CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP017066	Lactiplantibacillus plantarum strain LP3 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	7
NZ_CP017067	Lactiplantibacillus plantarum strain LP3 plasmid pLB301, complete sequence	0 crisprs	NA	1
NZ_CP017068	Lactiplantibacillus plantarum strain LP3 plasmid pLB302, complete sequence	0 crisprs	csa3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017066_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017066_1

2742731-2742816

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP017066_1

>merge|NZ_CP017066|1|2742731-2742816|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP017066|1|1|2742731-2742816|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017066.1\|WP_003642344.1\|2738195_2739233_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP017066.1\|WP_003643398.1\|2742833_2743433_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017066.1\|WP_013355935.1\|2746505_2747501_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP017066.1\|WP_013355936.1\|2748238_2749132_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP017066.1\|WP_046947578.1\|2743553_2744435_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP017066.1\|WP_095587177.1\|2751022_2751769_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP017066.1\|WP_003643400.1\|2745510_2746509_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP017066.1\|WP_003642340.1\|2735549_2735834_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP017066.1\|WP_003642338.1\|2730998_2732411_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP017066.1\|WP_063204396.1\|2749396_2749687_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP017066.1\|WP_022638460.1\|2741237_2742716_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP017066.1\|WP_003643392.1\|2736117_2736483_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP017066.1\|WP_011102040.1\|2737502_2738069_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017066.1\|WP_063204398.1\|2732681_2735264_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP017066.1\|WP_003642345.1\|2739381_2739948_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP017066.1\|WP_061871456.1\|2749748_2750918_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP017066.1\|WP_003642350.1\|2744719_2745514_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP017066.1\|WP_063204397.1\|2740167_2741121_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP017066.1\|WP_003643401.1\|2747745_2748258_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP017066.1\|WP_003642342.1\|2736615_2737344_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674

Protein	Function_ID	Function_description	E-value
NZ_CP017066.1\|WP_003642344.1\|2738195_2739233_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP017066.1\|WP_003643398.1\|2742833_2743433_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP017066.1\|WP_013355935.1\|2746505_2747501_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.35687e-78
NZ_CP017066.1\|WP_013355936.1\|2748238_2749132_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.70513e-130
NZ_CP017066.1\|WP_046947578.1\|2743553_2744435_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.58356e-56
NZ_CP017066.1\|WP_095587177.1\|2751022_2751769_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	3.54997e-91
NZ_CP017066.1\|WP_003643400.1\|2745510_2746509_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP017066.1\|WP_003642340.1\|2735549_2735834_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP017066.1\|WP_003642338.1\|2730998_2732411_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP017066.1\|WP_063204396.1\|2749396_2749687_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.19262e-17
NZ_CP017066.1\|WP_022638460.1\|2741237_2742716_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP017066.1\|WP_003643392.1\|2736117_2736483_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NZ_CP017066.1\|WP_011102040.1\|2737502_2738069_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP017066.1\|WP_063204398.1\|2732681_2735264_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.57488e-70
NZ_CP017066.1\|WP_003642345.1\|2739381_2739948_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP017066.1\|WP_061871456.1\|2749748_2750918_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.1996e-56
NZ_CP017066.1\|WP_003642350.1\|2744719_2745514_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP017066.1\|WP_063204397.1\|2740167_2741121_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	4.53899e-131
NZ_CP017066.1\|WP_003643401.1\|2747745_2748258_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP017066.1\|WP_003642342.1\|2736615_2737344_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89

>NZ_CP017066.1|WP_022638460.1|2741237_2742716_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP017066.1|WP_063204397.1|2740167_2741121_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDNILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP017066.1|WP_003642345.1|2739381_2739948_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP017066.1|WP_003642344.1|2738195_2739233_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP017066.1|WP_011102040.1|2737502_2738069_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP017066.1|WP_003642342.1|2736615_2737344_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP017066.1|WP_003643392.1|2736117_2736483_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP017066.1|WP_003642340.1|2735549_2735834_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP017066.1|WP_063204398.1|2732681_2735264_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTMTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP017066.1|WP_003642338.1|2730998_2732411_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP017066.1|WP_003643398.1|2742833_2743433_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP017066.1|WP_046947578.1|2743553_2744435_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSTVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP017066.1|WP_003642350.1|2744719_2745514_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP017066.1|WP_003643400.1|2745510_2746509_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP017066.1|WP_013355935.1|2746505_2747501_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP017066.1|WP_003643401.1|2747745_2748258_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP017066.1|WP_013355936.1|2748238_2749132_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP017066.1|WP_063204396.1|2749396_2749687_+|winged-helix-turn-helix-transcriptional-regulator
MIIKQLSDNEIRIQIFKALSDEVRLNIIAMLYEKQTEMSCGEIGETLDINKSTASYHFKTLREAGLTTTRKKGQNKYVSLNIDAFNEILPGFLDTL
>NZ_CP017066.1|WP_061871456.1|2749748_2750918_+|MFS-transporter
MRRYSLMFFLTMFLIGTDTFLISPLLPTLARMYGVSTSISGWMVSAYAIGYACFALISGPISDGRNRKKVMIWGLLAFSMSTFLCGFSYTFPAMLFFRFLAGVSASFVTPQVWASIPVIVDKKHIVKVMGYATAGLSVSQLVGIPIGSYLAVNSWHTPFFVISGAALILLISNAIALPELEFGHKFKTSFFKTYTSVLHNSKALNYLFAYLIFQTGSFTAITFISTWFTNSFGLTLTGVGTAMIAIGAGNLIGSLFSGNLVNRMGLEKTFLFELIALITLYLILPFITTFWLAEIVLTLAFLFNGFIFPIFMTTLQSTTINARSTVSSLSNAAMYFGETLAGIIGGVLFKQFHSYLGISIFAALMILFALLVYAKSGVFKPENNNSIED
>NZ_CP017066.1|WP_095587177.1|2751022_2751769_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQVGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

331485 : 443073

107

Tupanvirus(18.18%)

bacteriocin,tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044428951.1\|331485_332049_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_044428954.1\|332242_332911_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_027821520.1\|333068_334574_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|334838_335207_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|335319_335829_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|335859_337056_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641935.1\|337653_338109_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|338212_338785_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|338950_339871_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015379753.1\|340007_340907_+	oxidoreductase	NA	NA	NA	NA
WP_053566421.1\|341346_343227_+	hypothetical protein	NA	NA	NA	NA
WP_011679766.1\|343398_343845_-	ribonuclease H	NA	NA	NA	NA
WP_063204027.1\|344082_345615_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|345615_346587_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_063204026.1\|346664_347996_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|348461_349979_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|349993_351823_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_072534863.1\|351837_352560_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	5.4e-30	31.9
WP_095587106.1\|353142_356838_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_095587192.1\|358390_358807_+	EndoU domain-containing protein	NA	NA	NA	NA
WP_053566425.1\|358846_359161_+	hypothetical protein	NA	NA	NA	NA
WP_080373188.1\|359222_359375_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_053566426.1\|359385_359793_+	immunity 63 family protein	NA	NA	NA	NA
WP_080373231.1\|360293_360632_+	hypothetical protein	NA	NA	NA	NA
WP_011100991.1\|360971_361250_+	hypothetical protein	NA	NA	NA	NA
WP_053566427.1\|361546_362464_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|362470_362644_+	hypothetical protein	NA	NA	NA	NA
WP_016511577.1\|363188_363731_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011100988.1\|363745_364009_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|364125_364329_+	hypothetical protein	NA	NA	NA	NA
WP_063204024.1\|364453_364693_+	hypothetical protein	NA	NA	NA	NA
WP_047672646.1\|364710_365097_+	hypothetical protein	NA	NA	NA	NA
WP_072534813.1\|365546_365738_+	hypothetical protein	NA	NA	NA	NA
WP_057136835.1\|366129_366375_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|366949_367369_+	hypothetical protein	NA	NA	NA	NA
WP_063204023.1\|367650_368124_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|368459_369077_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_063204022.1\|369080_370235_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|370238_371030_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|371100_371973_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|372132_372948_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|373473_374850_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|374894_376079_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|376463_376667_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|377078_377747_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|377743_377917_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|377947_378115_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|378976_379177_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|379304_379472_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_063204020.1\|379589_380789_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|380819_381566_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|382443_382590_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_021356664.1\|382780_384109_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_063486822.1\|384109_384853_+	response regulator transcription factor	NA	NA	NA	NA
WP_063204018.1\|384971_385715_+	response regulator transcription factor	NA	NA	NA	NA
WP_015825123.1\|386020_386794_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|386892_387051_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|387075_387246_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_063204064.1\|387512_389663_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_057136851.1\|389678_391055_+	HlyD family secretion protein	NA	NA	NA	NA
WP_063204065.1\|391144_391834_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063204066.1\|391901_392570_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|392656_393337_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821496.1\|394244_394448_+	hypothetical protein	NA	NA	NA	NA
WP_063204067.1\|394542_396852_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_021356643.1\|397110_397887_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|398326_399343_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|399750_400461_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095587107.1\|400533_401895_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|401901_402090_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|402079_402502_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|402724_404080_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|404097_405534_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|405654_406551_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|406700_407447_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_063204068.1\|407559_408573_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_047672680.1\|409027_410161_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|410165_410960_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|411128_412046_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|412091_413366_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|413358_414318_+	hypothetical protein	NA	NA	NA	NA
WP_003646490.1\|414339_415044_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|415043_415886_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_015825136.1\|416489_416879_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|417200_419252_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003642016.1\|419484_420669_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003642017.1\|420791_421568_+	TatD family hydrolase	NA	NA	NA	NA
WP_063204069.1\|421554_422118_+	ribonuclease M5	NA	NA	NA	NA
WP_003642019.1\|422114_423005_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003642020.1\|423109_423361_+	Veg family protein	NA	NA	NA	NA
WP_003643828.1\|423493_424360_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642022.1\|424669_425614_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642023.1\|425881_426580_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003646500.1\|426572_427370_+	metal ABC transporter permease	NA	NA	NA	NA
WP_003642030.1\|427725_428562_+	pur operon repressor	NA	NA	NA	NA
WP_063204070.1\|428630_430013_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_063204071.1\|430248_431073_+	serine hydrolase	NA	NA	NA	NA
WP_003643830.1\|431438_432419_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003642034.1\|432701_433724_+	YdcF family protein	NA	NA	NA	NA
WP_003643831.1\|433806_434793_+	lipoprotein	NA	NA	NA	NA
WP_003642037.1\|434962_435772_-	sugar-phosphatase	NA	NA	NA	NA
WP_169484456.1\|435791_437150_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003643833.1\|437158_438091_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642040.1\|438453_438894_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003642041.1\|438938_439547_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642042.1\|439719_441333_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_095587108.1\|441801_443073_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.5e-95	43.4

DBSCAN-SWA_2

589624 : 598236

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643940.1\|589624_591322_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|591343_591652_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|591667_592267_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|592281_592533_+	YaaL family protein	NA	NA	NA	NA
WP_063204089.1\|592918_593584_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.9e-53	52.7
WP_003640965.1\|593580_593910_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|593926_594946_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|594970_595318_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_044429290.1\|595416_596313_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.5e-82	55.7
WP_003640969.1\|596316_597102_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|597240_598236_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5

DBSCAN-SWA_3

1275040 : 1284879

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044430313.1\|1275040_1276279_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.4e-216	97.4
WP_015825455.1\|1276369_1277341_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_003643099.1\|1277526_1278474_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1278817_1279432_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_046810985.1\|1279434_1281873_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_044430320.1\|1281960_1282521_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	8.5e-100	98.4
WP_033608589.1\|1282591_1283032_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.5e-75	97.3
WP_003645220.1\|1283883_1284879_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_4

1797694 : 1882524

Lactobacillus_phage(71.43%)

integrase,holin,tRNA,tail,capsid,portal,head,terminase,protease

attL 1823276:1823293|attR 1889466:1889483

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533795.1\|1797694_1798618_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003640717.1\|1799101_1799623_-	shikimate kinase	NA	NA	NA	NA
WP_003645966.1\|1799625_1800723_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_044430868.1\|1800725_1802024_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003644492.1\|1802037_1802565_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_044430925.1\|1802573_1803743_-	chorismate synthase	NA	NA	NA	NA
WP_003645963.1\|1803735_1805190_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1805838_1806192_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|1806214_1808791_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1808805_1809111_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1809100_1809400_-	YlxR family protein	NA	NA	NA	NA
WP_003644496.1\|1809444_1810662_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1810682_1811159_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1811454_1815768_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1816261_1817971_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1818010_1819288_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1819325_1820111_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1820126_1820906_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1821025_1821589_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1821590_1822313_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1822513_1823392_-	elongation factor Ts	NA	NA	NA	NA
1823276:1823293	attL	NA	NA	NA	NA
WP_003640739.1\|1823494_1824298_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1824522_1825245_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1825533_1826532_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1826616_1826922_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1826905_1827664_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1827775_1828411_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1828467_1828704_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1828801_1829041_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1829192_1829825_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_095587149.1\|1829914_1830145_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_063204321.1\|1830449_1831067_+	hypothetical protein	NA	NA	NA	NA
WP_011101645.1\|1831116_1832286_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1832321_1832714_-	hypothetical protein	NA	NA	NA	NA
WP_011101646.1\|1832877_1833270_+	hypothetical protein	NA	NA	NA	NA
WP_003645635.1\|1833716_1834658_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	3.1e-78	48.7
WP_003645636.1\|1835357_1835930_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644505.1\|1836081_1837266_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|1837246_1838038_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_063204320.1\|1838056_1839799_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_011101647.1\|1840277_1841489_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_095587150.1\|1842727_1843258_-\|holin	holin	E9LUS0	Lactobacillus_phage	8.5e-41	98.9
WP_095587151.1\|1843270_1843534_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	4.3e-38	98.9
WP_085764049.1\|1843533_1844706_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	2.2e-214	99.5
WP_187338181.1\|1845588_1845750_-	hypothetical protein	E9LUR6	Lactobacillus_phage	6.1e-19	96.2
WP_057138690.1\|1845753_1846005_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	3.2e-30	98.6
WP_085764050.1\|1845997_1848769_-\|tail	phage tail protein	E9LUR4	Lactobacillus_phage	1.5e-309	87.8
WP_085764051.1\|1851211_1852981_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	92.3
WP_085764052.1\|1853054_1857806_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	65.8
WP_003644519.1\|1857837_1858029_-	hypothetical protein	NA	NA	NA	NA
WP_072533483.1\|1858067_1858442_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.5e-57	93.5
WP_085764053.1\|1858514_1859168_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	5.4e-114	95.4
WP_085764054.1\|1859184_1859565_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.4e-61	93.7
WP_085764055.1\|1859564_1859969_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	8.1e-68	95.5
WP_072538088.1\|1859971_1860319_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.0e-55	93.9
WP_021336803.1\|1860319_1860598_-	hypothetical protein	A0A2P0ZLF2	Lactobacillus_phage	4.9e-32	72.5
WP_085764056.1\|1860688_1862071_-\|capsid	phage major capsid protein	A0A0M7RF71	Lactobacillus_phage	3.7e-96	62.0
WP_085764057.1\|1862077_1862683_-\|head,protease	HK97 family phage prohead protease	B8R651	Lactobacillus_phage	3.7e-40	48.5
WP_072533294.1\|1862654_1863773_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	2.5e-66	40.1
WP_085764059.1\|1863994_1865914_-\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	1.9e-135	41.5
WP_085764060.1\|1865897_1866332_-\|terminase	phage terminase small subunit P27 family	B8R648	Lactobacillus_phage	3.5e-16	36.9
WP_154231022.1\|1866538_1866775_-	hypothetical protein	NA	NA	NA	NA
WP_085764061.1\|1866807_1867467_-	HNH endonuclease	E9LUP6	Lactobacillus_phage	2.4e-16	83.3
WP_045351762.1\|1867520_1868321_-	hypothetical protein	NA	NA	NA	NA
WP_003644538.1\|1868731_1869157_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.3e-59	77.3
WP_085764062.1\|1869338_1869506_-	hypothetical protein	E9LUP4	Lactobacillus_phage	1.3e-11	82.6
WP_085764063.1\|1869623_1870046_-	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	3.1e-54	69.1
WP_085764064.1\|1870042_1870471_-	hypothetical protein	A0A2K9VC36	Lactobacillus_phage	6.9e-41	70.6
WP_085764065.1\|1870476_1870842_-	hypothetical protein	O03921	Lactobacillus_phage	4.2e-23	87.9
WP_095587153.1\|1870786_1870969_-	hypothetical protein	NA	NA	NA	NA
WP_085764066.1\|1871042_1871648_-	hypothetical protein	E9LUN9	Lactobacillus_phage	3.3e-113	97.0
WP_063722553.1\|1871747_1872056_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.2e-47	93.1
WP_085764067.1\|1872191_1872977_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.0e-131	90.8
WP_085764068.1\|1872976_1873705_-	replisome organizer	E9LUM6	Lactobacillus_phage	8.1e-42	41.6
WP_033098960.1\|1873807_1874065_-	hypothetical protein	NA	NA	NA	NA
WP_187338182.1\|1874064_1874235_-	hypothetical protein	NA	NA	NA	NA
WP_021732030.1\|1874509_1874764_-	hypothetical protein	NA	NA	NA	NA
WP_063485662.1\|1874906_1875167_-	hypothetical protein	NA	NA	NA	NA
WP_063485661.1\|1875576_1875933_+	hypothetical protein	NA	NA	NA	NA
WP_063485660.1\|1875929_1876133_-	hypothetical protein	NA	NA	NA	NA
WP_063485659.1\|1876193_1876637_+	hypothetical protein	NA	NA	NA	NA
WP_095587154.1\|1876602_1876806_-	hypothetical protein	NA	NA	NA	NA
WP_085764069.1\|1876884_1877064_-	hypothetical protein	NA	NA	NA	NA
WP_085764070.1\|1877078_1877813_-	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	3.3e-51	44.4
WP_027821294.1\|1877828_1878044_-	helix-turn-helix transcriptional regulator	A0A2H4JBV7	uncultured_Caudovirales_phage	5.9e-17	71.0
WP_089178244.1\|1878236_1878908_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	1.7e-41	55.0
WP_095587155.1\|1879029_1879764_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	2.6e-40	53.5
WP_085764073.1\|1879766_1879985_+	hypothetical protein	NA	NA	NA	NA
WP_063204245.1\|1880433_1881096_+	type II toxin-antitoxin system PemK/MazF family toxin	M1NRQ5	Streptococcus_phage	9.0e-24	36.0
WP_063204246.1\|1881360_1882524_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	7.8e-63	37.6
1889466:1889483	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2170887 : 2206016

Oenococcus_phage(41.94%)

holin,tail,capsid,portal,head,terminase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764077.1\|2170887_2171265_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	1.0e-16	64.0
WP_022638106.1\|2171251_2171548_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	6.4e-38	74.5
WP_187338184.1\|2171548_2172664_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	3.1e-32	77.4
WP_021732622.1\|2172842_2173277_-	hypothetical protein	NA	NA	NA	NA
WP_046811036.1\|2173279_2173729_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	2.8e-21	40.5
WP_095587160.1\|2173750_2178964_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	2.8e-144	59.4
WP_033611971.1\|2178978_2179341_-	hypothetical protein	V5UQS8	Oenococcus_phage	1.9e-44	71.2
WP_095587161.1\|2179354_2185186_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	3.1e-224	41.0
WP_031275283.1\|2185201_2185465_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_003642826.1\|2185572_2185971_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_099447638.1\|2186070_2186454_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642824.1\|2186555_2186921_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_044431353.1\|2186920_2187472_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	8.8e-65	62.3
WP_046947686.1\|2187464_2187821_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_024971556.1\|2187820_2188153_-\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642820.1\|2188164_2188341_-	hypothetical protein	NA	NA	NA	NA
WP_085764079.1\|2188353_2189376_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	6.3e-117	62.2
WP_085764080.1\|2189395_2189743_-	hypothetical protein	V5UTH9	Oenococcus_phage	9.8e-30	59.0
WP_085764081.1\|2189757_2190435_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	4.6e-15	32.1
WP_003642816.1\|2190607_2190814_-	hypothetical protein	NA	NA	NA	NA
WP_085764082.1\|2190865_2191144_-	hypothetical protein	NA	NA	NA	NA
WP_024971553.1\|2191118_2192804_-\|capsid	minor capsid protein	V5US81	Oenococcus_phage	3.1e-121	59.1
WP_021356226.1\|2192950_2193247_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	5.6e-10	39.2
WP_046811040.1\|2193176_2194685_-\|portal	phage portal protein	V5US18	Oenococcus_phage	1.1e-136	52.0
WP_022638113.1\|2194696_2195935_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	7.1e-139	61.0
WP_069710576.1\|2195924_2196452_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.6e-55	74.0
WP_021732633.1\|2196493_2196763_-	DUF2829 domain-containing protein	A0A0K2FLC4	Brevibacillus_phage	2.5e-12	45.5
WP_069710575.1\|2196890_2197088_-	hypothetical protein	NA	NA	NA	NA
WP_003642805.1\|2198155_2198617_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_063490736.1\|2198838_2199150_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	8.5e-49	91.3
WP_003642802.1\|2199152_2199527_-	hypothetical protein	NA	NA	NA	NA
WP_003642801.1\|2199523_2200042_-	hypothetical protein	O03915	Lactobacillus_phage	4.6e-39	54.6
WP_003642800.1\|2200038_2200326_-	hypothetical protein	NA	NA	NA	NA
WP_003642799.1\|2200322_2201231_-	DnaD domain protein	NA	NA	NA	NA
WP_025015687.1\|2201309_2202062_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	1.3e-71	51.0
WP_003642797.1\|2202093_2202993_-	recombinase RecT	E9LUM3	Lactobacillus_phage	3.2e-64	53.7
WP_072533949.1\|2202989_2203376_-	hypothetical protein	NA	NA	NA	NA
WP_095587162.1\|2203746_2204259_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.2e-29	45.3
WP_053339033.1\|2204325_2204631_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2204642_2204813_-	hypothetical protein	NA	NA	NA	NA
WP_011101083.1\|2204825_2205056_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016511202.1\|2205228_2205591_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_003642784.1\|2205602_2206016_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3

DBSCAN-SWA_6

2405362 : 2413873

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2405362_2405941_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2405933_2406959_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_063203946.1\|2406955_2408410_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|2408394_2410614_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2410606_2411287_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2411286_2411541_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2411542_2412274_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_046811071.1\|2412276_2413407_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2413390_2413873_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_7

2886203 : 2894490

Streptococcus_phage(16.67%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063204299.1\|2886203_2887316_-	glycerate kinase	W6LM47	Streptococcus_phage	2.3e-35	35.3
WP_044432279.1\|2887451_2888786_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-26	26.9
WP_063204300.1\|2888980_2889310_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003642490.1\|2889531_2890830_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_003643473.1\|2891146_2892436_+	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_024272289.1\|2892484_2893456_+	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.4e-137	71.2
WP_063204301.1\|2893548_2894490_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.3e-19	30.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

23670 : 31373

Enterococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533477.1\|23670_25818_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.8e-254	60.3
WP_046783565.1\|25924_26851_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	2.6e-37	32.4
WP_020923860.1\|26865_27816_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-99	54.6
WP_020923859.1\|27943_28756_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.4e-15	29.0
WP_046783566.1\|28869_29502_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2
WP_072533467.1\|29588_30491_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.4e-51	39.9
WP_095587199.1\|30598_31373_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017066

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection