CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP022991	Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence	0 crisprs	NA	0	1
NZ_CP022989	Paraburkholderia aromaticivorans strain BN5 chromosome 1, complete sequence	2 crisprs	csa3,cas14j,cas3,WYL,PD-DExK,DEDDh,DinG	1	6
NZ_CP022993	Paraburkholderia aromaticivorans strain BN5 plasmid pBN3, complete sequence	0 crisprs	RT,PrimPol	0	2
NZ_CP022995	Paraburkholderia aromaticivorans strain BN5 plasmid pBN5, complete sequence	0 crisprs	NA	0	0
NZ_CP022990	Paraburkholderia aromaticivorans strain BN5 chromosome 2, complete sequence	0 crisprs	csa3,DinG,cas3	0	1
NZ_CP022994	Paraburkholderia aromaticivorans strain BN5 plasmid pBN4, complete sequence	0 crisprs	NA	0	2
NZ_CP022996	Paraburkholderia aromaticivorans strain BN5 plasmid pBN6, complete sequence	0 crisprs	NA	0	0
NZ_CP022992	Paraburkholderia aromaticivorans strain BN5 plasmid pBN2, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

568999 : 608091

Leptospira_phage(11.11%)

plate,integrase,transposase

attL 568952:568966|attR 590491:590505

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
568952:568966	attL	NA	NA	NA	NA
WP_095423325.1\|568999_570087_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.0e-41	36.8
WP_095423326.1\|570439_572647_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_095423327.1\|572649_573111_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	5.2e-10	30.9
WP_095423328.1\|573296_574241_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_157763856.1\|574456_574642_-	hypothetical protein	NA	NA	NA	NA
WP_095423329.1\|575421_575691_-	DUF1488 family protein	NA	NA	NA	NA
WP_095423330.1\|575829_576198_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423331.1\|576635_577640_-	phospholipase	NA	NA	NA	NA
WP_095423332.1\|579595_580087_+	hypothetical protein	NA	NA	NA	NA
WP_095423434.1\|580124_580601_-	CreA family protein	NA	NA	NA	NA
WP_095423334.1\|581385_583890_+	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.9e-61	27.7
WP_095423335.1\|583926_584547_+	hypothetical protein	NA	NA	NA	NA
WP_167397612.1\|588246_588393_-	hypothetical protein	NA	NA	NA	NA
WP_095423336.1\|588463_589654_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_157763857.1\|589675_590422_-	MFS transporter	NA	NA	NA	NA
WP_157763858.1\|590445_590907_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.1e-33	48.0
590491:590505	attR	NA	NA	NA	NA
WP_095423339.1\|591070_592306_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	D2TEZ5	Emiliania_huxleyi_virus	2.4e-25	26.7
WP_095423340.1\|592250_593198_-	branched-chain amino acid transferase	NA	NA	NA	NA
WP_095423341.1\|593194_593752_-	peptide deformylase	K4JRM9	Caulobacter_phage	9.6e-11	33.1
WP_095423435.1\|593748_594879_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095423342.1\|595002_595479_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_095423436.1\|595543_596275_-\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	1.3e-20	30.3
WP_095423343.1\|596865_597627_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	8.5e-34	39.7
WP_095423344.1\|597681_598227_+	DUF3455 domain-containing protein	NA	NA	NA	NA
WP_095423345.1\|598296_599721_-	serine/threonine protein kinase	A0A1B1IUU3	uncultured_Mediterranean_phage	4.2e-18	28.2
WP_095423346.1\|599717_600638_-	DUF3365 domain-containing protein	NA	NA	NA	NA
WP_095423437.1\|600634_601546_-	hypothetical protein	NA	NA	NA	NA
WP_095423348.1\|601917_602439_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_095423438.1\|602447_603950_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_095423349.1\|604032_604536_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_095423350.1\|604670_605183_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_095423351.1\|605188_607087_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_095423352.1\|607050_608091_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022989

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022989_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022989_1

355430-355515

Orphan

Consensus_repeat	Method
GCATTCGCATGACCACGACCACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022989_1

>merge|NZ_CP022989|1|355430-355515|CRISPRCasFinder
GCATGAGCATTCGCATGACCACGACCACGACCATGGGCATGGTCACGCGGCGCGTGAGCATGAGCGTGCGCATGCGCATGACCACG

>NZ_CP022989|1|1|355430-355515|CRISPRCasFinder
GCATGAGCATTCGCATGACCACG	ACCACGACCATGGGCATGGTCACGCGGCGCGTGAGCATGA
GCGTGCGCATGCGCATGACCACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022989.1\|WP_095417267.1\|359284_360286_-\|lipopolysaccharide-heptosyltransferase-I	unknown	unknown	gnl\|CDD\|274025
NZ_CP022989.1\|WP_095417262.1\|353202_354909_+\|urease-subunit-alpha	unknown	unknown	gnl\|CDD\|237305
NZ_CP022989.1\|WP_095417264.1\|356261_356915_+\|urease-accessory-protein-UreG	unknown	unknown	gnl\|CDD\|349776
NZ_CP022989.1\|WP_095417260.1\|352517_352820_+\|urease-subunit-gamma	unknown	unknown	gnl\|CDD\|183913
NZ_CP022989.1\|WP_095417261.1\|352838_353144_+\|urease-subunit-beta	unknown	unknown	gnl\|CDD\|237303
NZ_CP022989.1\|WP_095417258.1\|349348_350041_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP022989.1\|WP_095417259.1\|351538_352342_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270233
NZ_CP022989.1\|WP_095420169.1\|345595_347257_+\|urea-ABC-transporter-permease-subunit-UrtB	unknown	unknown	gnl\|CDD\|200272
NZ_CP022989.1\|WP_091796480.1\|348439_349303_+\|urea-ABC-transporter-ATP-binding-protein-UrtD	unknown	unknown	gnl\|CDD\|274568
NZ_CP022989.1\|WP_091796478.1\|344096_345395_+\|urea-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|372603
NZ_CP022989.1\|WP_095417268.1\|360516_361911_-\|phosphomannomutase/phosphoglucomutase	unknown	unknown	gnl\|CDD\|100091
NZ_CP022989.1\|WP_095417265.1\|356951_358268_-\|3-deoxy-D-manno-octulosonic-acid-transferase	unknown	unknown	gnl\|CDD\|235589
NZ_CP022989.1\|WP_095417272.1\|365493_366516_+\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
NZ_CP022989.1\|WP_095417270.1\|363462_364293_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133038
NZ_CP022989.1\|WP_095417271.1\|364332_365481_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340837
NZ_CP022989.1\|WP_095417257.1\|347258_348443_+\|urea-ABC-transporter-permease-subunit-UrtC	unknown	unknown	gnl\|CDD\|132449
NZ_CP022989.1\|WP_095417266.1\|358350_359235_-\|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase	unknown	unknown	gnl\|CDD\|371337
NZ_CP022989.1\|WP_095417269.1\|362203_363466_+\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP022989.1\|WP_095420171.1\|355569_356250_+\|urease-accessory-protein-UreF	unknown	unknown	gnl\|CDD\|223900
NZ_CP022989.1\|WP_095420170.1\|350157_351039_+\|urease-accessory-protein-UreD	unknown	unknown	gnl\|CDD\|223899

Protein	Function_ID	Function_description	E-value
NZ_CP022989.1\|WP_095417267.1\|359284_360286_-\|lipopolysaccharide-heptosyltransferase-I	gnl\|CDD\|274025	TIGR02193, LIPOPOLYSACCHARIDE_HEPTOSYLTRANSFERASE-1, lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	5.00459e-145
NZ_CP022989.1\|WP_095417262.1\|353202_354909_+\|urease-subunit-alpha	gnl\|CDD\|237305	PRK13207, ureC, urease subunit alpha; Reviewed.	0
NZ_CP022989.1\|WP_095417264.1\|356261_356915_+\|urease-accessory-protein-UreG	gnl\|CDD\|349776	cd05540, UreG, urease accessory protein UreG. UreG is one of the four accessory proteins of urease. Urease is an enzyme which catalyzes the decomposition of urea to form ammonia and carbon dioxide. Bacterial urease is a trimer of three subunits which are encoded by genes ureA, ureB, and ureC. Up to four accessory proteins (ureD, ureE, ureF, and ureG) are required for urease catalytical function. UreG may play an important role in nickel incorporation of the urease metallocenter. UreG is a member of the Fer4_NifH superfamily which contains an ATP-binding domain. Proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.	2.32727e-125
NZ_CP022989.1\|WP_095417260.1\|352517_352820_+\|urease-subunit-gamma	gnl\|CDD\|183913	PRK13241, ureA, urease subunit gamma; Provisional.	1.44973e-71
NZ_CP022989.1\|WP_095417261.1\|352838_353144_+\|urease-subunit-beta	gnl\|CDD\|237303	PRK13203, ureB, urease subunit beta; Reviewed.	1.47542e-71
NZ_CP022989.1\|WP_095417258.1\|349348_350041_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	8.42314e-143
NZ_CP022989.1\|WP_095417259.1\|351538_352342_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270233	cd01072, PBP2_SMa0082_like, The substrate-binding domain of putatuve amino acid transporter; the type 2 periplasmic binding protein fold. This group includes the periplamic-binding protein component of a putative amino acid ABC transporter from Sinorhizobium meliloti and its related proteins. The putative SMa0082-like domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.59843e-125
NZ_CP022989.1\|WP_095420169.1\|345595_347257_+\|urea-ABC-transporter-permease-subunit-UrtB	gnl\|CDD\|200272	TIGR03409, urea_trans_UrtB, urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	3.92665e-152
NZ_CP022989.1\|WP_091796480.1\|348439_349303_+\|urea-ABC-transporter-ATP-binding-protein-UrtD	gnl\|CDD\|274568	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	6.82349e-150
NZ_CP022989.1\|WP_091796478.1\|344096_345395_+\|urea-ABC-transporter-substrate-binding-protein	gnl\|CDD\|372603	pfam13433, Peripla_BP_5, Periplasmic binding protein domain. This domain is found in a variety of bacterial periplasmic binding proteins.	0
NZ_CP022989.1\|WP_095417268.1\|360516_361911_-\|phosphomannomutase/phosphoglucomutase	gnl\|CDD\|100091	cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a bisphosphorylated sugar intermediate. The reaction involves two phosphoryl transfers, with an intervening 180 degree reorientation of the reaction intermediate during catalysis. Reorientation of the intermediate occurs without dissociation from the active site of the enzyme and is thus, a simple example of processivity, as defined by multiple rounds of catalysis without release of substrate. Glucose-6-phosphate and glucose-1-phosphate are known to be utilized for energy metabolism and cell surface construction, respectively. PMM/PGM belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the phosphoglucomutases (PGM1 and PGM2). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP022989.1\|WP_095417265.1\|356951_358268_-\|3-deoxy-D-manno-octulosonic-acid-transferase	gnl\|CDD\|235589	PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed.	0
NZ_CP022989.1\|WP_095417272.1\|365493_366516_+\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP022989.1\|WP_095417270.1\|363462_364293_+\|glycosyltransferase	gnl\|CDD\|133038	cd04195, GT2_AmsE_like, GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.	1.1837e-19
NZ_CP022989.1\|WP_095417271.1\|364332_365481_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340837	cd03808, GT4_CapM-like, capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.	4.70846e-119
NZ_CP022989.1\|WP_095417257.1\|347258_348443_+\|urea-ABC-transporter-permease-subunit-UrtC	gnl\|CDD\|132449	TIGR03408, urea_trans_UrtC, urea ABC transporter, permease protein UrtC. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	2.47817e-150
NZ_CP022989.1\|WP_095417266.1\|358350_359235_-\|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase	gnl\|CDD\|371337	pfam11004, Kdo_hydroxy, 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase. This is a family of 3-deoxy-D-manno-oct-2-ulosonic acid 3-hydroxylases, which catalyze the conversion of 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) to D-glycero-D-talo-oct-2-ulosonic acid (Ko). It contains a potential iron-binding motif, HXDX(n)H (n>40). Hydroxylation activity is iron-dependent.	1.33078e-165
NZ_CP022989.1\|WP_095417269.1\|362203_363466_+\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	5.67652e-28
NZ_CP022989.1\|WP_095420171.1\|355569_356250_+\|urease-accessory-protein-UreF	gnl\|CDD\|223900	COG0830, UreF, Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones].	4.21534e-55
NZ_CP022989.1\|WP_095420170.1\|350157_351039_+\|urease-accessory-protein-UreD	gnl\|CDD\|223899	COG0829, UreH, Urease accessory protein UreH [Posttranslational modification, protein turnover, chaperones].	2.80156e-79

>NZ_CP022989.1|WP_095417262.1|353202_354909_+|urease-subunit-alpha
MTLRIGRRAYAEMFGPTTGDRVRLADTELLIEVERDFTTYGEEVKFGGGKVIRDGMGQSQRVHAEVVDTVVTNAVILDHWGIVKADIGIKNGRIAAIGKAGNPDIQPNVTIAIGASTEVIAGEGLIVTAGGIDTHIHFISPQQIEEALASGVTTMLGGGTGPATGTNATTCTPGPWHLERMLQAADGYPMNLGFLGKGNVSQPQPALEQIAAGAIGLKLHEDWGTTPAAIDNCLSVADDTDTQVAIHTDTLNEAGFVEATVAAFKGRTIHTYHTEGAGGGHAPDIIKVCGEANVLPSSTNPTRPYTVNTLEEHLDMLMVCHHLDPSIAEDIAFAESRIRRETIAAEDILHDLGALSMLSSDSQAMGRVGEVIIRTWQTAHKMKVQRGALPEDNARHDNFRAKRYVAKYTINPAITHGIAHEVGSIEPGKWADLVFWEPAFFGIKPSLILKGGMIAMAQMGDPNASIPTPQPVHYREMFATRGGALGRTSLTFVSQMAADAGVAERYGLNKRIVAVRNCRNISKADMIHNAWRPAISVDPETYQVIADGQLLTCEPATVLPMAQRYFLF
>NZ_CP022989.1|WP_095417261.1|352838_353144_+|urease-subunit-beta
MIPGEFLIDDGEHELNAGRATVTVVVSNTGDRPVQIGSHYHFYEVNEALAFDREAARGFRLNIAAGTAVRFEPGQERTVELVELAGERVVYGFNGKVMGKL
>NZ_CP022989.1|WP_095417260.1|352517_352820_+|urease-subunit-gamma
MKLTPREKDKLLIFTAALLAERRRARGLKLNYPEAIAFITAELMEAARDGKTVAEVMHYGTTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP
>NZ_CP022989.1|WP_095417259.1|351538_352342_+|transporter-substrate-binding-domain-containing-protein
MTRSTLRPARRAWLAALLLSPVLAIHAPAAHADTLDNIAKAGVLKVAVPEDYPPFGSVGADMKPQGYDIDTAALLAKSMNVKLELVPVNSANRIPYLQTGKVDLVISSLGKTPDREKVIDFSSAYAPYYQGVFGPADIKVSGPADLTGKTVGATRGALEEIGLTQMAPNATIKRFEDNNATIAAFLSGQVQLIAAGNIVAAAILAKNPPRRPEPKFVIKNSPCFVGMNKNEPRLQQKVNAAIAQAKQDGTLNTMSKKWFSAPLPADL
>NZ_CP022989.1|WP_095420170.1|350157_351039_+|urease-accessory-protein-UreD
MSLHENHATLAIAQAGAHSQWRARLELGFVRDGERTTLKHRLHDGPLRVQRPLYPEGYGVCHAVIVHPPGGIAGGDELAIDVAVGDAAHAVITTPGATKWYKSNGREAQQRIDVRVGARAKLDWLPQNNIVFDQANAKLDFSLTLGEGATALGWDATQLGRQAAGERWSEGSLRSLSRIVGADGELLWLERASLSANDSLRDAAQGLAGFPAYGTLWAVGAACDDALAEALTAQLSFDGSLRGAASCVTSGVVIVRAVSRSMETLQRALTQCWLQLRPVVHGVGALPLRIWAT
>NZ_CP022989.1|WP_095417258.1|349348_350041_+|urea-ABC-transporter-ATP-binding-subunit-UrtE
MLEVENLNQYYGGSHILRDVKLTVPDGKLTVLLGRNGVGKTTLLRCLMGVVQTKSGSIAWRGAAITKLPTYSRVEKGLAYVPQGRDIFPRLTVEENLLVGAASKKAPKKIPDRIYELFPVLKDMRSRRGGDLSGGQQQQLAIGRALMSDPQLLILDEPTEGIQPSIIQDIGRTLRQLVEEMGMTVLLVEQYYDFAKEIADRYWVMSRGEIIAGGEGANMDADGVRTLIAV
>NZ_CP022989.1|WP_091796480.1|348439_349303_+|urea-ABC-transporter-ATP-binding-protein-UrtD
MNENPMVPDLALPEDPAETSLSGVASMGRAVVPGEIDVSHGTILYLEDVTVSFDGFRALNALTLTIDAGELRCIIGPNGAGKTTMMDVITGKTEPDSGKVFLGQSIDLTRMNEPSIARAGIGRKFQKPTVFEQHPVWENLELAMKADKGWWASLRARLDREAQARIEETLALIGLESEARRLAGELSHGQKQRLEIGMLLMQQPALLLLDEPAAGMTDDETMQLAELLNHLRGTCSMMVVEHDMEFVAALSGSTGKVTVMAEGRVLAHGTLDEVKRDETVIESYLGR
>NZ_CP022989.1|WP_095417257.1|347258_348443_+|urea-ABC-transporter-permease-subunit-UrtC
MTSATSSAHVGASGGGALAGREAQAGFALGLPPRPALLSRRAWLALIALIIVFGLGVPFATLVVPETSALHLSAYAMTITGKFMCYAIAALALDLVWGYCGILSLGHALFFALGGYAIGMYLMRSIGHEGKYGSDLPDFMVFLDWHHLPWYWQGTQHLGYALLLVVLVPAVVAWVFGFFTFRSRVKGVYLSIITQAMTFAAMLLFYRNETGFGGNNGFTDFKRIGGFPITHPGTRTALLLITFAVLILAFLGARAIVTSKLGRVVTAVRDGETRLMFLGYSPLAYKLFVWTVSAVLCGIAGALYVPQVGIINPGEMSPGNSIEMAIWVAVGGRGTLIGPIIGAFAVNGAKSFFTANFPEYWLFFLGLIFVLVPLFLPNGIMGLIELVTRKRNRS
>NZ_CP022989.1|WP_095420169.1|345595_347257_+|urea-ABC-transporter-permease-subunit-UrtB
MAFSFLTSARTRARTLARRLARRGIAGAALVLLAGAPLTAFALTQADVAPLAGDDFDAKSAAIDKLIANHDKESMAVLKALSEDGALATDSGAVLLQDGDTAKDAVTGKTVAAGDAQPVTLNNLLRSKVAGALSGLQLDSPDKAAREAAITALLQNPDPSIKPLVDAARAKETDPALKKRLDTLWAMTALHDADPARRLEAVQLVAARHDLDMNELLRPIVAKKPDGTFVEADDRVRAAAQSGIDELDAIQRRSQIAGTLFAGLSLGSVLLLAALGLAITYGLIGVINMAHGEFLMIGAYATYVVQNLFQRFAPGAFDWYPLLAIPASFVAAGLVGIVLERLVLKHLYGRPLETLLTTFGVSLILIQATRMLFGAQNVQVVNPAWMSGGVTVLPNLILPYNRLAILAFSLIVVGIAWAVLTKTRLGLFVRAVTQNRRMAACVGVKTARVDSYAFAFGAGIAGLGGCALSQIGNVGPDLGQSYIIDSFMAVVLGGVGQLAGTVIGGFGLGLISKAIEPFWGAVLAKIAVLVLIVLFIQKRPQGMFALKGRSAEA
>NZ_CP022989.1|WP_091796478.1|344096_345395_+|urea-ABC-transporter-substrate-binding-protein
MKRRSLLKFGSMSGALALAGQVPFAHAQSGSGPIKVGILHSLSGTMAISETSLKDTALMTIADINKNGGVMGRQLEPVVVDPASNWPLFAEKARQLITQDKCAVVFGCWTSVSRKSVLPVFEELNGLLFYPVQYEGEEMSRNVFYTGAAPNQQAIPATEYLMSAEGGGAKRFFLLGTDYVYPRTTNKILRAFLKSKGVQEADIQEVYTPFGHSDYQTIVANIKTFSQGGKTAVISTVNGDSNVPFYKELGNQGLKASDVPVVAFSVGEEELRGIDTKPLVGNLAAWNYFMSLRNPANEKFKKQWAAWVAQNNLPGGTKRVTNDPMEATFVGIHMWKQAVEKAKSTEVDKVRVAMVGQTFAAPSGFTLEMDGNHHLHKPVMIGEVRADGQFNVVWRTKTAIRAQPWSPFIAGNSSKPDVVSSIPAFLKRSRVA
>NZ_CP022989.1|WP_095420171.1|355569_356250_+|urease-accessory-protein-UreF
MRIAELTALLHLASPALPIGAFSYSQGLEAAIEAQLITDADSARAWIASGLTDVLAHGELPFLAHQMERWRTHDAQGLRVANSEFLASRESAELRRETEQMGWSLRQLCASLEWGDADRRATLASMTPLAQPTAFAFAAYAHDAAVDAALAAYAFSWVENQAAAALKAVPLGQLAGQRIIVALREPIDAAVTRALATSPENINTFAPQLGILSARHESQYSRLFRS
>NZ_CP022989.1|WP_095417264.1|356261_356915_+|urease-accessory-protein-UreG
MNAPHHPAHSTVRTKKLPPLRVGVGGPVGSGKTTLLEMLCKAMREQYDLVAITNDIYTKEDQRLLTVAGALPAERIMGVETGGCPHTAIREDASINLEAVDRMLTRFPDADIVFIESGGDNLAATFSPELSDLTIYVIDVAGGEKIPRKGGPGITKSDLLVINKTDLAPMVGANLDVMASDAKKMRGERPFVMSNLKALDGLDEVVKFIEKKGLLKV
>NZ_CP022989.1|WP_095417265.1|356951_358268_-|3-deoxy-D-manno-octulosonic-acid-transferase
MLRAIYQALWWIIAPLAVLRLLIRSRKERGYREHIGERFGYSRGRLPEDSAPLIWVHAVSVGETRAAQPLIDALMKARPDARILLTHMTPSGRATGEQIFGDRVLRSYLPYDMPHAVRRFLRTWRPSLGLVMETEVWPTLIDECRRADVPLVLTNARMSARSYRRAAKFGHATKDVFGGFARVLAQSPADAERLTALGARNVAVLGNLKFDMSTPPELAARGHAWRAAIGARPVWVAASTREGEEELVLQAFAALGIDEALLILVPRHPQRFNEVAGLVEKAGLRLERRSAWAPDARVASAANASGGVPALPAGVNVLLGDSMGELGAYYAASDLAFIGGSLLPLGGQNLIEACAVGVPVLIGPHVFNFTQATADAVAAGAAVQVQDPADLARALRELFGDKARRLAMGGAASAFAARHRGATARTVDVLMALLPEGE
>NZ_CP022989.1|WP_095417266.1|358350_359235_-|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase
MNETQIIEVANADWHGRNLSVPREMLLAGVERGKVLYFPNLRFAIEGGEQALLDPALADPNRKNISLEPNGGALHGVAGDAVTQSAVRALIARYQANARTLVDGLFPEYNGRLRVAPTSLRLHQVETRETSWRKDDSRLHVDAFPSRPNYGERILRVFTNVNPHGAPRVWRVGEPFEDMAKRFLPRIKPQMPGSAWLLNLLHVTKSPRSEYDHLMLHLHDGMKADLDYQKSSPQETMPFPPGSVWVCFSDQTSHAVMSGQFMLEQTFFLPVKAMAQPECAPLGILERLKGRALV
>NZ_CP022989.1|WP_095417267.1|359284_360286_-|lipopolysaccharide-heptosyltransferase-I
MSVQKILIVRVSSLGDVVHNMPVIADIRRRHPEAQIDWLVEESFVGLVQLVNGVRRAIPVSLRRWRKRILSLDNWREIGAFRRALAAENYDLVIDCQGLIKTAWVASMARGPLVGLANRTEGAGFEWPVRFFYGKRVPIEPRTHVVERTRQLVAAALNDPPPQPTDDIDFGLDTGRAALALSEANLNLPVPYVVFVHATSRADKQWPDTAWIELGQSLVRRGASIVLPWGSEEERATSERLAKEFGAAAIVPPKLSLPAVVGLIEGAAATVGVDTGLVHIAAALKRPTIELYNFATAWRTGGYWSPNVVNLGTAGQPPTLQQVKSALAGFGLL
>NZ_CP022989.1|WP_095417268.1|360516_361911_-|phosphomannomutase/phosphoglucomutase
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVQALSDGLRAAGVDVVNVGMVPTPVGYFAASVPLQLDGGERRVDSCIVVTGSHNPPDYNGFKMVLRGAAIYGEQILALHQRIVDENFSAGSGTYTEYDIADAYLDRIASDIKLARPIKIVVDTGNGVAGGLAPKLFKKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVEDPSKLLNALPNSNSTPELQLKLEEGENFELIARLQQNAKFTGADDVVKIDGLRVEYPDGFGLARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
>NZ_CP022989.1|WP_095417269.1|362203_363466_+|oligosaccharide-flippase-family-protein
MLTLKRFANPDVTRAFKNIVWLGLERLTQIGVAIVISGMLARYFGPDIFGKWQYANTLLLVLSPITWVCGSEILVPTIVNRPPAQLGTVLGSAFALRISVSVAALLLTWLGIALHFFEPLVGAMLGGLAVTMLFREPFVGVINAWLQSMTYSKPQLLTSMSTAVLKAALVYLLVRAAATPARFGWLWALESAAIGTVLVIYYVRRHGGKLGWHLDHALFRHFASAGTVFWLGLICMYLFLKLDRLMLERAISFADLGRYSAAQQLNENWITLALMLAQTIAPAFVYRVQDAAQLRRNMWRLTAMTAALMASGALVLDLLAGLIIRRVFGPQFEGAIEIFRWAVWLSVPAGIEAIGNLVVLKYQARFVLLSKWLLALAVAFVVNLLAIPRLGAYGALVGLAAGYLAAASVNLYYIRFKLRP
>NZ_CP022989.1|WP_095417270.1|363462_364293_+|glycosyltransferase
MTNSPATAQMTLDDVAVLIPAYNGQADVDLTLASFSESAPVHVLIVDDGSTPPIVAPAIPGMKIEVLRMAQNGGIERALQTGIDALAQRGFRYAARIDAGDRSAPQRLAKQRLFMELHPRVAGLGMWTQVVTREGKPLFMLTPPAEPNAIRRLRFFRSCLAHPSMMLRIDAVRAVGNYRAEYRSAEDLDLFVRLMERYDCANLPELGLYYELNEGGISATKRRRQVSSTLRLQLRHFNAANIYDWLGLAKNLLHLVTPYRALQRIKRSLLAPRASR
>NZ_CP022989.1|WP_095417271.1|364332_365481_+|glycosyltransferase-family-4-protein
MKPALKSTPALRITLVCNTAWAIYTYRQGLIRMLVGRGVDVTVLAPRDRTFELLAAMGCRCIELPVASKGTNPRDDLRTLCALYRQYRTIRPHVVFHYTIKPNIYGSIAAKLAGVQSVAVTTGLGYVFIQHSRAAQVAKKLYRFAFRFPREIWFLNRDDQSAFVEQNLLVHPERARLMHGEGVDLAQFAFTPLPERADYRFVLIGRLLWDKGVGEYVEAARRVRERYPHARFQLLGPVGVDNPSAITRAEVAAWEREGTIEYLGEAHDVRPFIAEADCVVLPSYREGVPRTLMEASAMGRPIVTTDVPGCREVVADGVNGLLCEARNAESLAATLARMLDMSGAERRAMAERGRQKVAEEFDERVVVETYKDLVQKMTGVLL
>NZ_CP022989.1|WP_095417272.1|365493_366516_+|UDP-glucose-4-epimerase-GalE
MTTKGTILVTGGAGFIGSHTCVELLNGGYDVVVIDNLVNSNRESLRRVEKITGKAVNFYEADARDTAALNRIFDAHPITGAIHFAALKAVGESVAKPIEYYSNNVGSLLSLLGVMRERNVKQFVFSSSATVYGVPKSSPIDESFPLSATNPYGQSKLIAEQVLRDLEVADPSWRIATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLSVFGGDYDTPDGTGVRDYIHVVDLARGHLAALDALVRRDASFVVNLGTGQGYSVIDVVKAFEKAAGRPVPYEIVARRPGDVASCFADPAAAEKIIGWRAQFGIERMCADHWRWQSTNPQGFA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022989_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022989_2

536183-536261

Orphan

Consensus_repeat	Method
GCGGACCACTGTTCGTGCGCCTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022989_2

>merge|NZ_CP022989|2|536183-536261|CRISPRCasFinder
GCGGACCACTGTTCGTGCGCCTGCCTGGACGCCGGCGCTGGATCAGCGGAGCGGAGCGGACCACTGTTCGTGCGCCCGC

>NZ_CP022989|2|2|536183-536261|CRISPRCasFinder
GCGGACCACTGTTCGTGCGCCTGC	CTGGACGCCGGCGCTGGATCAGCGGAGCGGA
GCGGACCACTGTTCGTGCGCCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022989.1\|WP_095417381.1\|521436_522960_-\|xanthine-dehydrogenase-small-subunit	unknown	unknown	gnl\|CDD\|274365
NZ_CP022989.1\|WP_095417380.1\|519028_521407_-\|xanthine-dehydrogenase-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|274367
NZ_CP022989.1\|WP_095417392.1\|545883_546669_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP022989.1\|WP_095417391.1\|544980_545814_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP022989.1\|WP_095417386.1\|536964_537789_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|236205
NZ_CP022989.1\|WP_095417389.1\|541902_543249_-\|homogentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|235421
NZ_CP022989.1\|WP_095420188.1\|529439_531104_-\|bifunctional-aspartate-transaminase/aspartate-4-decarboxylase	unknown	unknown	gnl\|CDD\|236444
NZ_CP022989.1\|WP_095417387.1\|539310_540471_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_CP022989.1\|WP_091796639.1\|546772_547963_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP022989.1\|WP_095417382.1\|523349_524561_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|235348
NZ_CP022989.1\|WP_095420186.1\|526593_527856_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP022989.1\|WP_095417384.1\|533015_534698_-\|aspartate-alanine-antiporter	unknown	unknown	gnl\|CDD\|274793
NZ_CP022989.1\|WP_095420190.1\|535154_536153_+\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240659
NZ_CP022989.1\|WP_095417383.1\|524941_525394_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022989.1\|WP_095417393.1\|548111_548750_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
NZ_CP022989.1\|WP_095420191.1\|537991_539158_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NZ_CP022989.1\|WP_095420189.1\|531197_532880_-\|aspartate-alanine-antiporter	unknown	unknown	gnl\|CDD\|274793
NZ_CP022989.1\|WP_095417388.1\|540595_541906_-\|fumarylacetoacetase	unknown	unknown	gnl\|CDD\|215461
NZ_CP022989.1\|WP_095417390.1\|543283_544648_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_CP022989.1\|WP_095420187.1\|528063_529287_-\|alanine--glyoxylate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223153

Protein	Function_ID	Function_description	E-value
NZ_CP022989.1\|WP_095417381.1\|521436_522960_-\|xanthine-dehydrogenase-small-subunit	gnl\|CDD\|274365	TIGR02963, Includes:_Xanthine_dehydrogenase, xanthine dehydrogenase, small subunit. Members of this protein family are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate. The small subunit contains both an FAD and a 2Fe-2S cofactor. Aldehyde oxidase (retinal oxidase) appears to have arisen as a neofunctionalization among xanthine dehydrogenases in eukaryotes and [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_CP022989.1\|WP_091796639.1\|546772_547963_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	0
NZ_CP022989.1\|WP_095417392.1\|545883_546669_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.41952e-46
NZ_CP022989.1\|WP_095417391.1\|544980_545814_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.11852e-08
NZ_CP022989.1\|WP_095417386.1\|536964_537789_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|236205	PRK08259, PRK08259, crotonase/enoyl-CoA hydratase family protein.	7.95136e-138
NZ_CP022989.1\|WP_095417389.1\|541902_543249_-\|homogentisate-1,2-dioxygenase	gnl\|CDD\|235421	PRK05341, PRK05341, homogentisate 1,2-dioxygenase; Provisional.	0
NZ_CP022989.1\|WP_095420188.1\|529439_531104_-\|bifunctional-aspartate-transaminase/aspartate-4-decarboxylase	gnl\|CDD\|236444	PRK09275, PRK09275, bifunctional aspartate transaminase/aspartate 4-decarboxylase.	0
NZ_CP022989.1\|WP_095417387.1\|539310_540471_+\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.14238e-75
NZ_CP022989.1\|WP_095417382.1\|523349_524561_+\|MFS-transporter	gnl\|CDD\|235348	PRK05122, PRK05122, major facilitator superfamily transporter; Provisional.	0
NZ_CP022989.1\|WP_095420186.1\|526593_527856_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.43998e-136
NZ_CP022989.1\|WP_095417384.1\|533015_534698_-\|aspartate-alanine-antiporter	gnl\|CDD\|274793	TIGR03802, Asp_Ala_antiprt, aspartate-alanine antiporter. All members of the seed alignment for this model are asparate-alanine anti-transporters (AspT) encoded next to the gene for aspartate 4-decarboxylase (AspD), which converts asparate to alanine, releasing CO2. The exchange of Asp for Ala is electrogenic, so the AspD/AspT system confers a proton-motive force. This transporter contains two copies of the AspT/YidE/YbjL antiporter duplication domain (TIGR01625).	0
NZ_CP022989.1\|WP_095420190.1\|535154_536153_+\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240659	cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains. D-Lactate dehydrogenase (LDH) catalyzes the interconversion of pyruvate and lactate, and is a member of the 2-hydroxyacid dehydrogenase family. LDH is homologous to D-2-hydroxyisocaproic acid dehydrogenase (D-HicDH) and shares the 2-domain structure of formate dehydrogenase. D-2-hydroxyisocaproate dehydrogenase-like (HicDH) proteins are NAD-dependent members of the hydroxycarboxylate dehydrogenase family, and share the Rossmann fold typical of many NAD binding proteins. HicDH from Lactobacillus casei forms a monomer and catalyzes the reaction R-CO-COO(-) + NADH + H+ to R-COH-COO(-) + NAD+. D-HicDH, like the structurally distinct L-HicDH, exhibits low side-chain R specificity, accepting a wide range of 2-oxocarboxylic acid side chains. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain.	0
NZ_CP022989.1\|WP_095417380.1\|519028_521407_-\|xanthine-dehydrogenase-molybdopterin-binding-subunit	gnl\|CDD\|274367	TIGR02965, xanthine_dehydrogenase, xanthine dehydrogenase, molybdopterin binding subunit. Members of the protein family are the molybdopterin-containing large subunit (or, in, eukaryotes, the molybdopterin-binding domain) of xanthine dehydrogenase, and enzyme that reduces the purine pool by catabolizing xanthine to urate. This model is based primarily on bacterial sequences; it does not manage to include all eukaryotic xanthine dehydrogenases and thereby discriminate them from the closely related enzyme aldehyde dehydrogenase. [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_CP022989.1\|WP_095417393.1\|548111_548750_-\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	5.08259e-133
NZ_CP022989.1\|WP_095420191.1\|537991_539158_+\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	2.14526e-95
NZ_CP022989.1\|WP_095420189.1\|531197_532880_-\|aspartate-alanine-antiporter	gnl\|CDD\|274793	TIGR03802, Asp_Ala_antiprt, aspartate-alanine antiporter. All members of the seed alignment for this model are asparate-alanine anti-transporters (AspT) encoded next to the gene for aspartate 4-decarboxylase (AspD), which converts asparate to alanine, releasing CO2. The exchange of Asp for Ala is electrogenic, so the AspD/AspT system confers a proton-motive force. This transporter contains two copies of the AspT/YidE/YbjL antiporter duplication domain (TIGR01625).	0
NZ_CP022989.1\|WP_095417388.1\|540595_541906_-\|fumarylacetoacetase	gnl\|CDD\|215461	PLN02856, PLN02856, fumarylacetoacetase.	0
NZ_CP022989.1\|WP_095417390.1\|543283_544648_-\|MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.69977e-99
NZ_CP022989.1\|WP_095420187.1\|528063_529287_-\|alanine--glyoxylate-aminotransferase-family-protein	gnl\|CDD\|223153	COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism].	2.35401e-105

>NZ_CP022989.1|WP_095420190.1|535154_536153_+|2-hydroxyacid-dehydrogenase
MRVILFSSRQYDSDTFSEANAAHRYELHFQESHLDSETAVLAQGYEVVCPFVNDRVDAAVLERLHAGGTRMIALRSAGFNHVDLAAAERLGITVARVPAYSPHAVAEHAVGLILALNRRLPRAAARTREGDFSLHGLLGFDLHGKTVGVIGTGMIGRVFGRIMAGFGMQVLAHDPGTPAGDLLALGARYVPLDTLLAESDVVSLHCPLVAGTYHLIDGPALAKMKRGAMLINTGRGGLVESNALIGALKDGQLGHLGLDVYEEEGGLFFEDHSNLPLQDDVLARLLMFPNVIVTAHQAFFTREAMSEIAQTTLANVAAWQAGTPRNVVRATA
>NZ_CP022989.1|WP_095417384.1|533015_534698_-|aspartate-alanine-antiporter
MIGELLRSQPEIALFASLAIGYFIGSFRIGPIQLGGVCGTLIVALLLGQTGARLAPDLKNIAFALFIFALGFTGGPQFFANIGRGWRYGLLSVVEIVSVLALIMIAVAVMRLDAGTAAGLLAGAATESAVIGTASEAIAKLGFSDAETLRLQANIVTAYSVSYLFGLITIVLFTSQFAPLLLRVNLRDEAERVWRKLGGEGAYGEGQRAAAPALVGRAFHVGAAAGTTIRAFEQQYGFNLTVERVRRNGAEVPAEPQLTLAPGDVILVGGRREAIVAAAAGLGEEVDGAEFGQVMAEKLDVVLTRRDLHGLTVAQVRDQATPENGRGIYIAAVTRLETTVPALPGTELNRGDVLTLVGAKADVQRGAKLLGYMVVATQKTDFVYLGLGVLVGMAIGHLGGRVGGVSLALGTGGGCLLSGLLFGWIRSRYPVIGSLPSAAAQILKDFGLATFIAAVGLSAGPDAIKLVREYGLALPLAGILMVLVPGLLSLWIGRMFLKLEAPMLLGAIAGQQCSTPAISALVGVTGNSTPVIGYTITYALSNILLPLMGPVVVGLAGKFH
>NZ_CP022989.1|WP_095420189.1|531197_532880_-|aspartate-alanine-antiporter
MDWLHHIFQKSPEMALFLSLAAGYFIGQINFGKFQLGGVGGSLLAAVVISQAGVTIDNGVKSVMFAVFIYAVGYDSGPGFFNSLNRKTLREIAMAVFLAVTALITVVVCAKLFHLNKGLAAGLAGGALTQSAIIGTAGDAIARLGLPADQVKSLQSDVAIAYAVTYVFGSLGAIIVCVNILPKFMGQSLRDASLEVERELASGATATGPGQLSALPEMVGRAYKIDVSAGKTVKAVETLHRDLLTIERIKRDGQPLDPAPDLVLKPNDVVLVVGRREAVVEFGAAGGEVATVEDVGVVMQTREGVFTRKGMNHTTIAAARQVVDRDMRHGVYIQSISRAGQPLPVLPETILEHGDVITFYGSPKDTKRAVEAAGYELPYTNKTDFIYMGVGLVLGLLIGLIVVDVAGIPLTLGSGGGCLLAGLLFGWMRGKYPMYGVMPTAASQLLKDFGLAAFVAVVGLNSGLQAVVTVKQSGMTIFLLGVFVTLFPLLLTMLFGRYVLKYDNAAILAGALTGSRSANPAFGGVLDKAESAVPTVPFAITYAIANVALTLLGPLVVGLV
>NZ_CP022989.1|WP_095420188.1|529439_531104_-|bifunctional-aspartate-transaminase/aspartate-4-decarboxylase
MAKEKGDKKHVDMAQPGMSALSPFELKDELIKAAGGSAVERPANVSMLNAGRGNPNFLATIPRHGFWQLGLFAMRESERSFAYMPEGVGGFPRHDGLEERFDLFLRENKGVAGIDFLRGAVSYVRDQLGYSAGDFLYEMCEGILASNYPVPDRMLKLSELIVGQYLRKEMIGDHPFVGEFDIFAVEGGTAAMTYIFNTLRENHLIKAGDTIALGMPIFTPYIEIPRLNDYRLNVVNLEADVANGWQYSKKELDKLRDPKVKAFFLVNPSNPPSVKINDESLQYIAEIVKERPDLILLTDDVYGTFADDFVSLFALAPKNTILVYSYSKYFGATGWRLGTIATHRDNVLDRLIAELPKDTKKQLHERYESITTEPDKLKFIDRLVADSRTVALNHTAGLSTPQQVQMVLFSLFSLMDTPDAYKNALKRLIRKRKQALYEEVGISFEDDDPNQVDYYTILDVEFLGERMFGREFVDWLLKNTQPSEMLFRLAREARVVLLPGLGFGTQHPSGRVSLANLNEADYRQIGRALRKLIEEYVERFNAATGKKLDKTAVK
>NZ_CP022989.1|WP_095420187.1|528063_529287_-|alanine--glyoxylate-aminotransferase-family-protein
MPTSSITSAFSAVPCPVVESLDAILPEEPLLMMGAGPVPIPAAVAKANAIVINHLGETMVKVIGQVKSMARYVFQTNSKWVLGVAGPGSAAMEMAISNLAWDGTRVLSIKNGFFSERMAEMGRRVGARVSTLDVADRSVASLEEIAEAIRRERPEIVTVVQGETSNTVWNYRLKEIAALAKAAGALVIVDAVCTLSTMPLEMDAWGIDAVITGGQKGLSSIPGVSLIAFSDAAWERVKGRTAPNAHWCLDARLAENFWHNAGYHYTAPVSGVLALHEALRLVCAETLEKRFARHLRCSLALQDGVVAMGLRLYAPQACRLNSVVGIEVPDGLSPADVCAHISRMHQVEISGSFGLPIVRVGQMGEQCREHNLFRTVHALGRTMVDLGVKVDLPAGVAALERGLSGGR
>NZ_CP022989.1|WP_095420186.1|526593_527856_+|IS256-family-transposase
MKKKRTAASQAAARGPLPELPDELMDQLVKGPMSPGDVQDLMLAFNKAIIERAMGAEMNLHLGYPSGQVKPLGQVNERNGASGKTVMTDRGPVRVEIPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIRAFLAESYGTEVSPDFISSVTDEVMAEAFAWQSRPLETMYPVVFFDALRVKIRDGGMVSNKAVYLALGIQADGQRDVLGLWIEQTEGAKFWLKVFNELKTRGCQDILIAVVDGLKGLPEAIAAVYPRATVQTCIVHLIRNSLEFANYKDRKALAQALRPIYAAASAEAAEQALRDFAEGPWGAKYPMIVQCWQRAWEHVIPFFVFPPDIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAVKLLWLALRNMLAKSVRSTFDWKSAMNQFAILFGERFTQAR
>NZ_CP022989.1|WP_095417383.1|524941_525394_-|hypothetical-protein
MSKSVKRTRTISRPPVDALQYEKLALSAFGLIERQLSQLDKLATLVASIVRSPAVTREERHRQRRLLELLLDTVEDYQYEVETDRELYQVIALDARGVVQSRITARHAAKVLAKATRRASETREDRNETQAKHREPARFKTIARTRATAH
>NZ_CP022989.1|WP_095417382.1|523349_524561_+|MFS-transporter
MSTDSATPRSEFATTMQIIPVVFFTFLCYLTIGIPLAVLPGYVHDDLGYSAVLAGAAISVQYLATLASRPLAGRSADTLGPKRTVTIGLMGCGASGVLLLLAVLCGRWPVLSLGLLVCSRLVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALAIGAPLGVAIEHTVGFAALGILVILLAALGFYLARPIAPVPIVHGERMSYRSVFTRVLPHGIGLALGSVGFGSIATFITLFYAAKHWPNAALSLTVFGTLFIGARLLFANTIKTYGGFRVAIASFSFECAGLLMLWLAPEPHVALAGAALTGFGFALVFPALGVEAVGLVPPASRGAALSAYSVFLDLSLGITGPLAGYIAGEFGYGSVFLFAAVAAAAGVGLSTLLYLRNAKVTNLPAAL
>NZ_CP022989.1|WP_095417381.1|521436_522960_-|xanthine-dehydrogenase-small-subunit
MTEPIRFYHRNAIREIKDAPVTRTVLQYLREDAHCTGTKEGCAEGDCGACTVVIGERNEAGGVDFKAVNACIQFVPTLDGKALFTVEDLRQPDGSLHPVQEAMVECHGSQCGFCTPGFVMSMWSLYEKHGHEHSCANKTVPSREAISNALTGNLCRCTGYRPIVDAAVRMFEAPAPKAPVNVEALATTLATLERKDTFHYQHAGQQFDAPRTVEALARIKEAEPAARILAGSTDIGLWVTKQMRELGNIVYVGQITELQKLETNDEWIEIGAGVSVEKAYAEIAKQYPELIEMWQRFASLPIRNAGTLGGNIANGSPIGDSMPGLIALGARVIVRGGEIEREMPLEDLYLAYQKKDMAEHEFVVGLKVPTRTGVRRNLQFRTYKLSKRFDSDISAVCAAFAFIADGNLIREPRIAFGGMAATSKRATHAEAVLRDAEWHEATAQAAMLALGNDYAPLSDMRATSHYRLESAKNTLYRFWLETRPNNPLPKSALDVRAVAAACAPVGA
>NZ_CP022989.1|WP_095417380.1|519028_521407_-|xanthine-dehydrogenase-molybdopterin-binding-subunit
MNQHAEPFLKDLQDLEDFTQVHISRPHESAHLHVSGRATYTDDIPTLAGTLHAALGLSSKAHAKIVSMSLDKVRATPGVVAIFTADDIPGVNDVGPIIHGDDPILADGLVQYVGQPIFIVVATSHETARLAARRAEIVYEELPAILTAQQARAANQHVLPPIKLARGEAGTKIARAAHREAGEMLLGGQEQFYLEGQISYAVPKDDDGMHVYCSTQHPTEMQHMVAHALGVASHNVLIECRRMGGGFGGKESQSGLFACCAALAAWKLLCPVKLRPDRDDDMMVTGKRHDFHYTYEVGYDDKGVIDGVTVDMTSRCGFSADLSGPVMTRALCHFDNAYWLSDVTIDGFCGKTNTQSNTAFRGFGGPQGAFAIEYIMDNVARSVGEDSLDVRRRNLYGKTERNQTPYGQIVEDNVIHELIDELEATSEYRARRAAINEFNANNEILKKGMALTPVKFGIAFNVTHFNQAGALVHIYTDGSVLVNHGGTEMGQGLNTKVAQVVAHELGIGFNRIRVTATDTSKIANTSATAASTGSDLNGKAAQDAARQLRERLSAFAAERFGAGQVSASEVRFVHDRVVVGESIVPFEELIAKAYVARIQLWSDGFYATPKLYWDQSKLQGRPFYYYSYGAAVSEVVIDTLTGEMRVLRADALHDVGASLNPALDVGQVEGAFIQGMGWLTTEELWWNAGGKLMTHAPSTYKIPTVNDTPPDFRVRLFKNRNAEDSIHRSKATGEPPLLLPFSVFFAVRDAVSAVGDHKVNPPLNAPATSEEILKAVSAVRAATAAARQKADQ
>NZ_CP022989.1|WP_095417386.1|536964_537789_+|crotonase/enoyl-CoA-hydratase-family-protein
MSTTLNFNDHVRIEANEAIGVATIVLERPARRNAVDRPVAQALSAAFARFEAEPAWRAAVLFGAGGTFCAGADLSALADDTRRNELHADGSGPGPMGPTRMSFSKPVIAAIAGYAVAGGLELAALCDLRVVEDDAVLGVFCRRVGIPLIDGGTIRLPRLIGLSRALDLILTGRAVSAQEALGFGLANRVVAKGTARAAAEQLAAELAALPQAALLADRRSALENSMLDDFAKALRREGAGGFRAVFDEGVAGAARFAEGAGRHGNTLDTGDGTR
>NZ_CP022989.1|WP_095420191.1|537991_539158_+|MFS-transporter
MPLPLLALAVAAFGIGTTEFVIMGLLPDVARDLAVSIPAAGMLVSAYALGVTIGAPIVAIAVANMPRKKALMSLIGVFIVGNLLCAVAPGYAVLMAARIVTAFCHGAFFGIGSVVAAGLVAPNRRAQAIALMFTGLTLANVLGVPLGTALGQAVGWRATFWAVTGIGLVAAAALAVCLPAKIETQKASLVREFSVLKNPQVLMVLGISVLASASLFSTFTYITPILEDVTGFTPHAVTLVLLLFGLGLTVGSTLGGKLADWRLMPSLVAFLLAIVVILTIFAGTMHAEIPAMITIFAWGVLAFAIVPPLQMLIVDRASHAPNLASTLNQGAFNLGNATGAWLGGMAIGAGAPLTTLPWVGVATSIGALVLTLWSVSIDRRAQRVAVAG
>NZ_CP022989.1|WP_095417387.1|539310_540471_+|MFS-transporter
MKVILTRDFLALILSVAVVGLGSGATLPLTALALTQAGYGTDVVGLLTAAQAGGGLVIVPLAGWIAARFGGRQVIVGAVLVVALATALMQLTANLWLWAVLRVLCGAALMLLFTIGEAWVNQLADDASRGRVVAIYATNFTLFQMAGPVLVSQIAGFAHWRFLLCGAIFLLALPMLAAIRTTPQASDDEHAAHGSWRRVLPQMPALVIGTGFFALFDTIALSLLPLFAMSHGITSEVAVLFASALLLGDTTMQFPIGWLADRLGRERVHIGCGVVVVALLPFLPWAATSPWLCWPLLYVLGAAAGAIYTLSLVACGERFRGVALVSASSLVGASWSAASFGGPLVAGALMKSVGNDAMVGVLLAAALAFLGAAWWEKRHAPVGSVG
>NZ_CP022989.1|WP_095417388.1|540595_541906_-|fumarylacetoacetase
MNALSDLQATLDPSRKSWVESANDSTNDFSIQNLPFGIFSDALNATRRVGVAIGDRIVDLAALESAGLLSVPSSGAGESVFVRDTLNDFIALGRDAWRSVRIQLSKLLSRDNATLRDDAELRSRALIRQADAQLHLPVQIPGYTDFYSSKEHATNVGSMFRDPKNALLPNWSEMPIGYNGRASSVVVSGTPVRRPNGQLKLPDQERPVFGACRKLDIELETGFVIGAGNALGEPVACADAEAHIFGMVLLNDWSARDIQQWEYVPLGPFNAKTFATTISPWIVTLDALEPFRVAQPAQDPQPLDYLRHDGEHAFDITLEVTLRPKQAERASTITRTNFKHMYWTMAQQLAHHTVSGCNTRVGDLMGSGTISGPTEDSFGSLLELTWNGKKPVELQEGGTRSFIEDGDELTLAGWCQGDGYRVGFGVCVGEILPALK
>NZ_CP022989.1|WP_095417389.1|541902_543249_-|homogentisate-1,2-dioxygenase
MDTQTRTPNTASSRLEIEPGYQSGFANEFATEALPGALPEGRNSPQRAAYGLYAEQVSGTAFTAPRGHNRRSWLYRIRPAAVHKPFTLLPSERLVANFAEVPPTPPNQLRWDPLPMPAEPTDFIDGWVTMAGNGAAESMSGCAIHLYAANRSMQDRFFYSADGELLIVPQEGRLHIATEMGRLEVEPFEIVVIPRGIRFAVSLPDGDARGYICENFGALLRLPDLGPIGSNGLANPRDFLTPHAAYEDREGKFELVAKLNGNLWRADIGHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTPGVDAIDFVIFPPRWLAAEDTFRPPWFHRNVASEFMGLVHGVYDAKAEGFLPGGGSLHNCMTGHGPDADTFEKASHGDTSKPMKVGDTMAFMFETRTLIKPTRFALETAQLQAHYYECWQGLKKHFNPEQR
>NZ_CP022989.1|WP_095417390.1|543283_544648_-|MFS-transporter
MSATPTAAAANVIEVERVLAETHHPAFQWMLLMLCGLCLVIDGFDAQAMGYVAPSVIAEWRVSKAALGPVFSASLFGMLLGALGLSVLADRVGRRPVLIGSTFFFALSMLATPFVTTVPALIALRFITGLGLGCIMPNAMALVGEFSTPAHRVKRMMLVSCGFTLGAALGGFISAALIPVYGWRAVFWVGGAAPLLLALAMLAVLPESLQFLVLKGRSERALRWLAKFNPALPIDANTRLVVREKGNEGAPVAELFRAGRGPVTLILWAISFMNLIDLYFLSNWLPTVMRDAGYSPGTAVIVGTVLQTGGVVGTLLLGWFIERFGFVRVLFVCFVGAALAVGTIGTVAHALPWLLIVVFAGGFCVVGGQPAVNALAGHFYPTTLRSTGIGWSLGIGRIGSVIGPLIGGELIALNWSNASLFHAAAVPVLCSALLVIALAAATRQRRRPSEPRTA
>NZ_CP022989.1|WP_095417391.1|544980_545814_+|EAL-domain-containing-protein
MIPPTIPALIARAADHPFLGAHLAMGQGLHHDVALARFDGLELASTYEPIFDISVHALAQSLSSGAEGVDRFGDELGFQAVTHLLDGPPSDAFDPFDRIADDRDLVELDRMSRALHAINFFGAQRHGLLFLRVHERLLKSVKYDHGRHFSTVLVSLGLNPSRVVIELPAAAVAHKTFLGYLTKSYQHYGFKVAGNLSNAGQILSVSETARLDFIKMDAGTALRDATVKPLVGYAGRLRIPLIFNRVVDEAQFDALQQYDVRFVQGPLFNAHYHDRAV
>NZ_CP022989.1|WP_095417392.1|545883_546669_-|IclR-family-transcriptional-regulator
MTPASTPTEPLDERKFVVALARGLDLLRAFKPGDTLLGNRDFVERTGLPKATVNRLAYTLTVLGYLRLDETLGKYALDAGVLSLGFALLSGTDTLELARPHMRTFAREVGAAVSLGCRDGLDMIYLETIRSETALTLGLASGSKLSMLTSSMGRAYLAVQPLDVRAALLAELKKAAGEDGAQLVADAQKEIAAFAAQRCCYSFRAWHDDVNAVAVPFREPREGRWLVLSCSGPASSMGEEVFRDNVAPRLKALARRLGDTG
>NZ_CP022989.1|WP_091796639.1|546772_547963_+|acyl-CoA-dehydrogenase
MAEAAQFHWEDPLLLDQQLTEDERMVRDAAAAYAQDKLQPRVLEAFRHEKTDIEIFREMGELGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMMSVQSSLVMVPIHAFGSEAQKQKYLPKLATGEWIGCFGLTEPNHGSDPGSMVTRAKKVDGGYSLSGSKMWITNSPIADVFVVWAKLEEDGKDAIRGFILEKGWKGLSAPTIHSKVGLRASITGEIVLDEVFVPEENRFPEVSGLRGPFTCLNSARYGIAWGALGAAEACWHTARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDIHALILGRAQTGIQAFF
>NZ_CP022989.1|WP_095417393.1|548111_548750_-|peroxiredoxin
MSLRLGDIAPDFEQQSSVGPIKFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLASEFEKRNVKTIALSVDSAESHKEWIKDINETQAANVGFPILADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLTDNHSVATPGNWKQGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRMTPQPNK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	178760-178790	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	2839-2869	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NC_010355	Azospirillum phage Cd, complete genome	2839-2869	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	586091-586121	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	173882-173912	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	180397-180427	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NZ_CP017078	Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence	254124-254154	7	0.774
NZ_CP022989_2	2.1\|536207\|31\|NZ_CP022989\|CRISPRCasFinder	536207-536237	31	NC_004929	Ruegeria sp. PR1b plasmid pSD20, complete sequence	32618-32648	8	0.742

1. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

2. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

3. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

4. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

5. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

6. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
atttctgccggcgctggaccggcggagcgga	Protospacer
 *   .************.*.**********

7. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NZ_CP017078 (Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence) position: , mismatch: 7, identity: 0.774

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
cagcagtccggcgctggatcagctgagcgac	Protospacer
* * *  **************** *****.

8. spacer 2.1|536207|31|NZ_CP022989|CRISPRCasFinder matches to NC_004929 (Ruegeria sp. PR1b plasmid pSD20, complete sequence) position: , mismatch: 8, identity: 0.742

ctggacgccggcgctggatcagcggagcgga	CRISPR spacer
gcggctgccggcgctggatcagcgcagcacg	Protospacer
 .** .****************** ***. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

408219 : 468944

Escherichia_phage(20.0%)

bacteriocin,transposase,integrase

attL 400890:400905|attR 429583:429598

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
400890:400905	attL	NA	NA	NA	NA
WP_095417295.1\|408219_409317_+\|integrase	integrase	NA	NA	NA	NA
WP_095417296.1\|409326_409695_+	hypothetical protein	NA	NA	NA	NA
WP_095417297.1\|409728_410751_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	6.2e-40	34.7
WP_095420176.1\|413162_414361_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	5.2e-102	65.6
WP_157763702.1\|415290_415458_-	hypothetical protein	NA	NA	NA	NA
WP_095417299.1\|416196_418074_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_095417300.1\|418079_419120_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_095417301.1\|419250_420222_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_095417302.1\|420337_421429_+	acyltransferase	A9YX16	Burkholderia_phage	6.9e-53	38.1
WP_095420177.1\|421438_422293_-	glycosyltransferase	NA	NA	NA	NA
WP_157763703.1\|422511_423255_-	hypothetical protein	NA	NA	NA	NA
WP_167397507.1\|423353_425273_-	glycosyltransferase	NA	NA	NA	NA
WP_095417305.1\|425269_426994_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_167397548.1\|427003_427891_-	glycosyltransferase	NA	NA	NA	NA
WP_095417307.1\|427939_429034_-	NAD(P)-dependent oxidoreductase	M1IDV7	Acanthocystis_turfacea_Chlorella_virus	1.3e-11	23.6
WP_095417308.1\|429114_430494_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
429583:429598	attR	NA	NA	NA	NA
WP_095420178.1\|430483_431239_-	ABC transporter permease	NA	NA	NA	NA
WP_095417309.1\|431380_432283_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.0e-25	30.9
WP_095417310.1\|432279_432831_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	5.5e-51	55.8
WP_095417311.1\|432815_433709_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	5.9e-95	58.1
WP_095417312.1\|433719_434781_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.5e-84	47.2
WP_095417313.1\|435240_436152_-	NAD-dependent epimerase/dehydratase family protein	E5ES47	Bathycoccus_sp._RCC1105_virus	3.9e-09	25.9
WP_095420179.1\|436356_437235_+	symmetrical bis(5'-nucleosyl)-tetraphosphatase	NA	NA	NA	NA
WP_095417314.1\|437321_438132_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095417315.1\|438279_439140_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_095417316.1\|439201_440482_-	dihydroorotase	NA	NA	NA	NA
WP_095417317.1\|440596_441730_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	4.1e-117	57.3
WP_095417318.1\|441872_442898_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	3.2e-28	33.3
WP_095417319.1\|443095_443647_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_095417320.1\|443633_444074_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_007178990.1\|444070_444649_-	YqgE/AlgH family protein	NA	NA	NA	NA
WP_095417321.1\|444901_446314_-	hypothetical protein	NA	NA	NA	NA
WP_006047743.1\|446578_446749_-	rubredoxin	NA	NA	NA	NA
WP_095417322.1\|446816_447041_-	hypothetical protein	NA	NA	NA	NA
WP_095417323.1\|447039_447900_+	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_095420180.1\|448324_448951_+	adenylyl-sulfate kinase	NA	NA	NA	NA
WP_095417324.1\|449085_450726_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	3.9e-169	61.5
WP_007178996.1\|450779_451070_-	co-chaperone GroES	A0A221S4A8	uncultured_virus	3.6e-17	40.4
WP_095417325.1\|451591_451873_+	hypothetical protein	NA	NA	NA	NA
WP_095417326.1\|451872_452313_+	DUF2471 domain-containing protein	NA	NA	NA	NA
WP_095417327.1\|452917_453250_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095417328.1\|453246_453702_+	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_157763705.1\|453698_453860_+	hypothetical protein	NA	NA	NA	NA
WP_095417329.1\|453846_454932_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_095417330.1\|454928_455351_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.5e-51	70.8
WP_095417331.1\|455350_456115_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	4.4e-91	69.9
WP_095417332.1\|456244_456724_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095417333.1\|456758_457289_-	aspartate carbamoyltransferase	NA	NA	NA	NA
WP_095417334.1\|457321_457753_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_095417335.1\|457754_458189_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_095417336.1\|458203_458521_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095420181.1\|458755_459655_-	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_095417337.1\|459755_460232_-	CreA family protein	NA	NA	NA	NA
WP_095417338.1\|461301_462267_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_157763706.1\|462263_462548_-	hypothetical protein	NA	NA	NA	NA
WP_095417341.1\|463211_463445_+	hypothetical protein	NA	NA	NA	NA
WP_157763707.1\|463533_463749_+	hypothetical protein	NA	NA	NA	NA
WP_095417343.1\|464050_464575_+	universal stress protein	NA	NA	NA	NA
WP_167397508.1\|465246_465396_+	hypothetical protein	NA	NA	NA	NA
WP_095417344.1\|468140_468944_+\|bacteriocin	bacteriocin family protein	NA	NA	NA	NA

DBSCAN-SWA_2

574125 : 583321

Acinetobacter_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095417413.1\|574125_575724_+	polynucleotide adenylyltransferase PcnB	A0A172Q0J1	Acinetobacter_phage	2.6e-16	30.6
WP_095417414.1\|575772_576321_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_095417415.1\|576317_576998_+	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	5.7e-05	28.1
WP_095417416.1\|577035_577851_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	4.1e-34	29.6
WP_095417417.1\|577997_579920_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	2.5e-50	36.6
WP_007179199.1\|579945_581088_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	3.6e-28	40.2
WP_095417418.1\|581359_583321_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	3.9e-147	49.1

DBSCAN-SWA_3

1082558 : 1149260

Streptococcus_phage(16.67%)

plate,tRNA,protease,integrase,transposase

attL 1115761:1115805|attR 1127574:1127618

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095417748.1\|1082558_1084046_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_095417749.1\|1084239_1084539_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_157763715.1\|1084537_1084687_+	hypothetical protein	NA	NA	NA	NA
WP_004189550.1\|1084919_1085963_+	rod shape-determining protein	NA	NA	NA	NA
WP_095417750.1\|1086116_1087259_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_095417751.1\|1087255_1087768_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_095417752.1\|1087909_1090219_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_095417753.1\|1090230_1091379_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_095417754.1\|1091468_1092170_-	sel1 repeat family protein	NA	NA	NA	NA
WP_095417755.1\|1092166_1092949_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_167397516.1\|1093194_1093641_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_095417756.1\|1093647_1094280_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	3.3e-07	34.2
WP_095417757.1\|1094377_1095109_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	7.3e-51	45.6
WP_095417758.1\|1095701_1096391_-	response regulator	NA	NA	NA	NA
WP_095417759.1\|1096391_1098806_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_095417760.1\|1098795_1099395_-	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_095417761.1\|1099391_1100831_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_095417762.1\|1101153_1102011_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_095417763.1\|1102115_1102757_-	LysE family translocator	NA	NA	NA	NA
WP_095417764.1\|1102869_1103856_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.3e-07	38.9
WP_095417765.1\|1103887_1104391_-	peptide deformylase	A0A0E3FIY1	Synechococcus_phage	1.4e-13	35.8
WP_095417766.1\|1104635_1105901_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	9.2e-25	36.2
WP_095417767.1\|1105990_1106368_+	thioredoxin family protein	NA	NA	NA	NA
WP_095417768.1\|1106615_1109288_+	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	1.9e-19	24.6
WP_095417769.1\|1109439_1110543_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_095417770.1\|1110882_1112739_-	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
WP_095417771.1\|1113119_1114133_+	D-2-hydroxyacid dehydrogenase family protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	1.6e-11	24.8
WP_095417772.1\|1114205_1115084_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_011486433.1\|1115120_1115525_-	PaaI family thioesterase	NA	NA	NA	NA
1115761:1115805	attL	NA	NA	NA	NA
WP_095417773.1\|1115860_1116871_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	9.7e-78	46.0
WP_095417774.1\|1116768_1117071_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095417775.1\|1117074_1119675_-	conjugative relaxase	NA	NA	NA	NA
WP_157763716.1\|1119668_1120907_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_095417777.1\|1120911_1121238_-	hypothetical protein	NA	NA	NA	NA
WP_095417778.1\|1121237_1121555_-	hypothetical protein	NA	NA	NA	NA
WP_157763717.1\|1121863_1122538_+	hypothetical protein	NA	NA	NA	NA
WP_157763718.1\|1122861_1123056_+	hypothetical protein	NA	NA	NA	NA
WP_095417781.1\|1123268_1124084_+	TIGR04255 family protein	NA	NA	NA	NA
WP_095417782.1\|1124085_1124769_+	hypothetical protein	NA	NA	NA	NA
WP_095417783.1\|1124938_1125658_+	hypothetical protein	NA	NA	NA	NA
WP_095417784.1\|1125797_1126979_-	hypothetical protein	NA	NA	NA	NA
WP_095417785.1\|1127782_1128229_+	hypothetical protein	A0A2D1GMX8	Marinobacter_phage	9.8e-06	48.9
1127574:1127618	attR	NA	NA	NA	NA
WP_095417786.1\|1128216_1128570_+	hypothetical protein	NA	NA	NA	NA
WP_095417787.1\|1129193_1130258_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_095417788.1\|1130254_1131346_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_095417789.1\|1131345_1133238_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_095417790.1\|1133269_1133818_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_095417791.1\|1134220_1134508_-	hypothetical protein	NA	NA	NA	NA
WP_095417792.1\|1134513_1136376_+	hypothetical protein	NA	NA	NA	NA
WP_095417793.1\|1136500_1137088_+	LysE family translocator	NA	NA	NA	NA
WP_095417794.1\|1137108_1137954_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095417795.1\|1138083_1138878_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095417796.1\|1138999_1140154_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_095417797.1\|1140464_1141868_-	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	2.3e-45	30.3
WP_095417798.1\|1141991_1142192_-	hypothetical protein	NA	NA	NA	NA
WP_095417799.1\|1142292_1142724_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_095417801.1\|1143073_1145173_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.8e-132	44.3
WP_095417802.1\|1145235_1146291_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095417045.1\|1147594_1148014_-	hypothetical protein	NA	NA	NA	NA
WP_095417046.1\|1148012_1149260_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.3e-11	21.0

DBSCAN-SWA_4

1982131 : 1991887

Streptococcus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095418411.1\|1982131_1984237_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.2e-62	27.2
WP_095418412.1\|1984679_1985186_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	9.4e-13	39.2
WP_095418413.1\|1985331_1985535_-	hypothetical protein	NA	NA	NA	NA
WP_095418414.1\|1985988_1986558_-	pseudouridine synthase	NA	NA	NA	NA
WP_095418415.1\|1986892_1988149_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	2.3e-12	64.8
WP_007180614.1\|1988521_1988728_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.4e-23	81.8
WP_006050100.1\|1989278_1989593_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	5.8e-13	44.6
WP_011489636.1\|1989589_1991887_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.2e-169	41.6

DBSCAN-SWA_5

4293866 : 4313143

Pseudomonas_phage(22.22%)

plate,transposase,integrase

attL 4284041:4284057|attR 4311688:4311704

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4284041:4284057	attL	NA	NA	NA	NA
WP_095420068.1\|4293866_4295066_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.1e-83	43.3
WP_095420069.1\|4295590_4296721_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_167397546.1\|4297056_4298043_+	hypothetical protein	NA	NA	NA	NA
WP_095420071.1\|4298172_4298526_+	DUF2591 family protein	NA	NA	NA	NA
WP_157763775.1\|4298494_4299670_-	acyltransferase family protein	B5WZU0	Pseudomonas_phage	2.5e-24	31.4
WP_095420439.1\|4300375_4300552_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_095420074.1\|4300609_4301026_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PH90	Moraxella_phage	5.3e-38	59.7
WP_095420075.1\|4301099_4301624_-	DUF1353 domain-containing protein	A0A1L2CVI8	Pectobacterium_phage	5.3e-19	47.4
WP_095420076.1\|4302023_4302242_-	hypothetical protein	NA	NA	NA	NA
WP_095420077.1\|4302250_4302736_-	hypothetical protein	NA	NA	NA	NA
WP_095420078.1\|4302792_4303365_-	chitinase	A0A059VA40	Pseudomonas_phage	3.7e-34	45.5
WP_157763776.1\|4303361_4303691_-	hypothetical protein	NA	NA	NA	NA
WP_095417514.1\|4303817_4305218_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_095417314.1\|4305791_4306602_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095420080.1\|4306761_4307853_+	acyltransferase	NA	NA	NA	NA
WP_095420081.1\|4308029_4308335_+	transcriptional regulator	NA	NA	NA	NA
WP_095420082.1\|4308388_4309102_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_095420084.1\|4309300_4310263_-	hypothetical protein	A9YX14	Burkholderia_phage	3.7e-26	34.7
WP_095420085.1\|4310271_4310874_-	DUF2313 domain-containing protein	A0A2P9JZK7	Alteromonadaceae_phage	1.0e-26	34.9
WP_095420086.1\|4310874_4312032_-\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	1.7e-30	32.6
4311688:4311704	attR	NA	NA	NA	NA
WP_095420087.1\|4312033_4312477_-	phage GP46 family protein	A0A2P9JZK5	Alteromonadaceae_phage	2.8e-21	37.9
WP_095420440.1\|4312534_4313143_-\|plate	phage baseplate assembly protein	NA	NA	NA	NA

DBSCAN-SWA_6

4317758 : 4328696

Pseudomonas_phage(20.0%)

terminase,capsid,head,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095420091.1\|4317758_4318103_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_095420092.1\|4318106_4318484_-\|tail	phage tail protein	NA	NA	NA	NA
WP_095420093.1\|4318546_4320031_-\|tail	phage tail protein	B5TK67	Pseudomonas_phage	4.3e-90	42.3
WP_095420094.1\|4320027_4320207_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_095420095.1\|4320216_4320789_-	ABC transporter permease	NA	NA	NA	NA
WP_095420096.1\|4320785_4321118_-	hypothetical protein	NA	NA	NA	NA
WP_095420097.1\|4321118_4321400_-	hypothetical protein	NA	NA	NA	NA
WP_095420098.1\|4321399_4322458_-\|capsid	major capsid protein	V5Q8G6	Xylella_phage	2.7e-46	31.4
WP_095420099.1\|4322535_4323222_-\|head	head decoration protein	NA	NA	NA	NA
WP_095420100.1\|4323251_4323893_-	hypothetical protein	NA	NA	NA	NA
WP_095420101.1\|4323917_4324805_-	S49 family peptidase	A0A1I9KF73	Aeromonas_phage	4.7e-52	39.0
WP_095420441.1\|4324801_4326367_-\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	1.2e-90	35.3
WP_095420442.1\|4326435_4326666_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_095420443.1\|4326713_4328696_-\|terminase	phage terminase large subunit family protein	G8EXZ6	Synechococcus_phage	3.5e-140	44.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP022993

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3098 : 63973

Leptospira_phage(19.05%)

integrase,transposase

attL 10522:10581|attR 51010:52127

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095423817.1\|3098_4094_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	8.3e-21	25.2
WP_095423818.1\|4426_4720_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423819.1\|4754_5216_+\|transposase	transposase	NA	NA	NA	NA
WP_095423820.1\|5196_5544_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.0e-18	43.5
WP_095423821.1\|5628_7233_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	6.1e-74	38.2
WP_095423822.1\|7264_8062_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	4.9e-08	26.9
WP_095423823.1\|8058_8967_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	2.8e-07	26.5
WP_095423824.1\|8936_10208_-\|integrase	tyrosine-type recombinase/integrase	A0A142K7N4	Mycobacterium_phage	1.6e-13	27.9
10522:10581	attL	NA	NA	NA	NA
WP_095423817.1\|10600_11596_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	8.3e-21	25.2
WP_095423825.1\|11582_12059_-	ATP-binding protein	NA	NA	NA	NA
WP_157763860.1\|13818_14349_-	hypothetical protein	NA	NA	NA	NA
WP_095423507.1\|14485_17491_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_011875611.1\|17477_17825_+	hypothetical protein	NA	NA	NA	NA
WP_011875610.1\|17821_19027_+	hypothetical protein	NA	NA	NA	NA
WP_095423363.1\|19132_20824_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	1.4e-07	23.7
WP_095423826.1\|20904_22056_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_095423827.1\|22064_22943_-\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	2.4e-32	31.4
WP_095423828.1\|23555_24893_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-37	31.9
WP_095423829.1\|25017_26262_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423926.1\|26258_27218_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423830.1\|27210_28215_+\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	6.4e-05	24.2
WP_095423828.1\|28397_29735_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-37	31.9
WP_095423827.1\|30347_31226_+\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	2.4e-32	31.4
WP_095423831.1\|31234_32440_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_095423832.1\|32751_33360_-	hypothetical protein	NA	NA	NA	NA
WP_095423833.1\|33486_34641_-	porin	NA	NA	NA	NA
WP_095423834.1\|34704_35724_-\|transposase	transposase	NA	NA	NA	NA
WP_157763909.1\|36106_36730_-	FCD domain-containing protein	NA	NA	NA	NA
WP_095423836.1\|36947_38294_-\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.1e-105	46.8
WP_095423837.1\|38344_39043_-	hypothetical protein	A0A0U4J920	Pseudomonas_phage	2.6e-74	61.5
WP_095423838.1\|39590_40841_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.5e-30	31.4
WP_095423839.1\|41826_43107_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_095423840.1\|43147_44365_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095423841.1\|44370_45240_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_095423842.1\|45236_46127_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_095423843.1\|46126_46888_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-11	27.4
WP_095423844.1\|46884_47643_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-12	26.9
WP_157763910.1\|47804_48227_+	hypothetical protein	NA	NA	NA	NA
WP_167397620.1\|48244_49282_+	EamA family transporter	NA	NA	NA	NA
WP_095423847.1\|49278_49821_+	flavin reductase	NA	NA	NA	NA
WP_095423817.1\|49994_50990_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	8.3e-21	25.2
WP_095423848.1\|50988_51999_+	hypothetical protein	NA	NA	NA	NA
WP_095423849.1\|52066_52327_+	hypothetical protein	NA	NA	NA	NA
51010:52127	attR	NA	NA	NA	NA
WP_095423927.1\|53478_55917_+	DEAD/DEAH box helicase family protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	9.0e-37	30.6
WP_095423850.1\|56100_57093_+	DNA-binding protein	NA	NA	NA	NA
WP_095423851.1\|57448_58777_-	4-hydroxybutyrate CoA-transferase	NA	NA	NA	NA
WP_095423852.1\|59078_59855_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_095423853.1\|59957_61616_-	cyclohexanecarboxylate-CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.7e-31	26.8
WP_095423854.1\|61650_62802_-	cyclohexanecarboxyl-CoA dehydrogenase	NA	NA	NA	NA
WP_095423834.1\|62953_63973_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

72721 : 147590

Ralstonia_virus(15.38%)

integrase,transposase

attL 125674:125688|attR 147601:147615

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095417046.1\|72721_73969_-\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	1.6e-42	29.3
WP_095417045.1\|73967_74387_+	hypothetical protein	NA	NA	NA	NA
WP_095423862.1\|75581_76169_-	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_095423863.1\|76194_77568_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_095423864.1\|77869_79354_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_095423865.1\|79343_80792_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_157763911.1\|80803_81199_-	c-type cytochrome	NA	NA	NA	NA
WP_095423867.1\|81195_82563_-	FAD-binding protein	NA	NA	NA	NA
WP_095423817.1\|82576_83572_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	8.3e-21	25.2
WP_095417514.1\|84211_85612_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_095423817.1\|86403_87399_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	8.3e-21	25.2
WP_095423868.1\|88393_89584_-	porin	NA	NA	NA	NA
WP_095417030.1\|89845_90802_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_095423869.1\|92933_94085_-	CoA transferase	NA	NA	NA	NA
WP_095423870.1\|94170_94818_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_095423928.1\|96217_96445_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_095423871.1\|96526_96808_-	hypothetical protein	NA	NA	NA	NA
WP_095423872.1\|96868_97267_-	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_157763913.1\|97229_97748_-	hydroxyphenylacetyl-CoA thioesterase PaaI	NA	NA	NA	NA
WP_095423874.1\|97744_99325_-	AMP-binding protein	A0A1V0SBX8	Catovirus	7.7e-21	23.2
WP_095423875.1\|99364_99739_-	OB-fold domain-containing protein	NA	NA	NA	NA
WP_095423876.1\|99754_100930_-	thiolase family protein	NA	NA	NA	NA
WP_095423877.1\|102286_102829_-	hypothetical protein	NA	NA	NA	NA
WP_095423878.1\|102893_104216_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_095423828.1\|104989_106327_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-37	31.9
WP_095423828.1\|106848_108186_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-37	31.9
WP_095423827.1\|108798_109677_+\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	2.4e-32	31.4
WP_095423831.1\|109685_110891_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_095423879.1\|111141_111522_+	hypothetical protein	NA	NA	NA	NA
WP_157763914.1\|112839_113298_-	hypothetical protein	NA	NA	NA	NA
WP_095423881.1\|115496_116945_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_095423882.1\|116941_118822_+\|integrase	integrase	A0A2H4J9J6	uncultured_Caudovirales_phage	7.7e-20	27.3
WP_095423883.1\|118818_120702_+\|integrase	integrase	A0A2H4J185	uncultured_Caudovirales_phage	2.2e-38	26.7
WP_095423884.1\|120698_121061_+	hypothetical protein	NA	NA	NA	NA
WP_095423885.1\|122084_122726_-	hypothetical protein	NA	NA	NA	NA
WP_095423929.1\|123476_125408_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
125674:125688	attL	NA	NA	NA	NA
WP_095423886.1\|125687_126260_-	hypothetical protein	NA	NA	NA	NA
WP_157763915.1\|126323_127499_-	DNA-binding protein	NA	NA	NA	NA
WP_095423889.1\|128195_129299_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_157763916.1\|129291_130377_-	AAA family ATPase	A0A1X9I765	Streptococcus_phage	4.6e-09	27.4
WP_095423891.1\|130976_131678_+	type IV secretion system protein	NA	NA	NA	NA
WP_095423892.1\|131674_132550_+	TrbG/VirB9 family P-type conjugative transfer protein	NA	NA	NA	NA
WP_095423893.1\|132558_133851_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_095423930.1\|133843_134650_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_095423894.1\|134646_135954_+	TrbG/VirB9 family P-type conjugative transfer protein	NA	NA	NA	NA
WP_095423895.1\|135950_136385_+	lytic transglycosylase domain-containing protein	A0A0K2QQJ4	Ralstonia_phage	5.9e-08	32.5
WP_095423896.1\|136381_136966_+	pilus assembly protein	NA	NA	NA	NA
WP_095423897.1\|136968_138579_+	type II secretory pathway protein	NA	NA	NA	NA
WP_095423898.1\|138587_139916_+	hypothetical protein	NA	NA	NA	NA
WP_095423899.1\|139902_140670_+	hypothetical protein	NA	NA	NA	NA
WP_095423900.1\|140686_142813_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_095417046.1\|142818_144066_-\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	1.6e-42	29.3
WP_095417045.1\|144064_144484_+	hypothetical protein	NA	NA	NA	NA
WP_095423901.1\|144490_145972_-	ATP-dependent helicase	A0A126DN25	Acinetobacter_phage	2.7e-68	33.1
WP_095423902.1\|146132_146600_-	hypothetical protein	NA	NA	NA	NA
WP_095423903.1\|146672_147590_-\|integrase	site-specific integrase	NA	NA	NA	NA
147601:147615	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP022994

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30270 : 64313

Gordonia_phage(12.5%)

integrase,transposase

attL 20873:20887|attR 64934:64948

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
20873:20887	attL	NA	NA	NA	NA
WP_007180429.1\|30270_31962_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	4.0e-07	23.4
WP_007181927.1\|32105_35132_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_156903410.1\|35128_35491_+	hypothetical protein	NA	NA	NA	NA
WP_007180432.1\|35487_35751_+	hypothetical protein	NA	NA	NA	NA
WP_007180433.1\|35827_36400_+	hypothetical protein	NA	NA	NA	NA
WP_095423935.1\|36731_37730_-	formamidase	NA	NA	NA	NA
WP_095423936.1\|37995_39456_-	amidase	NA	NA	NA	NA
WP_095423937.1\|39504_40659_-	porin	NA	NA	NA	NA
WP_095423938.1\|40793_41810_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_095423939.1\|41891_43220_-	cytosine permease	NA	NA	NA	NA
WP_095423940.1\|43647_44685_+	aliphatic amidase	NA	NA	NA	NA
WP_095423941.1\|44737_45547_+	CbbQ/NirQ/NorQ/GpvN family protein	R4TG24	Halovirus	9.1e-10	29.7
WP_095423942.1\|45552_47298_+	VWA domain-containing protein	NA	NA	NA	NA
WP_095423943.1\|47355_48561_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095423944.1\|48577_49219_+	ANTAR domain-containing protein	NA	NA	NA	NA
WP_095423945.1\|49731_50082_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_095423946.1\|50110_51349_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	1.5e-133	57.5
WP_095423947.1\|51430_52120_-	urea ABC transporter ATP-binding subunit UrtE	G9BWD6	Planktothrix_phage	8.5e-17	32.5
WP_095423948.1\|52131_52875_-	urea ABC transporter ATP-binding protein UrtD	A0A2H4PQG7	Staphylococcus_phage	1.3e-15	26.5
WP_095423949.1\|52871_54050_-	urea ABC transporter permease subunit UrtC	NA	NA	NA	NA
WP_095423950.1\|54135_55053_-	urea ABC transporter permease subunit UrtB	NA	NA	NA	NA
WP_095423951.1\|55115_56393_-	urea ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095423952.1\|56579_60011_+	response regulator	A0A1V0SGX0	Hokovirus	1.5e-32	28.9
WP_095423953.1\|60003_60984_+	response regulator transcription factor	NA	NA	NA	NA
WP_157763922.1\|61182_61335_+\|transposase	transposase	NA	NA	NA	NA
WP_157763925.1\|61480_62284_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.3e-13	27.4
WP_095423955.1\|63045_63762_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.0e-45	46.4
WP_095423956.1\|63776_64313_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
64934:64948	attR	NA	NA	NA	NA

DBSCAN-SWA_2

84316 : 115274

Salmonella_phage(40.0%)

integrase,transposase

attL 107046:107060|attR 115527:115541

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095423975.1\|84316_85678_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	2.6e-09	19.9
WP_095423997.1\|85652_85907_+	H-NS histone family protein	NA	NA	NA	NA
WP_095423976.1\|85964_87139_-\|transposase	IS3-like element ISBxe1 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.8e-62	43.0
WP_095423998.1\|87384_87783_+	hypothetical protein	NA	NA	NA	NA
WP_095423977.1\|87874_88588_-	hypothetical protein	NA	NA	NA	NA
WP_095423978.1\|88690_89599_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_095423979.1\|89709_91518_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_095423980.1\|92343_93363_-	YecA family protein	NA	NA	NA	NA
WP_095423982.1\|94028_95708_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423983.1\|95704_98686_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.9e-77	27.1
WP_095423985.1\|99419_100352_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_095423986.1\|100711_101476_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_095423987.1\|101628_102492_-	hypothetical protein	NA	NA	NA	NA
WP_095423988.1\|102517_103972_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_095423989.1\|103968_107100_-	efflux RND transporter permease subunit	NA	NA	NA	NA
107046:107060	attL	NA	NA	NA	NA
WP_095423999.1\|107111_108260_-	efflux RND transporter periplasmic adaptor subunit	S5VL44	Leptospira_phage	3.0e-06	22.0
WP_088176911.1\|109100_109337_+	hypothetical protein	NA	NA	NA	NA
WP_060090756.1\|109406_110060_-	response regulator transcription factor	NA	NA	NA	NA
WP_095423990.1\|110447_113414_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	69.5
WP_046565383.1\|113567_115274_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
115527:115541	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP022990

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

361813 : 427033

Catovirus(28.57%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095420710.1\|361813_363202_+\|tRNA	cysteine--tRNA ligase	NA	NA	NA	NA
WP_095420711.1\|363300_363549_-	hypothetical protein	NA	NA	NA	NA
WP_095418279.1\|363812_365228_+\|transposase	transposase	NA	NA	NA	NA
WP_095420712.1\|365492_365885_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_095420713.1\|365894_366587_-	HAD family phosphatase	NA	NA	NA	NA
WP_095420714.1\|366693_368136_-	c-type cytochrome	NA	NA	NA	NA
WP_095420715.1\|368339_370124_-	alkaline phosphatase family protein	NA	NA	NA	NA
WP_157763796.1\|370198_370525_+	hypothetical protein	NA	NA	NA	NA
WP_095422728.1\|370521_370842_+	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
WP_095420716.1\|371200_371761_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_095420717.1\|371757_372183_+	hypothetical protein	NA	NA	NA	NA
WP_095420718.1\|372179_372698_+	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_095420719.1\|372777_374352_+	DUF1800 domain-containing protein	NA	NA	NA	NA
WP_095422729.1\|374357_375506_+	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_095420720.1\|375686_376046_-	BON domain-containing protein	NA	NA	NA	NA
WP_095420721.1\|378405_379179_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_095420722.1\|379267_380950_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	8.8e-15	23.0
WP_167397595.1\|381153_381441_+	hypothetical protein	NA	NA	NA	NA
WP_095420724.1\|381958_383089_+	rubrerythrin family protein	NA	NA	NA	NA
WP_095420725.1\|383480_384659_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-27	35.9
WP_095420726.1\|384651_385554_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_095420727.1\|385561_386563_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_095420728.1\|386663_387599_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095420729.1\|387919_389182_+	RHS repeat protein	NA	NA	NA	NA
WP_157763797.1\|390196_390619_+	hypothetical protein	NA	NA	NA	NA
WP_095422730.1\|390740_391823_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_095420731.1\|392106_393501_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_095420732.1\|393544_394789_+	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_095420733.1\|394810_395149_+	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_095420734.1\|395145_398148_+	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_095420735.1\|398137_398794_+	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_095420736.1\|398850_399114_+	hypothetical protein	NA	NA	NA	NA
WP_095420737.1\|399256_400675_+	MFS transporter	NA	NA	NA	NA
WP_095420738.1\|400718_401891_-	class C beta-lactamase	NA	NA	NA	NA
WP_095420739.1\|402013_403699_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.5e-51	29.3
WP_095420740.1\|403710_405180_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_095420741.1\|405222_405810_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_095420742.1\|406100_407300_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.3e-12	27.2
WP_095420743.1\|408341_409337_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_095420744.1\|409780_411055_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	4.8e-106	55.1
WP_012426939.1\|411073_412045_+	membrane dipeptidase	NA	NA	NA	NA
WP_095420745.1\|412094_412631_+	4-vinyl reductase	NA	NA	NA	NA
WP_095420746.1\|412716_414780_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_095420747.1\|414782_416696_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_095420748.1\|416700_417870_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_095420749.1\|417866_418643_+	drug:proton antiporter	NA	NA	NA	NA
WP_095420750.1\|418716_420030_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_095420751.1\|420063_421323_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_095420752.1\|421461_422319_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095420753.1\|422402_423278_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_095420754.1\|423417_424332_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.6e-34	35.0
WP_095420755.1\|424495_426034_+\|holin	choline-sulfatase	A0A2P0VMN7	Tetraselmis_virus	6.1e-07	31.7
WP_095420756.1\|426082_427033_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP022992

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

126423 : 191634

Acidithiobacillus_phage(22.22%)

transposase,integrase

attL 137094:137153|attR 174586:176503

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095423523.1\|126423_127596_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423524.1\|127797_127998_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_095423525.1\|128001_129297_-	CDF family Co(II)/Ni(II) efflux transporter DmeF	NA	NA	NA	NA
WP_028206235.1\|129306_129579_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_095423526.1\|129929_131471_-	carbohydrate porin	NA	NA	NA	NA
WP_095423528.1\|133200_134862_+	divalent metal cation transporter	NA	NA	NA	NA
WP_095423529.1\|135138_136086_+	cation transporter	NA	NA	NA	NA
WP_095211915.1\|136624_136828_-	hypothetical protein	NA	NA	NA	NA
137094:137153	attL	NA	NA	NA	NA
WP_095417514.1\|137574_138975_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_095423530.1\|140325_140535_+	hypothetical protein	NA	NA	NA	NA
WP_095423531.1\|140742_142185_-	hypothetical protein	NA	NA	NA	NA
WP_095423532.1\|142181_143171_-	ATP-binding protein	NA	NA	NA	NA
WP_095423533.1\|143175_145149_-	hypothetical protein	NA	NA	NA	NA
WP_095423534.1\|145145_145799_-	hypothetical protein	NA	NA	NA	NA
WP_157763876.1\|146191_147460_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423536.1\|147658_148129_+	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_095423537.1\|148140_149400_+	DUF3443 family protein	NA	NA	NA	NA
WP_095423538.1\|149604_151215_-	replication initiation protein	NA	NA	NA	NA
WP_095423539.1\|151817_152342_+	hypothetical protein	NA	NA	NA	NA
WP_095423540.1\|152856_153141_+	hypothetical protein	NA	NA	NA	NA
WP_095423542.1\|153424_154462_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_095423543.1\|154468_155134_-	ParA family protein	E5FFJ3	Burkholderia_phage	4.0e-11	26.8
WP_095423784.1\|156101_157439_-	replication initiation protein	NA	NA	NA	NA
WP_095423544.1\|158501_158705_+	hypothetical protein	NA	NA	NA	NA
WP_095423545.1\|158840_159419_+	YcbK family protein	A0A2K9VAY0	Citrobacter_phage	8.2e-05	47.1
WP_095423546.1\|159430_160333_-	hypothetical protein	NA	NA	NA	NA
WP_095423547.1\|160457_160859_+	hypothetical protein	NA	NA	NA	NA
WP_095423548.1\|160860_161610_+	hypothetical protein	NA	NA	NA	NA
WP_095423549.1\|161675_162968_+	hypothetical protein	NA	NA	NA	NA
WP_157763877.1\|163268_163886_+	hypothetical protein	NA	NA	NA	NA
WP_095423551.1\|163882_164572_+	hypothetical protein	NA	NA	NA	NA
WP_095423552.1\|165958_166357_-	hypothetical protein	NA	NA	NA	NA
WP_095423553.1\|166399_168241_-	ATP-dependent helicase	S5MMD7	Bacillus_phage	2.9e-19	23.9
WP_095423554.1\|168244_168988_-	hypothetical protein	NA	NA	NA	NA
WP_095423555.1\|169663_169927_+	hypothetical protein	NA	NA	NA	NA
WP_095423556.1\|169923_170547_+	hypothetical protein	NA	NA	NA	NA
WP_095423557.1\|170605_171721_+	AAA domain-containing protein	A0A142EZN6	Stenotrophomonas_phage	3.6e-09	29.2
WP_167397614.1\|171723_172329_+	hypothetical protein	NA	NA	NA	NA
WP_095423558.1\|172339_173368_+	hypothetical protein	NA	NA	NA	NA
WP_095423559.1\|173384_173858_+	single-stranded DNA-binding protein	A0A1X9SGJ7	Bradyrhizobium_phage	3.7e-11	36.1
WP_095423786.1\|173970_174198_+	hypothetical protein	NA	NA	NA	NA
WP_095417514.1\|175066_176467_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_006400877.1\|178924_179674_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.8e-81	61.2
174586:176503	attR	NA	NA	NA	NA
WP_095423560.1\|179689_181240_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.5e-157	55.0
WP_095423561.1\|182147_183221_+	ribonucleotide-diphosphate reductase subunit beta	K4K678	Caulobacter_phage	1.5e-36	29.7
WP_095423562.1\|183307_183742_+	hypothetical protein	NA	NA	NA	NA
WP_095423563.1\|184164_185493_+	hypothetical protein	NA	NA	NA	NA
WP_095423564.1\|185705_186806_+	DUF3150 domain-containing protein	NA	NA	NA	NA
WP_095423565.1\|186864_189054_+	VWA domain-containing protein	NA	NA	NA	NA
WP_095418116.1\|189325_190144_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.4e-31	35.5
WP_095418115.1\|190140_191634_-\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

236439 : 258383

uncultured_virus(100.0%)

transposase,integrase

attL 232776:232790|attR 262001:262015

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
232776:232790	attL	NA	NA	NA	NA
WP_095423477.1\|236439_237257_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095423600.1\|238121_239150_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_095423601.1\|239910_240282_+	hypothetical protein	NA	NA	NA	NA
WP_095423602.1\|240648_241782_-	TDT family transporter	NA	NA	NA	NA
WP_095423603.1\|241889_242786_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_095423605.1\|243357_243792_-	cytochrome c	NA	NA	NA	NA
WP_095423606.1\|243807_245049_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_095423607.1\|245062_247354_-	cation-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.3e-55	28.3
WP_095423608.1\|247372_247960_-	cytochrome c	NA	NA	NA	NA
WP_095423609.1\|247956_248553_-	cytochrome-c oxidase	NA	NA	NA	NA
WP_095423610.1\|248555_250220_-	hypothetical protein	NA	NA	NA	NA
WP_095423600.1\|251400_252429_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_167397613.1\|254744_255023_-	hypothetical protein	NA	NA	NA	NA
WP_095423792.1\|255152_256055_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423611.1\|256051_257392_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095423612.1\|257378_258383_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
262001:262015	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage