HEXXH). Homologs of this peptidase domain are also found in a number of other bacterial genome sequences, most of which are as yet uncharacterized.	8.88313e-23
NZ_CP022957.1\|WP_094996259.1\|1176626_1176989_-\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	0.000261964
NZ_CP022957.1\|WP_094996253.1\|1169540_1170929_+\|dipeptidase	gnl\|CDD\|349929	cd05680, M20_dipept_like, uncharacterized M20 dipeptidase. Peptidase M20 family, unknown dipeptidase-like subfamily (inferred by homology to be dipeptidases). M20 dipeptidases include a large variety of bacterial enzymes including cytosolic nonspecific dipeptidase (CNDP), Xaa-methyl-His dipeptidase (anserinase),and canosinase. These dipeptidases have been shown to act on a wide range of dipeptides, but not larger peptides. For example, anserinase mainly catalyzes the hydrolysis of N-alpha-acetylhistidine while carnosinase degrades beta-alanyl-L-histidine.	0
NZ_CP022957.1\|WP_094996258.1\|1175525_1176626_+\|DUF4407-domain-containing-protein	gnl\|CDD\|379583	pfam14362, DUF4407, Domain of unknown function (DUF4407). This family of proteins is found in bacteria. Proteins in this family are typically between 366 and 597 amino acids in length. There is a single completely conserved residue R that may be functionally important.	1.28907e-119
NZ_CP022957.1\|WP_094996260.1\|1177283_1182266_+\|translocation/assembly-module-TamB	gnl\|CDD\|367909	pfam04357, TamB, TamB, inner membrane protein subunit of TAM complex. TamB is an integral inner membrane protein that forms a complex - the translocation and assembly module or TAM - with the outer membrane protein, TamA. TAM is responsible for the efficient secretion of the adhesin protein Ag43 in E.coli K-12.	6.7882e-52
NZ_CP022957.1\|WP_094996256.1\|1173015_1173381_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	2.86493e-30
NZ_CP022957.1\|WP_008610761.1\|1165357_1165702_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|366099	pfam00436, SSB, Single-strand binding protein family. This family includes single stranded binding proteins and also the primosomal replication protein N (PriB). PriB forms a complex with PriA, PriC and ssDNA.	9.4394e-40
NZ_CP022957.1\|WP_094996254.1\|1170950_1171838_+\|esterase	gnl\|CDD\|225256	COG2382, Fes, Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism].	2.57585e-17
NZ_CP022957.1\|WP_094996248.1\|1160815_1162396_-\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	8.88856e-21
NZ_CP022957.1\|WP_094996261.1\|1182282_1184607_+\|BamA/TamA-family-outer-membrane-protein	gnl\|CDD\|366466	pfam01103, Bac_surface_Ag, Surface antigen. This entry includes the following surface antigens; D15 antigen from H.influenzae, OMA87 from P.multocida, OMP85 from N.meningitidis and N.gonorrhoeae. The family also includes a number of eukaryotic proteins that are members of the UPF0140 family. There also appears to be a relationship to pfam03865 (personal obs: C Yeats). In eukaryotes, it appears that these proteins are not surface antigens; S. cerevisiae YNL026W (SAM50) is an essential component of the Sorting and Assembly Machinery (SAM) of the mitochondrial outer membrane. The protein was localized to the mitochondria.	4.97376e-19
NZ_CP022957.1\|WP_094999121.1\|1172298_1172877_-\|PhnA-protein	gnl\|CDD\|377140	pfam03831, PhnA, PhnA domain.	2.38651e-32

>NZ_CP022957.1|WP_094996252.1|1167015_1168803_-|ParB/RepB/Spo0J-family-partition-protein
MTTKASTTKKRSRAKSTAKKEVNGKKSSVLQIQNLPLGKIKPDPKQPRKTFNEDALKQLSESIEKHGVLQPITVRQLNGHYVIVMGERRYRASKLAGKKTVPCIVRTYENNDVLEVQIIENLQRQNVEPTEEAEAITYLNEKYAPTEIAKRLGRTGNFIRQRLKLAGLIEGFKHFVRNGEMTISLGVGVALFEPEEQQMMLETMGEDFNAHQINRMIKDQTYDLEKVSFDIYDKKLVPKVGSCVECPFNAANQGNLFGEGKMVCTKAACFETKKSKSLLNLIEKSKKENILLVPEIQQYWVDDENNQLIISQLEKNGLKVYLLDDVEIIENPIEPTIEAIQKEYQHYDYSEDELKAELDEAMQNYKEALEKFNSAKEDGFKNGIVFHPDSFQHKEIFVKIVEKSKNDSTEYSAPLANRKMADCTPEEQIVKINEREIRKKQIENNKQFEEVVEMIRETKYIDTKKTLSTDEMVAFSISLFENNVDYMSQQKYFSKFLGDTSKMTKVEMVENFKKKFKKEIFHKLIRYMLTKQVHFGESNHVNNLTNISFYNAMQGYYKSKIAGIEKEYAEKRDKREERLKERITVLEKQIEELND
>NZ_CP022957.1|WP_158657088.1|1166590_1166752_-|hypothetical-protein
MKNTAVKSDISLQEAEEHYQLSSENYTIESAESHLAYYREKHPLYYQVLLNNV
>NZ_CP022957.1|WP_008610761.1|1165357_1165702_-|single-stranded-DNA-binding-protein
MSTLKNHVQLIGNVGQEPTITNLESGKKVARFSLATNEYYKDAKGEKQTETNWHTVVAWGKTAEIIEKFVGKGKEVGVTGKLKSRSYEDKEGIKRYVTEIEANEILLLGSKNDK
>NZ_CP022957.1|WP_094996251.1|1164939_1165284_-|single-stranded-DNA-binding-protein
MKTIKNHVQLIGNIGQDPQVTNLENGKIVAQFSMATNENYKDAKGEKQSETHWHSVVAWGKLATIIEKYAVVGKQIAIEGKLAQRSYETKEGEKRYYTEVVAREILLLGSKNGK
>NZ_CP022957.1|WP_094996250.1|1164481_1164862_-|hypothetical-protein
MKAQVNEIKEGLQHFHGTEMFYQIPLLRTRFTDGLKYLANVADCFWLITDTSVIAKSLMNRSEFITIDFKRLSEEKQDFTGYEAEIIYTDGNDNILEKHGYRATDFPLDELRLFFVNDTLMLPSEY
>NZ_CP022957.1|WP_008610764.1|1164272_1164470_-|hypothetical-protein
MVYLNFTDLSEEAQNRLLEDSKKDVERKFGDDIRKYVRENYTCFETMIEEEALRNLYSYTFVFNI
>NZ_CP022957.1|WP_008610923.1|1163448_1163829_-|hypothetical-protein
MDSFITIRFKRKTAKRFQEFSKTHFKTHTEAMENILDFFFYNEISPKEKLGPTGRTIEAKLLKRINAVIAIMRDVEKTQTKPTVAMIQSLFETEQPNKKPLILEKKYAEEKKEVRFREKQNPSNQL
>NZ_CP022957.1|WP_094996249.1|1162405_1163437_-|mobilization-protein
MYITITPQKLGGNYSKSSADFVGYLEKENQGLEQQDMEHFFNQYGDEISAEEVVREIDGNTAKLEKHEPRFYSITVSPSKYELKRLQNHSKDLQKYTREIMKDYVASFNREINGRPITIDDIKYYAKIEHQRTFKGTDFQIKENQPYATKILQLKTEIRNVQDGRAEGNVKKLEKEIVKLEREAPHQQNGKRIVQGMPKAGNQSHIHIIVSRKDASNKFSLSPGSKYKASDVELNGKTVKRGFDRDGFFTKAEKTFDQTFGYRRNFAETYKARKDFIKNPKIYFASLMKLPTNEKALAFKIMGKSGIPMMPSIPVTQAQLAMKIFNRLRRGTEVAIKSSSIGI
>NZ_CP022957.1|WP_094996248.1|1160815_1162396_-|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MQMDNLVTVLFIIGLASSVFYGIFRVSRYAFVVNFLLIGAFVYYLNEQLPLVQIALYFVCPLILINIGMYVFLHKTDTPKSGNAKYQVNFATTKGNFKLDNIKRGVSIIGSAGSGKTESVVYGFLKHFEKEGFCGIIHDYKDFELTEMAYPLFKDSDIPFKVISFDKIIHRVNPIAPRYLENEESVNEVSRVLIENLLEQRESGTTGTTKFFNDAAEGLIGGLIWKLKCDYPKYCTLPHLIAIYQMLDTDSLIQFLETNTTSRAMADAFISGKDSDRQTAGVKSTLANALKRISTQRIFMVLSADEVPLNINSEENPAIISVVNNPKYETSYSPVIATIIHTITKQMSIRNSKPSFLLMEEAPTIRLLNMHRIPATLRSYNISTIYVMQDKIQNDMMYGDKASKAILSNLSYQFFGKVNDPDTAKYYERFFEIIKDPTKSISRGHNLDFDTRITTGEKEIPKIRADVFFRLKQGEFITYADGKDRKVQFKLANIQRELPQESKQFSQVDLEENFGRVYEEVRSIFS
>NZ_CP022957.1|WP_094996247.1|1160064_1160799_+|response-regulator-transcription-factor
MLNTLIVDDESHCIKRLLYLIDRKPGIFNVIATCKTVDEALKIAQDTPLDLVFLDIEIDDKTGFDFLRQLNHISFKTIFTTAFDNYAIKAFKFSAFDYLMKPIDFDEFNETIARLNEELQSKGHNNSVESLLKNIEQEHPKLLTIPSVEGFETVLVADIVHLEANGNYTYIHTKHKKQIVSKPIKFYENLLDEKLFFKCHKSHLINMEMIKTFNKGKQAYVQMENGNQVPIATRRKDVFLKKFY
>NZ_CP022957.1|WP_094996253.1|1169540_1170929_+|dipeptidase
MKNVKEYIANHKDRFLTELIELLKIPSISADSAFSQDVLDTADAVKLALENAGCHNVEIHETDGYPIVYGEKIIDENLPTVLVYGHYDVQPPDPMDLWNSPPFEPVIKKTELHPEGAIFARGACDDKGQMYMHVKALEFMVKTDQLPCNVKFMIEGEEEVGSNNLATYVSENREKLKNDVILISDTGMIANDIPSITTGLRGLSYVEVEVTGPNRDLHSGLYGGAVANPINVLAKMIASLHDEDNHITIPGFYDKVEQLSEAERAEMAKAPFSLEAYQKSLDIESVYGEKGYTTNERNSIRPTLDVNGIWGGYTGEGAKTVIASKAYAKISMRLVPNQDWREITELFKNHFESIAPKGVRVKVKPHHGGQGYVTPIDTDGYQAASKAYETTFGKKPIPQRSGGSIPIVSLFEKELDSKTILMGFGLDSDAIHSPNEHFGVWNYLKGIETIPYFFEYFAESKQ
>NZ_CP022957.1|WP_094996254.1|1170950_1171838_+|esterase
MKISENGSKALPILAVLFFICSVHVGLSQEESYALSEDSKPQPNVPKGTVTKHIFKSDLFEGTTREYYVYVPQQYRKDQPAALMIFQDGHAYVKEDGDFKTPIVFDNLIHKKEMPVTIGIFINPGHQSSELPENPFRASNRSWEYDELSDLYSRFLIEEIIPEVAKNYNLTSDPKMRAICGLSSGGICAFTAAWERPDYFYRVLSHIGSFTNIRGGHNYPSMIRRHAKRNIKVYLQDGSGDLNNQYGNWWLANQQMASSLEFRDYDYIFVKGTGGHNGKHGGAIFPEALKWLWKD
>NZ_CP022957.1|WP_094996255.1|1171860_1172283_+|hypothetical-protein
MKQAVSFLVLIISFYSHSQVINASGDYLVKLGNEDHLIEYSLTLSGDGSFTFHSYSNNQKGIPPTVHTYGKGKWTSDKDIVSFYSDKQDMDEKFSLNFTGTKARFISKSARDKTDREIKTRLKFYKSDIFWIKGMEIFKM
>NZ_CP022957.1|WP_094999121.1|1172298_1172877_-|PhnA-protein
MGLLEDLQNRSGHVCELCGAKDNLEVYEVPPVSTGGFDGSVLACTTCIGQIENPDTTDSNHWRCLNDSMWSEYDAVKVLSWRMLSRLKSEGWPQDLLDMMYLEDETLEWAKATGEGISDADKIIHRDANGAILENGDSVVLIKDLKVKGSSMVAKQGTAVRRISLDHENAEYIEGKVDGQQIVIITKYVKKV
>NZ_CP022957.1|WP_094996256.1|1173015_1173381_+|BlaI/MecI/CopY-family-transcriptional-regulator
MQLSKSEEELMNIVWKLKKAFMKDLLDAYPEPKPATTTVATLLKRMTDKGFVAYNSIGRSREYYPLVKKKDYFSKHVNGLIKNFFNDSPGQFASFFTQETNLSKAELEELKKLIDNEIKKK
>NZ_CP022957.1|WP_094996257.1|1173380_1175408_+|hypothetical-protein
MILAFLLKSTACLAIFLAFYKLVLEKESIHTFKRFFLLGALITSFVIPNIVFTEYVEVTPGTEISIPQVTEGLQAMNTETVAPKASFLDWNVIVWSIYGIGVIIFGFRFIRHLLQIWSRIRLNPKLKENLITRVLLRQSVAPHTFFNYIFLNKKEFEEKNIPIEVLLHEETHAKQRHSLDVILVEMVQVLFWFNPLIYFLKSSIKLNHEFLADNAVVNSNISIPKYQHLLLSFLSKASENHHSSIKIANAIVYSSTRAERSRSIKKRFTVMKTKTSKKSIVLRSFLLLPLTTILLFGFSEKKEIPISEKAALETTLKSKNNVDYSPWSATKDELLKFNALAKKYNAIPVEKRKIPMDDLKTLETIYGKMNEAQKKVAQPFPECLPQNQKRVDFIEININNNGQLLVQDDLIRLEDLKTYLSKLNEHLSFDDRKKVVRSIIKVDTKTPKEVIQKVDKILTEYGSATINIIGPEESIQIRQQQSATREEMKEYNTLAKKYNEMDRNQMYIKKSEVSRLKVIYGKMSKKQRADAEPFPDFPPLPPTPDAPKPPKNASDTDYAANQIEAIIEKQDPYDVVGGNIGVTQPKQPEPVLPPTYINETNPNLPPTPPKPKSPLVLIKEMAEKGATFTHNGKKISAEKAIEVIKKNNKINIDVRGNSGKEPIVKLSTAPIQIED
>NZ_CP022957.1|WP_094996258.1|1175525_1176626_+|DUF4407-domain-containing-protein
MLQDFFILCSGADSEILKTCSKGEQNKYAGIGATVFFTAVMAFIASSYALYTVFDSVYAAVFFGLIWGLLIFNLDRFIVSTIKKRNNFSQELLQATPRILLAIIIAVVISKPLEMKIFEKEINQVLLEQKNELTLANKEQLALQYTPKVEQLNQDIATLKSEIATQEAETNALYDVYITEAEGTAGTGLLGKGPVYKEKREKHDAALAELQELKVTNGEKIKTLESQIATLDTEYAEVVKNSQPIIDGFDGLMARITALGKLPWFPSFFIFLLFLAIETSPIIAKLLAPKGEYDIKLEEQESILSSWVAQKVAQRQLIVSTDGEINQKIYEDLKGEEELYGYKKQKAEELLRLQADKFHEVQVKNL
>NZ_CP022957.1|WP_094996259.1|1176626_1176989_-|VOC-family-protein
MLGLRTEIYKVGSIEEAKSWYTKAFKTEPYFDEPFYVGFNIKGYELGLQPEEQPTTDKTESVTALWGVADIQSEFDRLLGLGATLYEAPNYVGGKIMAASVKDPWGNIIGLIYNPEFKLP
>NZ_CP022957.1|WP_094996260.1|1177283_1182266_+|translocation/assembly-module-TamB
MKIKTWNRKRILKTAGKFFLALILLFFILVLVIRTPWAQNIIVTKITDFISNKTGTKVEVEHVFITFSGAIKTEGVFLEDKQGDTLLYSKELQMDLPIYPLLFKNELSIDDVYATGLIANISRTKNPNGFNFSFLMEAFATSKDTTTTTKPMSISLGDFYLKDWKVRYEDAYLGTKLDVSLGNLETQIDVFNLEDMTFSVDGFRLTDSQITYHQTHDFPESNDSTTTPMPIIDLGNFEIKKVKVSYDSQPDGIKSQMQLNDIGLIDGFIDLSKNRYEAKDIRLKDSNIHLALNQPVDTVAIQKENTPFEWPQLEVSLNSVNLESNSFTFSRNGAVQNDTLFNPDAFAINDLQLKAENASYNPKNVHLGVENLSFTESTGINLKQLQFETGLTDKKAFISNLNIQLNQSKARANVSTEYTSLDGAMKNPADSNLEVTLTELKLEPTDFIRWIPQLQKNTYLDSLSKHPITGSLKAKGSLKKVEDFDTELNWGPNTLITMEGVLSNLTQPEAFIFNLNNIDIISTKKDLEKFILSKNLPVKIPDNLSLNGTAQGTMDSFETHLALVIPEGKIHMDATADLGFQKQFKAQVSTDSLQLGTLLQNQNLGTVSLQVEGSGSGSELSNMNAQINGEISQFQLNAYNYKDLKLSGTLKNGSGDISLNVHDKNLNFKSNTFIDLTSEVNNIKFTSNIIGADLRELGFTKNDIKIAADINGSYSGISNNFNIQTSINNGIAVTGNEQYQISPIILNTHVEDSITDATLESGFLNGKLYSNASPNRINKALKRQLENYFTAEGKAGDLDLDDVKAELKLALIPTPILSKVFFDGVEDLDSLNIDAHFDARSKQISGELFIPKFSYAGSIVDSLDVNVLGDSLNLEFSAGLSSFEYQPLHLKKTYLTGNLQNKELVLDFNSVNDTTQIMHINSELVFKKDTLTLHVSPKNLFLNKNPWQVPEDNKIVMAESYTDFQNLVLSRNNQTLQVSTKIPKMKSDHIGIIFENFQLQSFLSLLNPDEPIVKGKVKGNFVILNPYEASGLVSELDISEFRLMGTPLGTLSLNASSKSLNNYDFDLILKDGGADLRLTGDYVAKQNDADLNLELDIQKFQTSIIQGFLKDQISNPSGYISGSMLVNGTLSNPAYSGRLNFNDVGLTLSAFKTNMKINGQTLDLNEEALTFDSFSILDGDRGNLVLDGTILTENMFKPSFDLTIKANKFTALDSKKGDNDLVYGKAIVNTDLEVTGNIELPVINGSLSIGDATDLTYLVPQTQYEIQEREGVVIFVNRENPDAILTRTTGETTSSIFAGMDINTTLKISDEATFTIVLDEKTQDKLQASGNATLNLNIDPNQDIRLSGRLELNSGFYRTSLYNLVSREFKINEGSSVVWTGDPYNAKLDVTAIYEIETSAAPLMSSISFGQDTGISGQYQRSSTFLVYLNVGGEITTPELSFALDMPENAQGTYGGAVYGRIQQLNEQESELNKQVFSLLALNRFYPTSGSDGSSGGAVALARNNVNKVLSGELNSISNKLLGNSGFELDFDLDSFQENQGNSYQNRTQLNINASKKLFNDRLIVTAGSAVDVEGSASNSDTATPLIGNVTLEYLLTEEGTYRLKGFRRQEYQNIIDGQLIVTGLAFIFDREFNKFSQLFNPIKNTAKTGDSPKKGKDKP
>NZ_CP022957.1|WP_094996261.1|1182282_1184607_+|BamA/TamA-family-outer-membrane-protein
MKKSIIKYLFLFGLGIFLIQSCSIGKFIPEGERLYTGAQLELDTIGEVKGLKDVKSELVNLIEPNPNTTFLGMKPALYFYYKAQREKPGFIYRFLNKSFGEEPVYFSEVKPEKVEELLLNRLDNNGFFYSRTSSEPVLKEKYASVNYAATVQQPYTLENYQLDNDSLPIYKELSDLIKDTPLSKNDRFDLDLLKAERERLDFNLKQRGYYNSQANLLIFEADTNQYKNRKFDLFLRLKKEVPKKSAIPYTIDSITVYPNYSLEGDTIPKSRQNPVTVNGTDFIQNEYFFKPELLETYLLFREGDLYNANTSKITSDRLASLGSYKYVNIQYTELDTTMTDGDYGSLAADIYLAPLTKRSLRAEVQAVTKSNGFTGPGVQLTYSNRNLFKGGETLSLSTHFSYESQLSSGNNSNLSSIAYGIKGDLIFPRSIPFSPRNFRYSVPKTKISTGIDFLRRSQLFTLSSINGSFGYTWKENKYVYHQLDPISINYSRLSNVTEEFQTILGDNPFLRRSFEQRFIAGLLYGFTYDEVSDLGKDYPIFFSTNMDIAGNLFSLLDGGSGTIIGSEYAQYAKVDADFRFYLRWGKEQTLVTRVYAGWGVPYGNSETMPFIKQFFSGGPYSVRAFDIRSLGPGNFNAQEDESTTDYFDRSGNLKLEANLEYRFPIYSYLKGAFFVDAGNVWLTGNYDELEADQQNSNFSNTLFTDGKFESDWIREVAAGFGFGARVDIQNFVIRLDLASPFRVPYRPENDRWNIPFFGDKGNKMTLNFAIGYPF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022957_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022957_2

4309906-4310228

Orphan

Consensus_repeat	Method
ANTNNTTGGAATGTTTCAAATGT	CRT

4 spacers

The CRISPR arrays of NZ_CP022957_2

>merge|NZ_CP022957|2|4309906-4310228|CRT
GATTCTTGGAATGTATCAAATGTGGAAAATATGCAGTCTATGTTCTTGGGCGCCCGCAGTTTTAATCAACCCTTGAATTCCTGGAATGTTTCAAAAGTATCCAACATGTACGGTATGTTTCAAGAAGCCGATAAGTTTAATCAACCACTTAATTCTTGGAATGTTTCAAATGTAGAGAATATGTCAAGTATGTTTTGGAATGCAACATCCTTTAATCAGAACATTACTGATTGGAATGTTTCAAATGTAACATCCATGAATAGTACGTTTAAAAATGCGATTTCGTTTAATCAAGATTTGAGTAATTGGAATATTGTAAATGT

>NZ_CP022957|2|1|4309906-4310228|CRT
GATTCTTGGAATGTATCAAATGT	GGAAAATATGCAGTCTATGTTCTTGGGCGCCCGCAGTTTTAATCAACCCTTG
AATTCCTGGAATGTTTCAAAAGT	ATCCAACATGTACGGTATGTTTCAAGAAGCCGATAAGTTTAATCAACCACTT
AATTCTTGGAATGTTTCAAATGT	AGAGAATATGTCAAGTATGTTTTGGAATGCAACATCCTTTAATCAGAACATT
ACTGATTGGAATGTTTCAAATGT	AACATCCATGAATAGTACGTTTAAAAATGCGATTTCGTTTAATCAAGATTTG
AGTAATTGGAATATTGTAAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022957.1\|WP_094998792.1\|4311257_4311959_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998802.1\|4319899_4320748_+\|aminotransferase-IV	unknown	unknown	gnl\|CDD\|238799
NZ_CP022957.1\|WP_094998790.1\|4304506_4305442_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP022957.1\|WP_094999323.1\|4306131_4307685_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223989
NZ_CP022957.1\|WP_094998798.1\|4316539_4317169_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187554
NZ_CP022957.1\|WP_094998797.1\|4316050_4316335_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998795.1\|4314412_4315528_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_CP022957.1\|WP_094998783.1\|4298840_4299932_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|225070
NZ_CP022957.1\|WP_094998789.1\|4304029_4304488_+\|cold-shock-domain-containing-protein	unknown	unknown	gnl\|CDD\|239905
NZ_CP022957.1\|WP_158657206.1\|4298225_4298831_+\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133025
NZ_CP022957.1\|WP_094998786.1\|4300709_4301312_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998800.1\|4318040_4318541_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|379804
NZ_CP022957.1\|WP_094999322.1\|4305397_4306006_-\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211334
NZ_CP022957.1\|WP_094998785.1\|4300216_4300705_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP022957.1\|WP_094998801.1\|4318707_4319895_+\|sorbosone-dehydrogenase	unknown	unknown	gnl\|CDD\|225044
NZ_CP022957.1\|WP_094998788.1\|4302107_4302899_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998796.1\|4315565_4315982_+\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|274650
NZ_CP022957.1\|WP_094998787.1\|4301313_4301943_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP022957.1\|WP_094998793.1\|4311959_4314137_-\|carbohydrate-binding-family-9-domain-containing-protein	unknown	unknown	gnl\|CDD\|187676
NZ_CP022957.1\|WP_094998799.1\|4317316_4317988_+\|flavodoxin-reductase	unknown	unknown	gnl\|CDD\|99793

Protein	Function_ID	Function_description	E-value
NZ_CP022957.1\|WP_094998802.1\|4319899_4320748_+\|aminotransferase-IV	gnl\|CDD\|238799	cd01558, D-AAT_like, D-Alanine aminotransferase (D-AAT_like): D-amino acid aminotransferase catalyzes transamination between D-amino acids and their respective alpha-keto acids. It plays a major role in the synthesis of bacterial cell wall components like D-alanine and D-glutamate in addition to other D-amino acids. The enzyme like other members of this superfamily requires PLP as a cofactor. Members of this subgroup are found in all three forms of life.	9.07346e-103
NZ_CP022957.1\|WP_094998790.1\|4304506_4305442_+\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	3.2288e-53
NZ_CP022957.1\|WP_094999323.1\|4306131_4307685_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	1.21951e-43
NZ_CP022957.1\|WP_094998798.1\|4316539_4317169_+\|SDR-family-oxidoreductase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	8.89436e-59
NZ_CP022957.1\|WP_094998795.1\|4314412_4315528_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	0
NZ_CP022957.1\|WP_094998783.1\|4298840_4299932_+\|amidohydrolase-family-protein	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	7.53028e-21
NZ_CP022957.1\|WP_094998789.1\|4304029_4304488_+\|cold-shock-domain-containing-protein	gnl\|CDD\|239905	cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea. CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA. CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.	1.02413e-15
NZ_CP022957.1\|WP_158657206.1\|4298225_4298831_+\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133025	cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.19489e-62
NZ_CP022957.1\|WP_094998800.1\|4318040_4318541_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|379804	pfam16242, Pyrid_ox_like, Pyridoxamine 5'-phosphate oxidase like. This domain, approximately 140 residues in length, is mainly found in general stress proteins in various Xanthomonas species. It is composed of a six-stranded antiparallel beta-barrel flanked by five alpha-helices and can bind to FMN and FAD, suggesting that it may help the bacteria to react against the oxidative stress induced by the defense mechanisms of the plant.	1.43573e-47
NZ_CP022957.1\|WP_094999322.1\|4305397_4306006_-\|pseudouridine-synthase	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	1.83235e-49
NZ_CP022957.1\|WP_094998785.1\|4300216_4300705_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.16535e-30
NZ_CP022957.1\|WP_094998801.1\|4318707_4319895_+\|sorbosone-dehydrogenase	gnl\|CDD\|225044	COG2133, COG2133, Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism].	3.00733e-65
NZ_CP022957.1\|WP_094998796.1\|4315565_4315982_+\|OsmC-family-peroxiredoxin	gnl\|CDD\|274650	TIGR03562, osmo_induc_OsmC, peroxiredoxin, OsmC subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein OsmC, or osmotically induced protein C. The member from Thermus thermophilus was shown to have hydroperoxide peroxidase activity. In many species, this protein is induced by stress and helps resist oxidative stress. [Cellular processes, Detoxification].	7.13545e-58
NZ_CP022957.1\|WP_094998787.1\|4301313_4301943_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.51628e-29
NZ_CP022957.1\|WP_094998793.1\|4311959_4314137_-\|carbohydrate-binding-family-9-domain-containing-protein	gnl\|CDD\|187676	cd09618, CBM9_like_2, DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.	1.70934e-61
NZ_CP022957.1\|WP_094998799.1\|4317316_4317988_+\|flavodoxin-reductase	gnl\|CDD\|99793	cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.	3.77065e-117

>NZ_CP022957.1|WP_094999323.1|4306131_4307685_+|DEAD/DEAH-box-helicase
MQETVYELQEKKTDKELYSYQQGAIQQIFEKFDNERDDYHLLYQLPTGGGKTVIFSEIVRQYLKNHNKKVLVMTHRVELCNQTSDMLTSFGVVNKVVNSKANLDDQEKYSCYVAMVETLNNRLNDDKLDISDVGLVIIDEAHYNSFTKLFKFFESSFILGVTATPLSSNKETPMNGNYDELIPGESIENLIENDFLARAETYQYDMGLTSLEVGSNGDYTVKSSADLYTSPAMLNKLLEAYTKHSKDKKTLIFNNGIETSIQVYYTFRNAGLPIMHLDNTATKKQRKQILKWFKETPNAILTSVSILTTGFDEPTIDSIILNRATKSLTLYYQMIGRGSRVLNNKSKFTVIDLGNNIYRFGPWGADLDWEAIFKSPNYYMDRIRDDEDIEADFKHDLSDEIKEEFKNSKETYFDIRETYEQATFAGESSKVVLERSIEQHAYICIENSEDVYDALALAKLLKEDIDNRIHVYAKCISKSTHNFLSWLKDDYQKKLNAYLRENFDSVYEDIHGHPPEE
>NZ_CP022957.1|WP_094999322.1|4305397_4306006_-|pseudouridine-synthase
MHHHFKIYKPFGMLSQLTSGEPRQLRKKRFLGELHTFPNGTMPIGRLDEKSEGLLLMTTDGKLADYINTTGIEKEYWVQLDGFITAKPISQMEKGVSIGLFGEKYTTKYCQVNLMETHPILPPPDSRLRIGVHRPTSWIRVILTEGKFRQIRKMTAAVGYPTVRLIRVRIGQIGLGTMMTGDVNPVLDLPFQFFGSKSGEKS
>NZ_CP022957.1|WP_094998790.1|4304506_4305442_+|EamA-family-transporter
MTLAKRNPALIILAFFAIYVIWGSTYLLNKIAVTELPAFMLAGIRFITAGSLIFIIAQFLKIPLRVTKKQLGNSIIAGFLFLTFGNGVVVWALKYVDSGFAALEISAQPLVVLILMRILQGKKIQPMSLVGVGLGMIGIYLLVSQKQIISQEGAFLGMILIFFCMLSWAYGSLFVGKADLPPNYFVNTGYQMVTGGILLFIISAVIGEEWISPVNWTVPVLWSMILLVLFGSIVAFTAFNYLLKVVSPEKVATSSYVNPVIAMVLGWYFLNEEITLQSAIAAFILLTGVYFINTKKRLTLFSRFTSKKLEG
>NZ_CP022957.1|WP_094998789.1|4304029_4304488_+|cold-shock-domain-containing-protein
MAKSQQTFNKTEKVKKRLKKREEKQKKKEARKQAAKDNGTSGIPMAYVDYNGNLVDTPPDPSMKVEIEAEDIVLGIPKKEEGDVEEFDPVRNGKVSFFDSSKGFGFIIDSENNEKYFVHVSGLIDEIFENDKVSFELEKGMKGMNAVRVKKI
>NZ_CP022957.1|WP_094998788.1|4302107_4302899_+|hypothetical-protein
MEIVRNTLKKMSLLASALILAYSCSDDAETDDNIVLSQADLKTILEIDDITGGIDVALFELYNNGSSTAKTLSNECYSAQYSDTGYIATFNNCVLNGTENINGVLTVTYNMNSEQTSFSASYEDFYVGDIKINGTRSYVLNTNTDASSVSFEVTSDLSVEMADGSIISDEGNRSFTLTFGDSAESTTYSIAGTWTVVYEGNTYNVTVNSPLTSSVTCGYIADGDMTVSKNGLTVNVDFGDSTCDNVATVTYPNGIEEEITLKD
>NZ_CP022957.1|WP_094998787.1|4301313_4301943_-|GntR-family-transcriptional-regulator
MIVKVNLRDQVRDYLLSEMKKGKLKIGKTINLAALSRELGVSVTPIREALTQLQQSHIIKAVPNRGFIIAELDVKEAEDLYGLVASLEVMAIENSEFDQEQIDALKRQQEVFENAHDALSRIQADLEFHHLLTKGYDNELALQILKDLKTRIFFYEQAFTADDSFYNKSDNQHEAIISAIAEDNVPTASLLLKMNWMLIVNYIQKKLTE
>NZ_CP022957.1|WP_094998786.1|4300709_4301312_+|hypothetical-protein
MELEELQATWSKMSQELEKQKKLTNEIIMKMTQDRYQKKFSKLRNFETIGAIIGYFLVGLILFNFGKLDTWYLRLSGVVTIVFFTLLPTIVLRTLARIQNLSLIKGTYRDILAKYTREKNRLLRLQQVGIGLSLILMPIIFLGTAKIIAGKNVFLIEIETKVWIGLSVVALLSILVSLWGYRSYKRVTNSAELLLKDLED
>NZ_CP022957.1|WP_094998785.1|4300216_4300705_+|sigma-70-family-RNA-polymerase-sigma-factor
MSKETHFADVIREHQGLLYKVTSIYTNNEQDREDLFQEVVYQLWKYFDTFRNESKISTWMYRVAMNTAITQLKKYKRSPNSVPIPEYVLRVSETKDEVYEERLKLLYQHVKQLNTLERGLMLLLLEGKSYNEIASITGLNPSNVGTRISRIKQKLKQNMTKS
>NZ_CP022957.1|WP_094998783.1|4298840_4299932_+|amidohydrolase-family-protein
MKNFCKTLLIIIVFFQSATELTAQEMGFEEYNPTSTLVVPGKEINEAKFPFIDVHSHQRDMSVKKLGSLLADMESLNEAIMVNLSGGSGESLKEKVDNINKSYPNRFVVFANVDFEGVDGPDWGKKAAAQLEKDIKNGAKGLKIFKSLGLRYKDASGKRLAIDDSRLDPIWAKCGEMGVPVLIHAADPKSFWDDMDSKNERWLELKTHPRRKRSATDPAPWEQIIQEQHNVFKKHPNTKFINAHMGWHANNLGKLGELLDEIPNMNVGISAVIAELGRQPQNARAFFIKYQDRILFGKDSWKPEEFPTYFRVLESNDEYFPYYKKYHAFWAMYGLDLPDEVLKKVYYENALNLIPGLDRSLFD
>NZ_CP022957.1|WP_158657206.1|4298225_4298831_+|NTP-transferase-domain-containing-protein
MNIAVVVLAAGQSSRMGKIKQLLPWKDSFLLQHALRTVKEVDPDQLVLVLGANSDKIRPMLHFDDETYDVIENPTWEKGLGNSISIGVGHVLSTNHAVDGILICLGDQPLITSVYLQRLIDQFKTKKYSIIASSYTNRVGVPAIFNRSICHELVQLNSDTGAKDILLAYKDDILRLDAQELLEDIDTPEEYEKLYQRFHNT
>NZ_CP022957.1|WP_094998792.1|4311257_4311959_+|hypothetical-protein
MIHQKVKYLASILLITSTFVSCDKGSDSDTEKQAEKPLPTKVQGTLPANGEPCSDFELVPNDDSKVSILFKWNASQNAVNYDLVVMEGAQEAAKSTVEALEAYLTLDKGKTYSWMVTAKNETGNTISDTYSFTTPGQAIGNYAPYAAEITLNFNTTNQTLNVVWVAEDEDGDALNYDIVVQENGSVLMEETDLSNTTIEDITYVSGTTYLVSVKAKDTSGNFSISEKSEISPD
>NZ_CP022957.1|WP_094998793.1|4311959_4314137_-|carbohydrate-binding-family-9-domain-containing-protein
MKFNIYVLLCLILCVNTLTSQKKNADYRLHIKKTNYPVVIDGIGNDKAWEDADEAKDFFRVLPMDDGLANEQSAIKMTYDDKNLYLLATFYNATEANYFVESLRRDFSFGKNDNFLLFLDPFNNQTTGFSFGSNAFGAQWDGTMYDGSRIDLNWDSKWISEVTRDDDKWVFEMAVPFKSIRYEEGVTEWGINFSRLDLKSSEKSSWTPIPRQFPTAALAYTGTLVWDNPPPALGTNFSIIPYVLGEVNRDLEANEDTKTNGKIGGDVKFSLTSSLNLDLTVNPDFSQVEVDRQVTNLDRFELFFPERRQFFLENGDLFANFGYETIRPFFSRRIGLGVPIQAGARVSGNLNEKWRMGLMDMQTASVDETGLPSQNFGVLSLQRKVFGRSNIGLMVVNKQSINYPSENDSINSQYAKYNRNLGLEYNLASSNNLWNGKAFLLKSLAPDENGKGIAQGAHLQYSSRKWSWRLQEEWVSNDYTAEVGYVPRRNYIKFSGKLGHLFFPKGGPLVSHGPELNINYFFNEALRQTDHLAYLVYNFDFRKRSSLMFFVSDDYVELLSPFDPTRLGIADLATGTKHQWNAFGWEYQSKPQSLFTYSFAGRLGGYYQDGNRTSLTTELGYRFQPYVSLSANLNYNHIDLPAPWNTNEFWLIGAEADITFTNKLFFANLVQYNEQTGNMNLNSRFQWRYSPASDLFLVYTNNYFVTPFETRNWGLTLKFTYWLNN
>NZ_CP022957.1|WP_094998795.1|4314412_4315528_+|alkene-reductase
MKEQALLEPYKERNLSMRNRVVMAPMTRSRAANKHKKPEKGLHDIYYKQRASAGLIITEGSQVSEEAVGYINTPGIHTEAQVEGWKQVTQDVHEKNGTIFIQLWHVGRMSHPDFHDGDLPLAPSAINPEAQSYTPEGFKDTVTPKAMTKEDIARTIEDFKNAAQNAVKAGFDGVEIHSSNGYLFHQFFNATSNTRTDEYGGSIQNRARFFFEVLDEVKKVIPESKIGARFNPSLNGMFGMRMDEETIPTFEYIIKKLDDEYDLAYIHLSEPFTDVSEIPYAVKSIAEHFRPMYNGTLMINGGFDQESGNKVIESGNADLVSFGKLYVSNPDLVERFKNDWDLADWDEDTFYTPGKEGYIDYETHKQEESVQ
>NZ_CP022957.1|WP_094998796.1|4315565_4315982_+|OsmC-family-peroxiredoxin
MNFTRNAKAQWKGSGKEGHGTLTTDSTVLENTQYSFNTRFEDGKGTNPEELIGAAHAGCFAMQLSFLLGEADYTPNTLDVSAKVSFKDGEIVKVTLDLIGDVPEIEASEFKEIATKAKNVCPISKLLDTEIVLNASLA
>NZ_CP022957.1|WP_094998797.1|4316050_4316335_-|hypothetical-protein
MSNQKEKTYNSDITKEDLNALGEKTKNSRTDQGDDQQLQEREKDVDFAGSDLDVPGRNLPKDKTKKTVKDEENQLYSQGGSGNEDLERNRDYIK
>NZ_CP022957.1|WP_094998798.1|4316539_4317169_+|SDR-family-oxidoreductase
MGNILVAGANGTTGKKVVHLLKASQYFNPVAMVRKKEQMAQFENDGIDTVLGDLEEDLSHTVKNIDKVIFAAGSGGKKVVAVDQEGAKSLMDVSKKANVKRFVMLSSMGADNPEAAEDLKEYLQAKHNADEYLKKSDLKYMIVRPGSLTNENGTGTISLKKHFEEQGSISRDDVAQTLVHALHEDAGTNETFEILEGETLIGKALDSVS
>NZ_CP022957.1|WP_094998799.1|4317316_4317988_+|flavodoxin-reductase
MAHKINIQEIGFIRHNVLQIQTDRPSGYDFTPGQACEMSIDQPKWKEEKRPFTFTSLPDDGFLQFTIKVYPNHYGVTDQLQTLEQGDSLLISDSWGAISYQGPGVFLAGGAGVTPFIAIIKNLARKGNLEGNTLIFGNQRERDIILQSDFERWLGKDFINILSDEHSSKFPHGTIDKEFIKNHTANLDKKFYLCGPPPMMDSVYNALLELDVPKKNIITEDLD
>NZ_CP022957.1|WP_094998800.1|4318040_4318541_+|pyridoxamine-5'-phosphate-oxidase-family-protein
MATKNLSNTDAVSKLKELATSIDFALMATQLDKFPLHAIPMSTKKVDSKGNIWFLSGKDSTHNKNINKDSNVQLFYSKAMAMEFLTVYGKAEIVDDQIIIDDLYQSSDDNWFDGKTDPNISAIKVIPEDAHYWDTKDNMLISLIKMGVGTVTGEKKDLSEQGNLKV
>NZ_CP022957.1|WP_094998801.1|4318707_4319895_+|sorbosone-dehydrogenase
MKNKIPFIKITFATALALSIFSCKETKKEESVDVKEEVPMDSTDLALLDLNLPDGFDIKVYARGVDGARSMAMGDNGTLFVGTRNENTVYAIQDKDGDYNAETVMVLDTMEVPNGIAMRNGDLYVAQVGSLWKYPNIENQLGDSLNKELVYDDYPTEFHHGWKYIAFGPDDKLYVPVGAPCNICNPTQDERFATITRMDPDGTNREIYAKGVRNSVGFTWDDNGEMWFTDNGRDMLGDDIPPCELNHITEAGQHFGYPFCHGGTVKDPEFGDQRPCSDFVPPAKALGAHVAPLAVKFKSGNMFPSTYNGKAFIAEHGSWNRSKKIGYRIMLADIENGEVKSTEPFIDGWLNDETQEVTGRPVDLLWMEDGSLLISDDYGDAIYRVTYSDTQVASN
>NZ_CP022957.1|WP_094998802.1|4319899_4320748_+|aminotransferase-IV
MSNYPDKVYLNGEILPSAKAQVSVFDRGFIFGDGIYEAMAQINGVFFYEEAHLSRLAEGLAKIGIRYDVSRIPKEINHLLKASDLMGKDCFLYIQITRGVAPRQHSFPKDIQPTVFMYALPKVLPDINTTHAKVITREDFRWSRCDIKMTSLLGNVMLNEEAMQHECYETVLFRNGVVTEASHCNVFFVKDNVVYTHPANEFILNGITRLVAIQLCGELGLELKEEAISEHEIYNMDEAFLTGTSTQIASIKQINDHFYYSDYTVGPVTKKLQEAFHHLKGN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022957_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022957_3

4443498-4443598

Orphan

Consensus_repeat	Method
ATGGCGAGGTAGCTCAGCTGGTTAGAGCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022957_3

>merge|NZ_CP022957|3|4443498-4443598|CRISPRCasFinder
ATGGCGAGGTAGCTCAGCTGGTTAGAGCGTCGGATTCATAACCCGGGGACAAAATTGAAATATTGTAGTAAATGGCGAGGTAGCTCAGGTGGTTAGAGCGT

>NZ_CP022957|3|2|4443498-4443598|CRISPRCasFinder
ATGGCGAGGTAGCTCAGCTGGTTAGAGCGT	CGGATTCATAACCCGGGGACAAAATTGAAATATTGTAGTAA
ATGGCGAGGTAGCTCAGGTGGTTAGAGCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022957.1\|WP_094998893.1\|4456631_4456838_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998875.1\|4436456_4437107_-\|DUF4290-domain-containing-protein	unknown	unknown	gnl\|CDD\|379482
NZ_CP022957.1\|WP_094998881.1\|4441527_4442088_+\|YqgE/AlgH-family-protein	unknown	unknown	gnl\|CDD\|376864
NZ_CP022957.1\|WP_094998882.1\|4442084_4442930_-\|aminotransferase-class-IV	unknown	unknown	gnl\|CDD\|376449
NZ_CP022957.1\|WP_158657210.1\|4450216_4451419_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|132838
NZ_CP022957.1\|WP_094998887.1\|4448967_4450044_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225212
NZ_CP022957.1\|WP_094998890.1\|4455019_4455226_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP022957.1\|WP_094998878.1\|4438125_4440024_+\|RecQ-family-ATP-dependent-DNA-helicase	unknown	unknown	gnl\|CDD\|223588
NZ_CP022957.1\|WP_094998879.1\|4440020_4440968_+\|methionyl-tRNA-formyltransferase	unknown	unknown	gnl\|CDD\|234567
NZ_CP022957.1\|WP_094998885.1\|4447107_4447641_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998883.1\|4442982_4443366_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176856
NZ_CP022957.1\|WP_094998889.1\|4451581_4454809_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350769
NZ_CP022957.1\|WP_094998892.1\|4455564_4456551_+\|HipA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377920
NZ_CP022957.1\|WP_094998876.1\|4437189_4437477_-\|DUF493-domain-containing-protein	unknown	unknown	gnl\|CDD\|377327
NZ_CP022957.1\|WP_094998884.1\|4443976_4447111_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|223496
NZ_CP022957.1\|WP_094998880.1\|4441144_4441417_+\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259853
NZ_CP022957.1\|WP_094998886.1\|4447615_4448971_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022957.1\|WP_094998874.1\|4435133_4436441_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP022957.1\|WP_094998877.1\|4437564_4438125_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379235
NZ_CP022957.1\|WP_094998891.1\|4455235_4455568_+\|phosphatidylinositol-kinase	unknown	unknown	gnl\|CDD\|274416

Protein	Function_ID	Function_description	E-value
NZ_CP022957.1\|WP_094998875.1\|4436456_4437107_-\|DUF4290-domain-containing-protein	gnl\|CDD\|379482	pfam14123, DUF4290, Domain of unknown function (DUF4290). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 200 and 221 amino acids in length. There are two conserved sequence motifs: EYGR and KLWD.	4.40812e-110
NZ_CP022957.1\|WP_094998881.1\|4441527_4442088_+\|YqgE/AlgH-family-protein	gnl\|CDD\|376864	pfam02622, DUF179, Uncharacterized ACR, COG1678.	2.94608e-58
NZ_CP022957.1\|WP_094998882.1\|4442084_4442930_-\|aminotransferase-class-IV	gnl\|CDD\|376449	pfam01063, Aminotran_4, Amino-transferase class IV. The D-amino acid transferases (D-AAT) are required by bacteria to catalyze the synthesis of D-glutamic acid and D-alanine, which are essential constituents of bacterial cell wall and are the building block for other D-amino acids. Despite the difference in the structure of the substrates, D-AATs and L-ATTs have strong similarity.	2.28936e-48
NZ_CP022957.1\|WP_158657210.1\|4450216_4451419_-\|hypothetical-protein	gnl\|CDD\|132838	cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17. Patatin is a storage protein of the potato tuber that shows Phospholipase A2 activity (PLA2; EC 3.1.1.4). Patatin catalyzes the nonspecific hydrolysis of phospholipids, glycolipids, sulfolipids, and mono- and diacylglycerols, thereby showing lipid acyl hydrolase activity. The active site includes an oxyanion hole with a conserved GGxR motif; it is found in almost all the members of this family. The catalytic dyad is formed by a serine and an aspartate. Patatin belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Members of this family have been found also in vertebrates. This family includes subfamily of PNPLA8 (iPLA2-gamma) and PNPLA9 (iPLA2-beta) like phospholipases from human as well as the Pat17 isozyme from Solanum cardiophyllum.	3.71001e-16
NZ_CP022957.1\|WP_094998887.1\|4448967_4450044_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225212	COG2333, ComEC, Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only].	7.2318e-13
NZ_CP022957.1\|WP_094998890.1\|4455019_4455226_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	8.87619e-13
NZ_CP022957.1\|WP_094998878.1\|4438125_4440024_+\|RecQ-family-ATP-dependent-DNA-helicase	gnl\|CDD\|223588	COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair].	2.66835e-134
NZ_CP022957.1\|WP_094998879.1\|4440020_4440968_+\|methionyl-tRNA-formyltransferase	gnl\|CDD\|234567	PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed.	2.76692e-145
NZ_CP022957.1\|WP_094998883.1\|4442982_4443366_-\|hypothetical-protein	gnl\|CDD\|176856	cd07814, SRPBCC_CalC_Aha1-like, Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins. This family includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of Micromonospora echinospora CalC, human Aha1, and related proteins. Proteins in this group belong to the SRPBCC domain superfamily of proteins, which bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. MeCalC confers resistance to the enediyne, calicheamicin gamma 1 (CLM), by a self sacrificing mechanism which results in inactivation of both CalC and the highly reactive diradical enediyne species. MeCalC can also inactivate two other enediynes, shishijimicin and namenamicin. A crucial Gly of the MeCalC CLM resistance mechanism is not conserved in this subgroup. This family also includes the C-terminal, Bet v1-like domain of Aha1, one of several co-chaperones, which regulate the dimeric chaperone Hsp90. Aha1 promotes dimerization of the N-terminal domains of Hsp90, and stimulates its low intrinsic ATPase activity, and may regulate the dwell time of Hsp90 with client proteins. Aha1 can act as either a positive or negative regulator of chaperone-dependent activation, depending on the client protein, but the mechanisms by which these opposing functions are achieved are unclear. Aha1 is upregulated in a number of tumor lines co-incident with the activation of several signaling kinases.	6.84983e-06
NZ_CP022957.1\|WP_094998889.1\|4451581_4454809_+\|hypothetical-protein	gnl\|CDD\|350769	cd18011, DEXDc_RapA, DEXH-box helicase domain of RapA. In bacteria, RapA is an RNA polymerase (RNAP)-associated SWI2/SNF2 (switch/sucrose non-fermentable) protein that mediates RNAP recycling during transcription. The ATPase activity of RapA is stimulated by its interaction with RNAP and inhibited by its N-terminal domain. The conformational changes of RapA and its interaction with RNAP are essential for RNAP recycling. RapA is part of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	2.62888e-17
NZ_CP022957.1\|WP_094998892.1\|4455564_4456551_+\|HipA-domain-containing-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	5.24675e-49
NZ_CP022957.1\|WP_094998876.1\|4437189_4437477_-\|DUF493-domain-containing-protein	gnl\|CDD\|377327	pfam04359, DUF493, Protein of unknown function (DUF493). This domain is likely to act in a regulatory capacity like pfam01842 domains. This domain has a remarkable property in that the C-terminal residue of every protein in the family lies up in the alignment. This suggests that the C-terminal residue plays some important functional role (Bateman A pers obs).	1.08952e-10
NZ_CP022957.1\|WP_094998884.1\|4443976_4447111_-\|AAA-family-ATPase	gnl\|CDD\|223496	COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair].	9.19473e-14
NZ_CP022957.1\|WP_094998880.1\|4441144_4441417_+\|HU-family-DNA-binding-protein	gnl\|CDD\|259853	cd13831, HU, histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.	6.71595e-39
NZ_CP022957.1\|WP_094998874.1\|4435133_4436441_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP022957.1\|WP_094998877.1\|4437564_4438125_+\|ATP-binding-protein	gnl\|CDD\|379235	pfam13521, AAA_28, AAA domain.	6.12974e-42
NZ_CP022957.1\|WP_094998891.1\|4455235_4455568_+\|phosphatidylinositol-kinase	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	1.64556e-33

>NZ_CP022957.1|WP_094998883.1|4442982_4443366_-|hypothetical-protein
MSEKIKFEIEYVIQSSPQLLYQYLVTPSGLSEWFADNVNSRGEKYIFIWDGAEEEAKLLKRKSDEFVRFSWTEGDDDTYFEMKIIVDEITKDVSLFITDFADEDEVDEAKMLWENQVSDLKQVLGSK
>NZ_CP022957.1|WP_094998882.1|4442084_4442930_-|aminotransferase-class-IV
MINLNGELYGDNHYFLNQNNRGFRYGDSLFETLRVVNGHIYFLEEHYLRLMASMRILRMEIPMNFTMDFFEEEIIKTIQGNVNGPAHRVRFSVYRNNGGLYTPKTNEISYVIEAKSLQSTFYVLGDATYEVELFKDFYVNPDMLSNLKTNNKILNVVAGIYSQENDYQNCLLLNQDKQVVEAINGNVFLVSGNIIKTPPLKDGCIDGIIRKKLISMLKDDENFVIKEESISPFGLQKADEMFITNTISGIISVTNYRKKEFSTEIAKKMVGRLNALARIAI
>NZ_CP022957.1|WP_094998881.1|4441527_4442088_+|YqgE/AlgH-family-protein
MVHLKPNKGKLLIAEPSLTGDVSFNRSVVLLAEHNEEGSVGFILNKPLEYQISDLVSEISKPFQVYNGGPVEQDNLYFIHKVPQLIDNSVEISDGIYWGGDFDKTVDLINNHIISEDDIRFFLGYSGWSSLQLDKELSSNTWIVAKNEHQSQIIQKSSSAFWKEKMLELGGDYLLWSNAPENPSLN
>NZ_CP022957.1|WP_094998880.1|4441144_4441417_+|HU-family-DNA-binding-protein
MNKTELIDAMAADAGITKAAAKKSLESFLGNVEGALKKGDRVSLVGFGSWSVSKRNAREGRNPSTGKTIQIAAKNVVKFKAGSDLSDAVN
>NZ_CP022957.1|WP_094998879.1|4440020_4440968_+|methionyl-tRNA-formyltransferase
MKKLRIVFMGTPDFAVGILDSILNTNYNVVGVITAPDRPAGRGRKLNESSVKKYAMEKGLHILQPTNLKSEEFLNELKLLKANLQVVVAFRMLPRVVWQMPAYGTFNLHASLLPQYRGAAPINWAIINGETKTGVTTFFIDEKIDTGAIILQKEIEIDPEENAGSLHDKLMVLGSVVVLDTIQRIANDNFETEEQENPKELKLAHKIHRDTCRIDWDQPMDNIFNFIRGLSPYPAAWTMLHDGKDETITKIYKVSKEPGRHGLKNGTLINEKNELRVAVTGGYLNILEVQLQGKRKMPIKDLLNGLNLSKNAHLG
>NZ_CP022957.1|WP_094998878.1|4438125_4440024_+|RecQ-family-ATP-dependent-DNA-helicase
MSTEPHRILQQYWGYPNFKGSQEVIINAALKGQDVLALLPTGGGKSICFQVPAMAQEGICIVVSPLISLIQNQVAQLKNLGIKAIGMTGGLKFVEVNDLLDNCIYGNYKFIYLSPERLEQEIIRDRIRQMNVNFLVVDEAHCISQWGHDFRPAYLKCQILRELQPDAPMLALTATATPKVTQDIIEHLQLLNPLVQKDSFSRSNIAFQVHYNEDKSHQLLHYCKQLRSSGIVYTRSRKVTKELSSYLIKNGISSTFYHGGIPEKDKKDKLEKWLKNDITIIVATNAFGMGIDKPDVELVVHYQIPDCIENYFQEAGRAGRNGEKAQAILLTNKTDIELGKKQFLSVLPDVSFVKYIYNKLNNYFQIAYGEGSNEKYRLNFNEFCSVYQLNSLLSYNVLKILDRNSVIALSESFHRMTGIQFISSKENIMTYLSRNTFLDDLVKLILRTYGGIFENETHINTFTLAQKLNYPEKKVLDYLEILEKDEIVDYKASHSDLELTFLVPREDGHTINRFARNITEQNELKKFQVDAILGYINNNKICRSKQLLHYFGEKSSKDCGICDVCVNDTSNREELSDLKEQIISLLRKQTASSKKMQSALGCSSNDLVFILKELLEEGSITLNLKNEYKIVV
>NZ_CP022957.1|WP_094998877.1|4437564_4438125_+|ATP-binding-protein
MDFKRIVITGAPGTGKTSVIKSLENAGYHCFHEIIRTMTLEAKKSQHPDSPLSNPIDFVDDSLAFNRALILGRLEQFKEASQIREKLVFYDRGTPDVLAYMDYFGQTQQQDFKDICEKNKYCQVFILPPWEEIYEQDNERLESYSQAVDLHVHLEETYSSLGYSPIEVPFGTVDERLAFILNKTNI
>NZ_CP022957.1|WP_094998876.1|4437189_4437477_-|DUF493-domain-containing-protein
MEETNSEEFYDKLKEQLEATSSWPSNYLYKFIVLSDQNKINRIHKIFDNMGAVIESKKSKNGKYTSVSITVNLENPDEVIAKYKEVGAIEGVISL
>NZ_CP022957.1|WP_094998875.1|4436456_4437107_-|DUF4290-domain-containing-protein
MDLVDNLEYNTERPQLIIPEYGRHFQKMVDYAVTIEDTAERNRIAKSIISVMGNLQPHLRDVPDFQHKLWDQLFIMSDFKLDVESPFPITSKEMLQKRPEPLDYPQNYPKYRFYGNNIKRMIDVAVKWEKGDKRAGLEYAIANHMKKCYLNWNKEVVDDAAIFKHLYELSNGEIDLAAKGENLTDSGQFLKNRVAKTPRSSSGKKNRSNNRGKKRY
>NZ_CP022957.1|WP_094998874.1|4435133_4436441_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MGTFKIEGGHSLSGEITPQGAKNEALQILCAVLLTSEKVTIHNIPDIVDVNKLISLLEDLGVKIQKKGKGSYTFKSDDINLDYLQSDQFKQDGRGLRGSIMLVGPLLARFGKGYIPKPGGDKIGRRRLDTHFEGFIKLGAKFRYNREEYFYGVEAKELKGTYMLLDEASVTGTANILMAAVLAKGQTTIYNAACEPYLQQLCKMLNRMGAKITGVGSNLLEIEGVDSLGGTEHTMLPDMIEIGSWIGLAAMTKSELTIKNVSWDDLGQIPTTFKKLGIQLERRGDDIYIPEHKDGYEIQNYIDGSILTIADAPWPGLTPDLLSIILVVATQAKGELIIHQKMFESRLFFVDKLLDMGSKIILCDPHRAAIIGHDFKSTLKATTMTSPDIRAGVSLLIAALSAKGTSTIHNIEQIDRGYEDIDVRLRAIGAKIDRV
>NZ_CP022957.1|WP_094998884.1|4443976_4447111_-|AAA-family-ATPase
MKFKSVEISGFRAYDKSEDATFKFTTPEGEVLNFISLYAPNGFGKTSFYDAVEWGITNNVSRLWRRGKDTEKSINTLRELDTDKKQVNLLRNTNTSGPTFVRYFTDRDEKPVERLLKVHGSNKADTKKDVGEQLAFRDVILSQEWISAFLKEDDGEIRYSKFMKNHELQETDVYYQKIKVLQETNKKHLAELRENIKVLKSKISEEDEEDILETVNNLIQKINTDYQKPISDLITLSASKKEIKDLQDVLAKALIEEDNSTDLALLLMAIENAIVGKEGLFSKKQYFEARDNLRKLIAEIKAIEENLKQFERLEAAQNELESGNSEREALQGKAKILERLITQFDNYLETQKEIDDKHEEQKDLRKQKSKLDKEIEQVRRKQIDEKATLDSLAKNKVGLEKEQESLPKLKENLEKTATAIDQGEKRILDLEDIMDKHRADLEKIDEQISELELVKREAKEGQYALTSVSESPRLNKVVEDLLAKSQQKFTIKNELKQLAETITQQEELNTTIQGFIASGLDIVNRNETDSCPLCEHQYDSYKTLADKISNNRALSESLKILLEQKNRSLDEMAKIDTELEKLLNDLMLFYDNGLKNLKERRIQIDNSRTEDQKLLKAQESDLAKLKENQAGLINKTNGKSFENHTSALKESLKGILKNLEDTRTKLAKTDQELTNLETNEKEIIGRIELIATEIENLKSGKSFIEIENWFEDNNPGQKINKGFLEKQTKKNQSALDKVQELLAELRKEIQNLEENLKSLSQNNQQSKLSGAEDQKKDLEKKIAAYERFLQESLSIEGPELSDEALTRLLSQKENETKAQLKKTKKKLEDYRKLDKYSQNIVPFLERKNAKIELEKEEGELALVKKSVTPIINAEVKKTKEFLENKIKEFFYVELINEIYEKIDPHPEFKSVEFKANFDLGTPSLDVFVKDNNNQSTLIPNLYFSTAQINILSLSIFLASALNSHEYDCIFIDDPIQSMDSINVLSTIDLLRSIVINQEKQIILSTHDQNFHNLLKKKIPSRIFKSKFMELESFGKVKDDRQLTN
>NZ_CP022957.1|WP_094998885.1|4447107_4447641_-|hypothetical-protein
MKDSSPSGNVKEAFQEQFLDLSLLYEEIDLGNGKAHAFFVDIEGYEVLEESWQQIVNLIAINFQNKLEKEFERWNIYLFFRLSEAVDKGLKYKIENDTFSCRKIIIDKSESHKSAVEDHILNKLVNIGVSTQSTQNVFEPNKIIQEVLKGKTLKKINTTPDARKAYDLLVEKIINKK
>NZ_CP022957.1|WP_094998886.1|4447615_4448971_-|hypothetical-protein
MTAEDLKRYSVRVGEGSGCFFQPMTNEYTYILTAKHLFSALQNGAEIDIFRHLKNEDGWSEELIPFTLELGVNYFPHSQADAAILKIDYLDGFKELFVKNEINENVGYQLCGFPSQNRDSAEGERYSPYRVERILASGNYCHMAQLFGTVNYDNVAGMSGGGFLKIETDHLSILGIQSRMATNAVQALGQIGFIPIKYYNQIIDANENAGALEKLLPAYLKSFSFFEDEIFSIITGPQEVIVSRRDKLTELLKVKASEIRDSDITPNYIKEHLSNRLLLLEQTNFELQKRGIWRMWLEFLTILNIAKNKAHSLADMPVVFEKVRMFFSDINQDFWTAHLMDLPKLDYSGLGPDGIVVVASNIPSVDREMEILDLSKITSNIAEARKQYAQTHFGHDIDVASEFPLEKYKFINISAFKERVVTELDEDFDNSLPNESLATLKRLYERFIPEW
>NZ_CP022957.1|WP_094998887.1|4448967_4450044_-|MBL-fold-metallo-hydrolase
MIIKFLEAHKGDSILISHQDDEGTSRNILIDGGMSSTYFNSSYNQYGQLHLEIEKIKKRKEKIDLLILSHIDNDHIEGLLKWFSTDAKAYNLVGQVWFNSGKSIAQFFKKEENNDLRLNLKVPNTTYTGVAEAIEFEDYLLKHKIWDKKIIRQGDEFALFGVQLKILSPDNSQLKKLVGEYNKKTGDPVYTSGKKEDWAKNLKDIIQKETLDSFRFKQDTSVKNGSSITVLLTYAEKNFLFLADSHPDRVLKSLQELGYSKEKPIPVELFQISHHGSKSNMHKELLEVVKTNKYVISTDSSSHGHPHKATLARIISVNPQAVIYFNYENVKKSIFTEQDLNDFPNFETKLISEYPVSK
>NZ_CP022957.1|WP_158657210.1|4450216_4451419_-|hypothetical-protein
MYNILSLDGGGSWSLLQFLTLRERYGNSKGHEILGKYDLVIATSGGSLVLAALCCNWDIDKCLSLFYEKQNRTLVFSKNSFWEKYFPADFVGLFGAGPKYSVKKKYAGLKSLFSEIEAIPMEDLPDFIGKPSLKLVVTTFDALHNKAKFFKSYGKEGKPFDSVNLIQAISGSTNAPIGYFDFPARIKAQRSERNFYLWDGALGGFNNPVAAGLTEAIKLGVSKEEINIISLGTSNKITSQRERKYFYLLYINVIKYRKTKPGLGLKFFGKTVINQAKTILYEPPDWANYMTYIWRFDNNLGQALENKKRFIRLSPLLHRHSQDDNANELDHLINELYDLDMDLTNDDDIELLNQCFEKWKIGEIYNQPIRTNLDTKGDVLHDLGHKYFKEAMADWINMKI
>NZ_CP022957.1|WP_094998889.1|4451581_4454809_+|hypothetical-protein
MKNKKQLFIDFDNPSYTWPSQEDFPINEDGRKIKDIILEDLKASKEYLIITGFTSLANIVEVFGSEPLDITRKTRILLGFEPEVRKRKSWSKTPLSEEIKEYWIDRGIDVLKGGKVIQTIEHINNGTIEFRIKERQHSKLYVGDRHAVLGSANFSIQGITTQKEASIRVGSQPYQDVGVSDFNKDLNQYQYDNIRKKALNFWDQGQTYDMKSLLEGLLQKVPWDQALARALAEILEGNWISNYPEFKNKIDNAKLWPFQISGLAKSMILLDHQGSVLIADPTGSGKTRMVTICMLSLIHKLWESGRRDQCNSLVLCPKNIVENWEKESLNLSFLNTPPISMGILQREGRNRNKTIKALQLTNILVLDEAHNFLSRKSNRSNAFKEHNASYVILSTATPINKKADDLLRIIELLGPDNLQDEELLKLKELYKTPIREKKAEDLKRLNRFIQKFILRRTKKRLNQLIDKEPEAYVNKFGNRAKFPKVNNRTYKTAETKQDIEIAQQIGVKAKQLRGLIYLRKFRIPVYIEKEDTERIMVYYKQRIKTATAFTGYHIQNSLRSSTAALMEHVVGTQTTKKFYDLKGHKSDTGNIISKLESFREKPLPRSDYPQLLPDWLTDSIEYEKVINHEIKTYKEILELLKSMSDSRERGKAKQLMLLVDKHGLVLGFDSTVLTLFYLRKLLREFGYPEKIHLVSGSSDAARLEVQEVFGIDSKVERGLALCSDVMAEGVNLQRAKALLQLDFPSVMRLAEQRVGRLHRMDSPHDDIEVFWSKDSESFALKADRRLVRTTILTEKLIGGNLDLPDELLEGEEDLISAAEFIREFNPFEREDSDWQGLNDAFDPLYRLKEGNNAIIKEEVYEELKRTKASIQCRVSFVKSKEDWAFICTKGTEKKSPLWLFIEASGVVHNEFSVICQLLRENLDNVTDIDWSPKTLDNFISIFRRNERNAIPNKKRRALEVAEFLLTKQIRYEKDDTIIRLIKELQKAFRAGYRIDEMAIDYSRFAELWLELLMPMLKEKQLKATRRALITLENLKTPWLKRYFEPERLKSIYDHIPLTEKLEKRIAACIVGIKNK
>NZ_CP022957.1|WP_094998890.1|4455019_4455226_+|helix-turn-helix-transcriptional-regulator
MSKKKIGKSIKARRKALRVTQQQLAQLADVSVNTLYKIERGQANPTLETLDGIADVLGMEVCLKVKKL
>NZ_CP022957.1|WP_094998891.1|4455235_4455568_+|phosphatidylinositol-kinase
MRQAKILFKGEEAGILTQYDDGSFTYRYHDQWLGDSGKPAISLTLPKTEQEYRSEHLFPFFFNMLPEGTNKQVVCRHMKIDQDDYFGLLLTTARYDTIGAITVKKIEQPI
>NZ_CP022957.1|WP_094998892.1|4455564_4456551_+|HipA-domain-containing-protein
MSLPMIKYCPGTLAEGYETYSTTCLRRVFDGRKVNHILPYDSPASNEATDELFVENRKRISISGVQEKFSVLLEKNKLRLINEGEQGTYILKPIPGAGKNPDQMPANEHLTMQIARQVFDIETAENALIFFKDGTPAYITKRFDVKKGGGKLAKEDFASLAGRTPQTHGEHYKYSGSYLELFELMKKYLPAYQLEAPKLFRLLVFNYLFSNGDAHFKNFSLLETELGDFRLSPAYDLLNTRMHIEDSDFALDDGLLPKNLSKGKVMQQFLSLAEHAKIGQGQLDGVLEKLLSNSEEVEKLIDASYLSDTSKRNYLQSYQTRLKKLNRK
>NZ_CP022957.1|WP_094998893.1|4456631_4456838_+|hypothetical-protein
MKNLNNFTFSDVKAIYDFLELRKDIVSKNPEHFEKGEVHTILAKQKIVWQQLHSRMNEIEELKSYENE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3389531 : 3455225

uncultured_Mediterranean_phage(25.0%)

transposase,integrase,protease,tRNA

attL 3448789:3448848|attR 3454096:3455506

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094999269.1\|3389531_3390113_-\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_094998041.1\|3390212_3391061_+	hypothetical protein	NA	NA	NA	NA
WP_094998042.1\|3391067_3391976_+	hydrolase TatD	NA	NA	NA	NA
WP_094998043.1\|3391977_3392877_+	UbiA-like protein EboC	NA	NA	NA	NA
WP_094998044.1\|3392881_3394042_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_094998045.1\|3394049_3395243_+	metabolite traffic protein EboE	NA	NA	NA	NA
WP_094998046.1\|3395244_3396621_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_094998047.1\|3396626_3396980_+	hypothetical protein	NA	NA	NA	NA
WP_094998048.1\|3396968_3398819_-	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	4.6e-49	37.2
WP_094998049.1\|3399230_3400346_-	DUF2914 domain-containing protein	NA	NA	NA	NA
WP_094998050.1\|3400443_3400977_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_094998051.1\|3400976_3401813_-	DUF3822 family protein	NA	NA	NA	NA
WP_094998052.1\|3401790_3402441_-	hypothetical protein	NA	NA	NA	NA
WP_094998053.1\|3402541_3403975_+	AAA family ATPase	A0A223LDI7	Bacillus_phage	3.5e-20	27.4
WP_094998054.1\|3404050_3404620_+	DUF4126 domain-containing protein	NA	NA	NA	NA
WP_094998055.1\|3404630_3405359_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_094998056.1\|3405349_3406048_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_094998057.1\|3406057_3407185_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_094998058.1\|3407235_3407778_+	acyltransferase	NA	NA	NA	NA
WP_094998059.1\|3407859_3408573_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_094998060.1\|3408652_3408940_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_094998061.1\|3408946_3409768_-	sugar nucleotide-binding protein	NA	NA	NA	NA
WP_094998062.1\|3409769_3410684_-	glutaminase	NA	NA	NA	NA
WP_094998063.1\|3410684_3411770_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_094998064.1\|3411895_3413506_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_094998065.1\|3413502_3414798_-	threonine synthase	NA	NA	NA	NA
WP_094998066.1\|3414830_3415751_-	homoserine kinase	NA	NA	NA	NA
WP_094998067.1\|3415753_3418195_-	bifunctional aspartate kinase/homoserine dehydrogenase I	NA	NA	NA	NA
WP_094998068.1\|3418463_3420011_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_094998069.1\|3420017_3420419_-	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_094998070.1\|3420630_3423183_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	4.1e-125	34.1
WP_094998071.1\|3423441_3425931_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.1e-109	33.2
WP_094998072.1\|3426004_3427267_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_094998073.1\|3427317_3428067_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_094998074.1\|3428084_3429260_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_094998075.1\|3429386_3431423_+	HDIG domain-containing protein	NA	NA	NA	NA
WP_158657175.1\|3431610_3433929_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_094998077.1\|3436148_3436451_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	8.6e-14	47.2
WP_094998078.1\|3436463_3436745_-	plasmid maintenance system killer family protein	A0A222YWE2	Escherichia_phage	7.7e-09	42.6
WP_094998079.1\|3440431_3441319_-	4,5-DOPA dioxygenase extradiol	NA	NA	NA	NA
WP_034887672.1\|3441336_3441720_-	hypothetical protein	NA	NA	NA	NA
WP_094998080.1\|3441966_3442812_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_034893277.1\|3442815_3443340_-	YceI family protein	NA	NA	NA	NA
WP_034887811.1\|3443381_3443951_-	YceI family protein	NA	NA	NA	NA
WP_034893272.1\|3444047_3444881_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094998081.1\|3445050_3445851_-	abortive infection family protein	NA	NA	NA	NA
WP_094999138.1\|3448032_3448788_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.8e-13	32.4
WP_094996498.1\|3448787_3449918_+\|transposase	IS91 family transposase	NA	NA	NA	NA
3448789:3448848	attL	NA	NA	NA	NA
WP_094998082.1\|3450210_3450606_-	hypothetical protein	NA	NA	NA	NA
WP_094998083.1\|3450620_3450878_-	hypothetical protein	NA	NA	NA	NA
WP_158657176.1\|3451066_3451591_-	cupin domain-containing protein	NA	NA	NA	NA
WP_094996355.1\|3452023_3452995_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094999138.1\|3453339_3454095_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.8e-13	32.4
WP_094996498.1\|3454094_3455225_+\|transposase	IS91 family transposase	NA	NA	NA	NA
3454096:3455506	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3537939 : 3640305

Cronobacter_phage(20.0%)

transposase,integrase

attL 3593036:3593095|attR 3648576:3648592

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094998156.1\|3537939_3539193_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	2.2e-34	40.6
WP_094999276.1\|3539542_3539950_+	hypothetical protein	NA	NA	NA	NA
WP_094998157.1\|3540236_3540446_-	hypothetical protein	NA	NA	NA	NA
WP_094998158.1\|3540445_3541048_-	mercuric transport protein MerTP	NA	NA	NA	NA
WP_094998159.1\|3541049_3541421_-	winged helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	9.0e-05	30.1
WP_094998160.1\|3541487_3542492_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094998161.1\|3542791_3543628_+	DUF932 domain-containing protein	A0A1B0WMN7	Flavobacterium_phage	1.4e-74	50.0
WP_094998163.1\|3544018_3544966_+	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_158657181.1\|3545517_3545682_-	hypothetical protein	NA	NA	NA	NA
WP_094998166.1\|3546173_3546530_+	single-stranded DNA-binding protein	A0A2I6UGD9	Salinibacter_virus	5.9e-22	44.9
WP_094998167.1\|3546605_3546986_+	hypothetical protein	NA	NA	NA	NA
WP_094998168.1\|3547008_3547206_+	hypothetical protein	NA	NA	NA	NA
WP_094998169.1\|3547637_3548018_+	hypothetical protein	NA	NA	NA	NA
WP_094998170.1\|3548029_3549061_+	mobilization protein	NA	NA	NA	NA
WP_094999277.1\|3549070_3550651_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_094998171.1\|3550856_3553895_+	N-6 DNA methylase	R4TFP1	Halovirus	1.3e-08	24.9
WP_094998172.1\|3553898_3554519_+	hypothetical protein	NA	NA	NA	NA
WP_094998173.1\|3554593_3554944_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094998174.1\|3554909_3555272_-	hypothetical protein	NA	NA	NA	NA
WP_094998175.1\|3555279_3556140_-	DUF4138 domain-containing protein	NA	NA	NA	NA
WP_094998176.1\|3556136_3557066_-	conjugative transposon protein TraM	NA	NA	NA	NA
WP_094998177.1\|3557055_3557670_-	conjugal transfer protein TraK	NA	NA	NA	NA
WP_094998178.1\|3557681_3558524_-	hypothetical protein	NA	NA	NA	NA
WP_094998179.1\|3558526_3559102_-	conjugal transfer protein	NA	NA	NA	NA
WP_094998180.1\|3559106_3561509_-	TraG family conjugative transposon ATPase	NA	NA	NA	NA
WP_094998181.1\|3561501_3561780_-	hypothetical protein	NA	NA	NA	NA
WP_094998182.1\|3561779_3562067_-	hypothetical protein	NA	NA	NA	NA
WP_094998183.1\|3562256_3562889_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	3.8e-19	35.8
WP_094998184.1\|3562993_3563656_-	ATPase	NA	NA	NA	NA
WP_094998185.1\|3563639_3564392_-	hypothetical protein	NA	NA	NA	NA
WP_094998186.1\|3564396_3564681_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_094998187.1\|3565003_3565840_-	hypothetical protein	NA	NA	NA	NA
WP_094998188.1\|3567035_3567527_-	asparaginase	NA	NA	NA	NA
WP_094998189.1\|3567916_3568549_-	hypothetical protein	NA	NA	NA	NA
WP_094998190.1\|3568559_3569249_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_094998191.1\|3569301_3569514_-	hypothetical protein	NA	NA	NA	NA
WP_094998192.1\|3569554_3570811_-	MFS transporter	NA	NA	NA	NA
WP_094998193.1\|3570851_3572045_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_094998194.1\|3572074_3576475_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_094998195.1\|3576682_3577042_-	hypothetical protein	NA	NA	NA	NA
WP_094998197.1\|3577973_3579920_-	c-type cytochrome	NA	NA	NA	NA
WP_094998198.1\|3580052_3581960_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.1e-127	40.0
WP_094998199.1\|3582054_3582912_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_094998200.1\|3583575_3583785_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_094998201.1\|3584277_3585528_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	1.9e-35	32.8
WP_094998202.1\|3585838_3586447_-	hypothetical protein	NA	NA	NA	NA
WP_094998203.1\|3586531_3586723_+	hypothetical protein	NA	NA	NA	NA
WP_094998204.1\|3586789_3588070_-	hypothetical protein	NA	NA	NA	NA
WP_094998205.1\|3588747_3589308_+	hypothetical protein	NA	NA	NA	NA
WP_094998206.1\|3589338_3590307_+	mobilization protein	NA	NA	NA	NA
WP_094998207.1\|3590528_3591593_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_094998208.1\|3591888_3592506_-	MarC family protein	NA	NA	NA	NA
WP_094998209.1\|3592507_3593017_-	DUF3124 domain-containing protein	NA	NA	NA	NA
3593036:3593095	attL	NA	NA	NA	NA
WP_094998210.1\|3593078_3593345_+	hypothetical protein	NA	NA	NA	NA
3593036:3593095	attL	NA	NA	NA	NA
WP_158657182.1\|3593446_3594022_-	hypothetical protein	NA	NA	NA	NA
WP_094999138.1\|3594383_3595139_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.8e-13	32.4
WP_094996498.1\|3595138_3596269_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_094998212.1\|3596561_3597131_-	hypothetical protein	NA	NA	NA	NA
WP_094998213.1\|3597193_3597442_+	hypothetical protein	NA	NA	NA	NA
3597151:3597426	attR	NA	NA	NA	NA
WP_094996355.1\|3597753_3598725_+\|transposase	IS110 family transposase	NA	NA	NA	NA
3597151:3597426	attR	NA	NA	NA	NA
WP_094998214.1\|3598848_3600027_-	hypothetical protein	NA	NA	NA	NA
WP_127137563.1\|3600023_3600548_-	hypothetical protein	NA	NA	NA	NA
WP_094996355.1\|3600908_3601880_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094998216.1\|3602011_3602416_-	hypothetical protein	NA	NA	NA	NA
WP_094998217.1\|3602415_3603030_-	hypothetical protein	NA	NA	NA	NA
WP_094998218.1\|3603029_3603518_-	hypothetical protein	NA	NA	NA	NA
WP_094999138.1\|3603948_3604704_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.8e-13	32.4
WP_094996498.1\|3604703_3605834_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_094998219.1\|3606106_3606646_-	hypothetical protein	NA	NA	NA	NA
WP_094999138.1\|3607014_3607770_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.8e-13	32.4
WP_094996498.1\|3607769_3608900_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_094998220.1\|3609179_3610235_-	YbjQ family protein	NA	NA	NA	NA
WP_094996355.1\|3610580_3611552_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094998221.1\|3611678_3611915_-	hypothetical protein	NA	NA	NA	NA
WP_094998222.1\|3611967_3612495_-	hypothetical protein	NA	NA	NA	NA
WP_094998223.1\|3614393_3614891_-	hypothetical protein	NA	NA	NA	NA
WP_094998224.1\|3615160_3615469_-	hypothetical protein	NA	NA	NA	NA
WP_094998225.1\|3615458_3615998_-	hypothetical protein	NA	NA	NA	NA
WP_094998226.1\|3616000_3617773_-	AAA family ATPase	G8DDJ2	Micromonas_pusilla_virus	9.5e-28	32.6
WP_094998227.1\|3617931_3620448_-	Hsp70 family protein	A0A167RAE1	Powai_lake_megavirus	2.6e-23	27.4
WP_094998228.1\|3620457_3621393_-	hypothetical protein	NA	NA	NA	NA
WP_094998229.1\|3621395_3623414_-	hypothetical protein	NA	NA	NA	NA
WP_094996355.1\|3623930_3624902_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094998230.1\|3625157_3626810_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-41	27.4
WP_002978232.1\|3626840_3627452_-	organomercurial lyase	NA	NA	NA	NA
WP_002978236.1\|3627471_3627768_-	hypothetical protein	NA	NA	NA	NA
WP_094998231.1\|3627769_3628117_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_034736775.1\|3628164_3628770_-	mercuric transport protein MerTP	NA	NA	NA	NA
WP_027375684.1\|3628766_3629144_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	6.1e-09	31.1
WP_094998232.1\|3631228_3631777_-	HNH endonuclease	K4F7W4	Cronobacter_phage	2.3e-09	42.4
WP_094998233.1\|3631938_3633147_-	hypothetical protein	NA	NA	NA	NA
WP_094998234.1\|3633168_3634416_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_094998232.1\|3636368_3636917_-	HNH endonuclease	K4F7W4	Cronobacter_phage	2.3e-09	42.4
WP_158657183.1\|3637077_3637569_-	hypothetical protein	NA	NA	NA	NA
WP_094998232.1\|3637770_3638319_-	HNH endonuclease	K4F7W4	Cronobacter_phage	2.3e-09	42.4
WP_094998232.1\|3638489_3639038_-	HNH endonuclease	K4F7W4	Cronobacter_phage	2.3e-09	42.4
WP_094998236.1\|3639189_3640305_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	7.1e-29	37.6
3648576:3648592	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022957

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection