CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP023257	Bacillus subtilis strain TLO3 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG,RT	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023257_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023257_1

966515-966624

Orphan

Consensus_repeat	Method
CAAGGTCAATTCGGCACTGAATTTGCTAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023257_1

>merge|NZ_CP023257|1|966515-966624|CRISPRCasFinder
CAAGGTCAATTCGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTGGCCAACAAGGTCAATTCGGCACTGAATTCGCTAG

>NZ_CP023257|1|1|966515-966624|CRISPRCasFinder
CAAGGTCAATTCGGCACTGAATTTGCTAG	CGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTGGCCAA
CAAGGTCAATTCGGCACTGAATTCGCTAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023257.1\|WP_026113736.1\|964195_965305_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP023257.1\|WP_003233532.1\|972428_972902_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP023257.1\|WP_014476212.1\|962996_963980_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP023257.1\|WP_095843593.1\|960418_963004_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP023257.1\|WP_003242708.1\|966866_967127_+\|ygaB-like-family-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP023257.1\|WP_095843594.1\|974058_974943_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP023257.1\|WP_041052569.1\|959357_960347_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP023257.1\|WP_003233542.1\|965312_965537_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023257.1\|WP_003223285.1\|973025_973463_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP023257.1\|WP_009966836.1\|967888_969631_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP023257.1\|WP_015715541.1\|970987_972277_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP023257.1\|WP_003243363.1\|957340_957859_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP023257.1\|WP_017697485.1\|969705_970767_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP023257.1\|WP_017697486.1\|967270_967801_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP023257.1\|WP_014479226.1\|973497_973851_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP023257.1\|WP_087614160.1\|981952_983103_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP023257.1\|WP_003243789.1\|955632_955902_+\|YfhJ-family-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP023257.1\|WP_024573182.1\|957943_958276_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP023257.1\|WP_095843592.1\|958262_959123_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP023257.1\|WP_003223262.1\|965618_966371_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145

Protein	Function_ID	Function_description	E-value
NZ_CP023257.1\|WP_026113736.1\|964195_965305_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	1.72084e-156
NZ_CP023257.1\|WP_003233532.1\|972428_972902_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NZ_CP023257.1\|WP_014476212.1\|962996_963980_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.46531e-44
NZ_CP023257.1\|WP_003223262.1\|965618_966371_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP023257.1\|WP_003242708.1\|966866_967127_+\|ygaB-like-family-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.32408e-26
NZ_CP023257.1\|WP_095843594.1\|974058_974943_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	4.60772e-59
NZ_CP023257.1\|WP_041052569.1\|959357_960347_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.76719e-85
NZ_CP023257.1\|WP_003223285.1\|973025_973463_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP023257.1\|WP_009966836.1\|967888_969631_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP023257.1\|WP_015715541.1\|970987_972277_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP023257.1\|WP_003243363.1\|957340_957859_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	2.69836e-13
NZ_CP023257.1\|WP_017697485.1\|969705_970767_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	9.54572e-89
NZ_CP023257.1\|WP_017697486.1\|967270_967801_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	2.68278e-126
NZ_CP023257.1\|WP_014479226.1\|973497_973851_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	7.28983e-70
NZ_CP023257.1\|WP_087614160.1\|981952_983103_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	9.5844e-41
NZ_CP023257.1\|WP_003243789.1\|955632_955902_+\|YfhJ-family-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP023257.1\|WP_024573182.1\|957943_958276_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	9.58285e-26
NZ_CP023257.1\|WP_095843592.1\|958262_959123_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	6.00414e-37
NZ_CP023257.1\|WP_095843593.1\|960418_963004_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0

>NZ_CP023257.1|WP_003223262.1|965618_966371_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP023257.1|WP_003233542.1|965312_965537_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP023257.1|WP_026113736.1|964195_965305_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKEFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSELKKVTKEELEQFAFPVSHQKIWKMAVEAAAISAAP
>NZ_CP023257.1|WP_014476212.1|962996_963980_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILAGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP023257.1|WP_095843593.1|960418_963004_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFMISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSDLKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFTLKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NZ_CP023257.1|WP_041052569.1|959357_960347_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENIERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP023257.1|WP_095843592.1|958262_959123_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRLEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYETLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP023257.1|WP_024573182.1|957943_958276_+|SdpC-immunity-protein-SpdL
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLIILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NZ_CP023257.1|WP_003243363.1|957340_957859_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP023257.1|WP_003243789.1|955632_955902_+|YfhJ-family-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP023257.1|WP_003242708.1|966866_967127_+|ygaB-like-family-protein
MTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP023257.1|WP_017697486.1|967270_967801_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISTPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP023257.1|WP_009966836.1|967888_969631_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP023257.1|WP_017697485.1|969705_970767_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTDEIMKWIRLIMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENDIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIQYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP023257.1|WP_015715541.1|970987_972277_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NZ_CP023257.1|WP_003233532.1|972428_972902_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP023257.1|WP_003223285.1|973025_973463_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP023257.1|WP_014479226.1|973497_973851_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP023257.1|WP_095843594.1|974058_974943_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVAELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP023257.1|WP_087614160.1|981952_983103_-|IS3-family-transposase
MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQELNIKNNTQIKTWVRWYKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENRYLRQQNEVFKKVQRIGKEVDSQTSVELVEELHSTMTVQDICIHLGISRSSYYRWKKNLKKDHPKRHLEKQIGTLCREHQYRYGYRKITAILKKRMCINHKTVQRIMQKNQWQCRVKVKKRKKNGQPYAVVDNILDRNFQSDHPLEKLVTDITYLPYGQKQLYLSSILDVYNGEVIAFTIGDKQDTDFVLHTLDQLPTLPENCVLHSDQGSVYTSYEYQKAVKTKGITMSMSRKGTPADNASIESFHSSLKSETFYLNSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023257_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023257_2

2997151-2997258

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023257_2

>merge|NZ_CP023257|2|2997151-2997258|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP023257|2|2|2997151-2997258|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023257.1\|WP_095843900.1\|3004818_3005340_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP023257.1\|WP_003243227.1\|3008759_3009968_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP023257.1\|WP_085186026.1\|3006907_3007432_-\|NfeD-family-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP023257.1\|WP_003229018.1\|2993517_2994660_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP023257.1\|WP_017695429.1\|2984584_2985640_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP023257.1\|WP_017695430.1\|2984151_2984583_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023257.1\|WP_033881498.1\|3007599_3008088_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP023257.1\|WP_095843898.1\|2994656_2996540_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP023257.1\|WP_014480661.1\|3011655_3012198_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP023257.1\|WP_095843901.1\|3005357_3006887_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP023257.1\|WP_017697648.1\|3009984_3011457_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP023257.1\|WP_095843899.1\|3004198_3004777_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP023257.1\|WP_095843902.1\|3008093_3008672_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NZ_CP023257.1\|WP_072557162.1\|2986977_2988051_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP023257.1\|WP_003243556.1\|3012395_3012941_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP023257.1\|WP_095843895.1\|2985654_2986788_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP023257.1\|WP_003229024.1\|2988130_2988598_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP023257.1\|WP_004398841.1\|2992462_2993494_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP023257.1\|WP_095843897.1\|2991011_2992466_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP023257.1\|WP_095843896.1\|2988628_2991025_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967

Protein	Function_ID	Function_description	E-value
NZ_CP023257.1\|WP_003243227.1\|3008759_3009968_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NZ_CP023257.1\|WP_003243556.1\|3012395_3012941_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NZ_CP023257.1\|WP_003229018.1\|2993517_2994660_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP023257.1\|WP_004398841.1\|2992462_2993494_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP023257.1\|WP_017695429.1\|2984584_2985640_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	7.34474e-130
NZ_CP023257.1\|WP_033881498.1\|3007599_3008088_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.35984e-17
NZ_CP023257.1\|WP_095843898.1\|2994656_2996540_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP023257.1\|WP_014480661.1\|3011655_3012198_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
NZ_CP023257.1\|WP_095843901.1\|3005357_3006887_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	2.64789e-123
NZ_CP023257.1\|WP_017697648.1\|3009984_3011457_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP023257.1\|WP_095843899.1\|3004198_3004777_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	8.60269e-72
NZ_CP023257.1\|WP_095843902.1\|3008093_3008672_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	7.70604e-05
NZ_CP023257.1\|WP_072557162.1\|2986977_2988051_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	7.37273e-131
NZ_CP023257.1\|WP_003229024.1\|2988130_2988598_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NZ_CP023257.1\|WP_085186026.1\|3006907_3007432_-\|NfeD-family-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.00034536
NZ_CP023257.1\|WP_095843900.1\|3004818_3005340_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	2.80064e-10
NZ_CP023257.1\|WP_095843895.1\|2985654_2986788_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.68213e-74
NZ_CP023257.1\|WP_095843897.1\|2991011_2992466_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP023257.1\|WP_095843896.1\|2988628_2991025_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0

>NZ_CP023257.1|WP_095843898.1|2994656_2996540_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASKVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIMLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYDKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMRETYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYIMMTIPPYGISILRAVKKRGEIKR
>NZ_CP023257.1|WP_003229018.1|2993517_2994660_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP023257.1|WP_004398841.1|2992462_2993494_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP023257.1|WP_095843897.1|2991011_2992466_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDYVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEQLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGQDVLE
>NZ_CP023257.1|WP_095843896.1|2988628_2991025_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILMEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP023257.1|WP_003229024.1|2988130_2988598_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NZ_CP023257.1|WP_072557162.1|2986977_2988051_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDQLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPFLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NZ_CP023257.1|WP_095843895.1|2985654_2986788_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDKDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYNPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWRRVAENLLSVYEKNR
>NZ_CP023257.1|WP_017695429.1|2984584_2985640_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLASYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP023257.1|WP_017695430.1|2984151_2984583_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSMSAEKEEEEKHLDVGSIRELPHINVPKEYKEETKEKETDHKIVDDEEETKFETILEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP023257.1|WP_095843899.1|3004198_3004777_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKRTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP023257.1|WP_095843900.1|3004818_3005340_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWLDLSALKTLLNR
>NZ_CP023257.1|WP_095843901.1|3005357_3006887_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKATSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>NZ_CP023257.1|WP_085186026.1|3006907_3007432_-|NfeD-family-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIVLLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP023257.1|WP_033881498.1|3007599_3008088_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKSLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP023257.1|WP_095843902.1|3008093_3008672_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVHHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP023257.1|WP_003243227.1|3008759_3009968_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP023257.1|WP_017697648.1|3009984_3011457_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGDTVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP023257.1|WP_014480661.1|3011655_3012198_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>NZ_CP023257.1|WP_003243556.1|3012395_3012941_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP023257_2	2.1\|2997175\|60\|NZ_CP023257\|CRISPRCasFinder	2997175-2997234	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|2997175|60|NZ_CP023257|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

152638 : 219445

Bacillus_phage(41.3%)

capsid,tRNA,portal,terminase,integrase,plate,holin,head,tail

attL 165621:165668|attR 220201:220248

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399657.1\|152638_153382_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_003241966.1\|153543_153981_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_004399691.1\|154001_154394_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_017695888.1\|154851_155619_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017695889.1\|155804_156248_+	YbaK family protein	NA	NA	NA	NA
WP_017695890.1\|156307_157021_+	N-acetylmuramoyl-L-alanine amidase CwlD	A0A0N6W8I1	Bacillus_phage	1.1e-14	30.0
WP_095843389.1\|157116_158175_+	iron-sulfur carrier protein/transcriptional regulator SalA	NA	NA	NA	NA
WP_003235126.1\|158210_158768_-	spore germination protein GerD	NA	NA	NA	NA
WP_004399693.1\|158877_159474_+	KinB-signaling pathway activation protein	NA	NA	NA	NA
WP_095843390.1\|159474_160239_-	polysaccharide deacetylase family sporulation protein PdaB	NA	NA	NA	NA
165621:165668	attL	NA	NA	NA	NA
WP_095843391.1\|165773_166958_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CZ62	Paenibacillus_phage	2.6e-74	40.5
WP_095843392.1\|166944_167478_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.0e-37	49.4
WP_095843393.1\|167558_168164_-	hypothetical protein	O64079	Bacillus_phage	5.0e-61	76.1
WP_095843394.1\|168397_168724_-	helix-turn-helix transcriptional regulator	O64078	Bacillus_phage	9.0e-17	46.7
WP_014112366.1\|168884_169118_+	helix-turn-helix transcriptional regulator	A8ATX6	Listeria_phage	6.6e-14	52.8
WP_095843395.1\|169130_169322_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014112367.1\|169386_169920_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_019712778.1\|169909_170170_+	hypothetical protein	NA	NA	NA	NA
WP_014112369.1\|170170_170335_+	hypothetical protein	NA	NA	NA	NA
WP_095843396.1\|170753_170939_+	hypothetical protein	NA	NA	NA	NA
WP_095843397.1\|170935_172909_+	AAA family ATPase	A0A1L2K2K3	Aeribacillus_phage	7.3e-154	46.7
WP_095843398.1\|172908_173133_+	hypothetical protein	NA	NA	NA	NA
WP_095843399.1\|173125_174007_+	recombinase RecT	D7RWF9	Brochothrix_phage	7.7e-87	61.5
WP_095843400.1\|174003_174705_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	1.1e-96	70.0
WP_095843401.1\|174909_175665_+	hypothetical protein	U5Q085	Bacillus_phage	2.0e-11	31.9
WP_095843402.1\|175682_175964_+	hypothetical protein	NA	NA	NA	NA
WP_095843403.1\|175938_177237_+	replicative DNA helicase	Q38152	Bacillus_phage	2.1e-93	43.6
WP_095843404.1\|177256_177451_+	Fur-regulated basic protein FbpA	A0A1L2JY24	Aeribacillus_phage	5.5e-06	47.3
WP_010330157.1\|177551_177998_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	2.0e-51	68.3
WP_095843405.1\|177979_178675_+	hypothetical protein	NA	NA	NA	NA
WP_157761998.1\|178783_178978_+	hypothetical protein	NA	NA	NA	NA
WP_095843407.1\|179047_179251_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	6.4e-05	29.7
WP_095843408.1\|179344_179863_+	hypothetical protein	NA	NA	NA	NA
WP_095843409.1\|179886_180417_+	ImmA/IrrE family metallo-endopeptidase	A0A090D850	Clostridium_phage	3.2e-32	43.9
WP_095843410.1\|180424_181858_+	NUDIX hydrolase	A0A090DBU6	Clostridium_phage	4.8e-46	29.2
WP_095843411.1\|181928_182315_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	1.9e-29	57.9
WP_095843412.1\|182369_182915_+	hypothetical protein	NA	NA	NA	NA
WP_172843755.1\|183451_183619_+	hypothetical protein	NA	NA	NA	NA
WP_095843413.1\|183713_184058_+	structural protein	Q38579	Bacillus_phage	6.3e-29	58.8
WP_095843414.1\|184126_184594_+	hypothetical protein	NA	NA	NA	NA
WP_019712756.1\|184649_185171_+	ParB N-terminal domain-containing protein	A0A1B1P7B5	Bacillus_phage	4.6e-55	60.2
WP_095843415.1\|185181_186201_+	DNA cytosine methyltransferase	A0A1B1P7C6	Bacillus_phage	2.7e-128	65.0
WP_086352723.1\|186338_186587_+	hypothetical protein	A8ATN7	Listeria_phage	2.1e-05	36.7
WP_095843416.1\|186703_187234_+	YfbU family protein	NA	NA	NA	NA
WP_095843417.1\|187321_188221_+\|terminase	terminase	A0A1B1P7C9	Bacillus_phage	5.9e-18	33.1
WP_095843418.1\|188217_189531_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.0e-155	63.4
WP_095843419.1\|189535_191068_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.4e-152	54.0
WP_095843420.1\|191064_191982_+\|head	phage head morphogenesis protein	A0A1B1P7D7	Bacillus_phage	1.8e-54	41.1
WP_095843421.1\|192044_193349_+	hypothetical protein	NA	NA	NA	NA
WP_014112399.1\|193374_194556_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	4.8e-84	51.1
WP_095843422.1\|194587_195523_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	4.9e-108	65.9
WP_010330132.1\|195533_195851_+	hypothetical protein	NA	NA	NA	NA
WP_010330131.1\|195856_196249_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.2e-13	36.2
WP_095843423.1\|196245_196608_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_095843424.1\|196604_197108_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	4.1e-37	46.9
WP_095843425.1\|197120_197558_+\|portal	phage portal protein	NA	NA	NA	NA
WP_095843426.1\|197554_197746_+	hypothetical protein	NA	NA	NA	NA
WP_095843427.1\|197746_199147_+\|tail	phage tail sheath subtilisin-like domain-containing protein	S5MNC1	Brevibacillus_phage	9.7e-76	39.6
WP_010330125.1\|199148_199592_+\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	1.3e-26	46.8
WP_095843428.1\|200194_200644_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.3e-10	36.6
WP_095843429.1\|200825_206162_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.7e-43	46.3
WP_095843430.1\|206154_206814_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	5.6e-26	35.2
WP_017696791.1\|206826_207807_+	hypothetical protein	H7BV96	unidentified_phage	3.2e-41	32.6
WP_095843431.1\|207803_208070_+	DUF2577 family protein	NA	NA	NA	NA
WP_095843432.1\|208082_208508_+	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	7.3e-11	33.3
WP_095843433.1\|208500_209547_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	2.0e-70	42.9
WP_095843434.1\|209530_210109_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	4.3e-14	33.1
WP_095843435.1\|210105_210378_+	hypothetical protein	NA	NA	NA	NA
WP_095843436.1\|210381_212136_+\|terminase	terminase	A0A1P8CWR7	Bacillus_phage	1.8e-23	39.6
WP_095843437.1\|212145_212481_+\|portal	phage portal protein	NA	NA	NA	NA
WP_087961660.1\|212477_212642_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.5e-15	67.9
WP_095843438.1\|212733_213627_+\|portal	phage portal protein	NA	NA	NA	NA
WP_017696800.1\|213694_213973_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.5e-25	66.3
WP_095843439.1\|213988_214252_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.0e-26	70.1
WP_095843440.1\|214303_215278_+	N-acetylmuramoyl-L-alanine amidase	D6QWL5	uncultured_phage	6.5e-63	70.1
WP_095843441.1\|215315_215756_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_095843442.1\|215768_217589_-	HNH endonuclease	A0A1P8CWI7	Bacillus_phage	6.8e-122	47.6
WP_087961655.1\|217799_218933_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	2.8e-89	48.8
WP_164907155.1\|218922_219081_+	hypothetical protein	NA	NA	NA	NA
WP_087961654.1\|219112_219445_-	YolD-like family protein	O64030	Bacillus_phage	5.0e-15	44.1
220201:220248	attR	NA	NA	NA	NA

DBSCAN-SWA_2

740125 : 748491

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233955.1\|740125_741421_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_014479060.1\|741494_742220_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003219409.1\|742212_742467_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003243954.1\|742463_743147_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003233949.1\|743130_745359_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
WP_003233947.1\|745334_746765_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_003233945.1\|746866_747907_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
WP_015252651.1\|747903_748491_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_3

1250952 : 1343327

106

Bacillus_phage(38.46%)

tRNA,integrase,coat,transposase

attL 1316230:1316289|attR 1321013:1321111

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232972.1\|1250952_1251192_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|1251356_1252295_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|1252317_1253559_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_095843629.1\|1253633_1254419_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|1254610_1255597_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_014476428.1\|1255593_1256583_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	8.8e-07	26.1
WP_017695680.1\|1256670_1258302_+	peptide-binding protein	NA	NA	NA	NA
WP_003245828.1\|1258377_1259328_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_003232961.1\|1259344_1260256_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|1260461_1261214_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_026113648.1\|1261247_1262240_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003232957.1\|1262983_1264621_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_003245554.1\|1264728_1265664_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|1265667_1266585_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_015252358.1\|1266589_1267666_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|1267667_1268585_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_095843630.1\|1268690_1269908_+	MFS transporter	NA	NA	NA	NA
WP_003224597.1\|1270071_1270650_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014476435.1\|1270830_1271226_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003232944.1\|1271480_1272137_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|1272306_1272447_+	hypothetical protein	NA	NA	NA	NA
WP_003232942.1\|1272413_1273070_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|1273064_1273187_-	hypothetical protein	NA	NA	NA	NA
WP_017695683.1\|1273230_1274382_+	competence protein CoiA	NA	NA	NA	NA
WP_171518460.1\|1274611_1276441_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|1276478_1276646_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|1276960_1277860_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|1277856_1278255_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_080031064.1\|1278506_1279052_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	4.8e-39	61.0
WP_015252351.1\|1279255_1279828_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_095843631.1\|1279952_1280321_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|1280349_1280985_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|1281003_1281804_+	NAD kinase	NA	NA	NA	NA
WP_017695686.1\|1281818_1282718_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_015383361.1\|1282730_1283465_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	2.5e-06	25.2
WP_017695687.1\|1283699_1285544_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_003232909.1\|1285792_1286503_+	thiaminase II	NA	NA	NA	NA
WP_095843632.1\|1286477_1287095_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_041344286.1\|1287078_1288188_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072173897.1\|1288187_1288388_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_095843633.1\|1288384_1289155_+	thiazole synthase	NA	NA	NA	NA
WP_017695692.1\|1289151_1290162_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_017695693.1\|1290180_1290996_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|1291131_1291908_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_080265338.1\|1292008_1292692_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_003244982.1\|1292784_1293231_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_003239243.1\|1293358_1293847_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003244668.1\|1293998_1294517_-\|coat	spore coat protein CotX	NA	NA	NA	NA
WP_003245818.1\|1294617_1294935_-\|coat	spore coat protein CotW	NA	NA	NA	NA
WP_003244871.1\|1294976_1295363_-\|coat	spore coat protein CotV	NA	NA	NA	NA
WP_003232879.1\|1295522_1295879_+	sporulation protein YjcA	NA	NA	NA	NA
WP_017695696.1\|1296160_1296367_+	hypothetical protein	NA	NA	NA	NA
WP_003232872.1\|1296448_1296598_+	sporulation protein YjcZ	NA	NA	NA	NA
WP_003232870.1\|1296730_1296985_+	sporulation-specific transcription regulator SopVIF	NA	NA	NA	NA
WP_017695697.1\|1297058_1299338_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	3.5e-91	34.9
WP_003232866.1\|1299454_1299709_+	hypothetical protein	NA	NA	NA	NA
WP_017695698.1\|1299781_1300204_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003232861.1\|1300207_1300723_-	2'-5' RNA ligase family protein	NA	NA	NA	NA
WP_029726266.1\|1300759_1301482_-	esterase family protein	NA	NA	NA	NA
WP_026113650.1\|1301837_1302959_+	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	6.2e-17	26.3
WP_021479530.1\|1302951_1304124_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_015252328.1\|1304156_1304702_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_041336656.1\|1304771_1305962_-	DUF819 domain-containing protein	NA	NA	NA	NA
WP_041336658.1\|1306351_1306654_-	hypothetical protein	NA	NA	NA	NA
WP_041351540.1\|1306990_1307281_-	hypothetical protein	NA	NA	NA	NA
WP_041351543.1\|1307686_1307896_+	hypothetical protein	NA	NA	NA	NA
WP_041351546.1\|1308003_1308294_+	hypothetical protein	NA	NA	NA	NA
WP_041351548.1\|1308383_1309004_+	hypothetical protein	NA	NA	NA	NA
WP_041351552.1\|1310894_1311278_+	hypothetical protein	NA	NA	NA	NA
WP_052478204.1\|1311296_1312463_+	hypothetical protein	NA	NA	NA	NA
WP_041351553.1\|1312526_1312754_-	hypothetical protein	NA	NA	NA	NA
WP_014479904.1\|1313060_1313378_+\|transposase	transposase	NA	NA	NA	NA
WP_095843634.1\|1313566_1314217_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_172843758.1\|1314376_1314523_-	PhrK family phosphatase-inhibitory pheromone	NA	NA	NA	NA
WP_014479904.1\|1315001_1315319_+\|transposase	transposase	NA	NA	NA	NA
WP_095843636.1\|1315507_1316047_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_095843637.1\|1316058_1316229_+\|transposase	IS3 family transposase	NA	NA	NA	NA
1316230:1316289	attL	NA	NA	NA	NA
WP_041351555.1\|1317390_1319157_+	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	4.0e-127	55.0
WP_041351557.1\|1319170_1319635_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_095843638.1\|1320385_1321012_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_157761999.1\|1321092_1321455_-	DUF2513 domain-containing protein	NA	NA	NA	NA
1321013:1321111	attR	NA	NA	NA	NA
WP_017697622.1\|1321820_1322045_-	hypothetical protein	NA	NA	NA	NA
WP_041351656.1\|1322085_1322367_-	hypothetical protein	NA	NA	NA	NA
WP_041351654.1\|1322414_1322642_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041351652.1\|1322823_1323138_+	hypothetical protein	NA	NA	NA	NA
WP_041351650.1\|1323152_1323545_+	hypothetical protein	NA	NA	NA	NA
WP_162985483.1\|1324497_1324662_+	hypothetical protein	A0A1P8CX58	Bacillus_phage	8.7e-13	75.6
WP_095843640.1\|1325673_1325859_+	super-infection exclusion protein B	NA	NA	NA	NA
WP_095843641.1\|1325923_1326241_+\|transposase	transposase	NA	NA	NA	NA
WP_157762008.1\|1326237_1327152_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
WP_157762000.1\|1327268_1327625_+	super-infection exclusion protein B	NA	NA	NA	NA
WP_014476481.1\|1328805_1329321_-	hypothetical protein	NA	NA	NA	NA
WP_017697614.1\|1330059_1330359_-	hypothetical protein	NA	NA	NA	NA
WP_015252322.1\|1330796_1331114_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_021479515.1\|1331352_1332108_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_041335706.1\|1332255_1332603_-	Ig-like domain-containing protein	NA	NA	NA	NA
WP_095843644.1\|1333164_1335111_+	mannose transport/utilization transcriptional regulator ManR	NA	NA	NA	NA
WP_041335712.1\|1335258_1337199_+	PTS mannose transporter subunit IIABC	NA	NA	NA	NA
WP_041335714.1\|1337213_1338161_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_010886487.1\|1338324_1338807_+	YjdF family protein	NA	NA	NA	NA
WP_017697545.1\|1338848_1339355_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017697546.1\|1340187_1340667_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_003232825.1\|1340706_1340901_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_003232822.1\|1341028_1341358_-	YjdJ family protein	NA	NA	NA	NA
WP_171518357.1\|1341965_1342967_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_015715704.1\|1343078_1343327_-\|coat	spore coat protein CotT	NA	NA	NA	NA

DBSCAN-SWA_4

1376914 : 1410915

uncultured_Caudovirales_phage(29.41%)

portal,terminase,plate,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245490.1\|1376914_1378186_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_010886491.1\|1378330_1379467_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.4
WP_003245487.1\|1379456_1379591_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_003232731.1\|1379621_1379879_-	YciI family protein	NA	NA	NA	NA
WP_003244876.1\|1379999_1380953_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	7.3e-67	74.1
WP_003245254.1\|1380992_1381370_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	6.1e-17	42.3
WP_041344770.1\|1381475_1382078_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
WP_041333900.1\|1382154_1382991_+	manganese catalase family protein	NA	NA	NA	NA
WP_015715727.1\|1383034_1383631_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_017695142.1\|1383793_1384135_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.5e-19	46.6
WP_015715728.1\|1384313_1384493_+	hypothetical protein	NA	NA	NA	NA
WP_003245799.1\|1384479_1385316_+	phage-like element PBSX protein XkdB	S6BFM4	Thermus_phage	1.8e-24	28.2
WP_015252287.1\|1385215_1386016_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
WP_003245588.1\|1386015_1386183_+	hypothetical protein	NA	NA	NA	NA
WP_003245290.1\|1386267_1386618_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_003244900.1\|1386614_1386821_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	50.0
WP_017695139.1\|1386936_1387446_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.1e-21	38.6
WP_015715733.1\|1387562_1388360_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	1.9e-60	51.5
WP_095843648.1\|1388356_1389658_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.4e-153	60.2
WP_003245427.1\|1389661_1391149_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_003245836.1\|1391168_1391996_+	phage-like element PBSX protein XkdF	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
WP_003232690.1\|1392021_1392957_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_029317668.1\|1392978_1393362_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.1e-13	39.6
WP_041351209.1\|1393358_1393715_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_041351210.1\|1393711_1394197_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	6.2e-38	47.0
WP_041351211.1\|1394209_1394650_+	hypothetical protein	NA	NA	NA	NA
WP_003232679.1\|1394653_1394872_+	hypothetical protein	NA	NA	NA	NA
WP_003245369.1\|1394868_1396269_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
WP_003239114.1\|1396270_1396714_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
WP_003232676.1\|1396804_1397251_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
WP_003239113.1\|1397280_1397430_+	hypothetical protein	NA	NA	NA	NA
WP_095843649.1\|1397431_1401313_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	9.3e-44	45.3
WP_003232674.1\|1401305_1401965_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
WP_003245730.1\|1401980_1402958_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|1402957_1403224_+	DUF2577 family protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_003232671.1\|1403280_1403706_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
WP_003232669.1\|1403698_1404745_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_003244743.1\|1404728_1405307_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.2
WP_003232665.1\|1405303_1405576_+	hypothetical protein	NA	NA	NA	NA
WP_095843650.1\|1405578_1408020_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	1.1e-21	35.2
WP_095843651.1\|1408037_1408364_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	4.4e-16	40.9
WP_015252267.1\|1408360_1408525_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.5e-15	66.0
WP_041351214.1\|1408571_1409411_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_041351215.1\|1409463_1409733_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	65.9
WP_041351216.1\|1409745_1410009_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	64.4
WP_095843652.1\|1410021_1410915_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	1.2e-82	68.3

DBSCAN-SWA_5

1866912 : 1909467

Bacillus_phage(46.15%)

tRNA,protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095843713.1\|1866912_1868442_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_003231834.1\|1868443_1868875_+	RicAFT regulatory complex protein RicA	NA	NA	NA	NA
WP_003231833.1\|1869136_1869682_+\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_041336021.1\|1869814_1872391_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	4.1e-40	27.5
WP_041336024.1\|1872406_1874290_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	7.6e-68	31.5
WP_026113607.1\|1874689_1875145_-	membrane protein	NA	NA	NA	NA
WP_017694906.1\|1875299_1875857_-	hypothetical protein	NA	NA	NA	NA
WP_017694907.1\|1875977_1876592_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_003231786.1\|1876730_1877087_-	hypothetical protein	NA	NA	NA	NA
WP_072557160.1\|1877165_1877990_-	hypothetical protein	NA	NA	NA	NA
WP_041336030.1\|1878099_1879428_-\|protease	serine protease AprX	A0A1B0T6A2	Bacillus_phage	1.6e-27	33.6
WP_014476869.1\|1879652_1879886_+	hypothetical protein	NA	NA	NA	NA
WP_003245758.1\|1880165_1880873_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_003231775.1\|1880942_1881395_+	OsmC family protein	NA	NA	NA	NA
WP_014479837.1\|1881408_1881762_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_009967307.1\|1881775_1882093_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_041336033.1\|1882227_1882506_-	hypothetical protein	NA	NA	NA	NA
WP_080031033.1\|1882594_1883008_+	hypothetical protein	NA	NA	NA	NA
WP_095843714.1\|1883107_1884052_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|1884091_1884313_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_014479841.1\|1884508_1884781_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|1884862_1885093_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|1885335_1885728_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|1885687_1887790_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|1887807_1888797_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|1888846_1889467_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_041336037.1\|1889530_1890298_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	5.3e-52	50.0
WP_003231746.1\|1890916_1891885_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_015483254.1\|1892017_1893280_+	GTPase HflX	NA	NA	NA	NA
WP_014479845.1\|1893297_1894563_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|1894672_1895080_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_031600540.1\|1895138_1896473_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_095010668.1\|1896582_1896708_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_015483256.1\|1896746_1897046_-	hypothetical protein	NA	NA	NA	NA
WP_017697662.1\|1897099_1897408_-	hypothetical protein	NA	NA	NA	NA
WP_017697663.1\|1897428_1899312_-	EndoU domain-containing protein	A0A1P8CWI7	Bacillus_phage	5.2e-125	61.3
WP_033881290.1\|1900403_1900694_+	hypothetical protein	NA	NA	NA	NA
WP_014479885.1\|1900932_1901424_+	hypothetical protein	NA	NA	NA	NA
WP_014479887.1\|1902754_1903006_+	hypothetical protein	NA	NA	NA	NA
WP_072592598.1\|1903189_1903624_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_041351960.1\|1905012_1905549_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157762008.1\|1905654_1906569_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
WP_095843641.1\|1906565_1906883_-\|transposase	transposase	NA	NA	NA	NA
WP_033880480.1\|1908238_1909153_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
WP_014479904.1\|1909149_1909467_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2006500 : 2083322

Bacillus_phage(52.38%)

integrase,transposase

attL 2068536:2068595|attR 2074472:2074693

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043857582.1\|2006500_2007046_-\|integrase	site-specific integrase	A0A1B0T6D2	Bacillus_phage	4.6e-42	51.4
WP_003231472.1\|2007363_2007594_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_024573328.1\|2007778_2009542_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_014479972.1\|2010489_2011971_-	glutamate synthase small subunit	NA	NA	NA	NA
WP_095843729.1\|2011987_2016550_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_004399246.1\|2016696_2017599_+	glutamate biosynthesis transcriptional regulator GltC	NA	NA	NA	NA
WP_024571767.1\|2017649_2018765_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.6e-68	41.4
WP_080031110.1\|2018761_2019655_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.0e-30	32.7
WP_003220337.1\|2019802_2020171_-	replication termination protein	A0A0K2CP62	Brevibacillus_phage	9.2e-18	41.8
WP_014479980.1\|2020469_2021186_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	9.7e-48	78.0
WP_017697324.1\|2021336_2021645_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_095843730.1\|2021711_2022482_+	hypothetical protein	NA	NA	NA	NA
WP_047182706.1\|2022525_2023059_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095843731.1\|2023137_2024382_-	MFS transporter	NA	NA	NA	NA
WP_095843732.1\|2024475_2025939_-	sugar kinase	NA	NA	NA	NA
WP_095843733.1\|2025956_2026979_-	2-hydroxyacid dehydrogenase	M1NSB9	Streptococcus_phage	1.9e-25	28.8
WP_095843734.1\|2027314_2029357_+	molybdopterin oxidoreductase family protein	NA	NA	NA	NA
WP_003241898.1\|2029466_2029787_+	hypothetical protein	NA	NA	NA	NA
WP_157762010.1\|2029864_2031301_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_095843736.1\|2031358_2032525_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_095843737.1\|2032542_2033472_-	TIM barrel protein	NA	NA	NA	NA
WP_172843762.1\|2033954_2034950_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-27	31.4
WP_014477000.1\|2035640_2035763_+	hypothetical protein	NA	NA	NA	NA
WP_041335460.1\|2035806_2036100_+	YozQ family protein	NA	NA	NA	NA
WP_095843739.1\|2036214_2037900_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-13	46.0
WP_095843740.1\|2038225_2039677_+	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
WP_041052907.1\|2039713_2040412_-	expansin ExlX	NA	NA	NA	NA
WP_004399503.1\|2040681_2041359_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_095843741.1\|2041531_2042569_+	polysaccharide lyase family 1 protein	NA	NA	NA	NA
WP_095843742.1\|2042824_2043508_+	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	1.7e-65	83.8
WP_095844137.1\|2045689_2046172_-	DUF4944 domain-containing protein	NA	NA	NA	NA
WP_141556150.1\|2046196_2046352_-	hypothetical protein	NA	NA	NA	NA
WP_095843743.1\|2046877_2047375_-	hypothetical protein	NA	NA	NA	NA
WP_095843744.1\|2047476_2048388_-	VanW family protein	NA	NA	NA	NA
WP_033883967.1\|2049225_2049480_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095843745.1\|2050486_2051359_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_095843746.1\|2051459_2052338_+	DMT family transporter	NA	NA	NA	NA
WP_095843747.1\|2052496_2052928_-	hypothetical protein	NA	NA	NA	NA
WP_095843748.1\|2054592_2055234_-	glutamine amidotransferase	NA	NA	NA	NA
WP_095843749.1\|2055504_2056425_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.2e-58	43.9
WP_046663317.1\|2056873_2057227_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_095843751.1\|2057911_2058175_+	hypothetical protein	NA	NA	NA	NA
WP_095843752.1\|2058532_2061133_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.1e-44	35.2
WP_095843753.1\|2061807_2062449_-	endo-1,4-beta-xylanase XynA	NA	NA	NA	NA
WP_014477028.1\|2063077_2063317_-	TM2 domain-containing protein	M4ZS56	Bacillus_phage	1.4e-19	67.1
WP_095843755.1\|2063849_2065448_-	hypothetical protein	NA	NA	NA	NA
WP_095843756.1\|2065553_2066063_-	MepB family protein	NA	NA	NA	NA
WP_095843757.1\|2066169_2066538_-	hypothetical protein	NA	NA	NA	NA
WP_095843758.1\|2067062_2067764_-	hypothetical protein	NA	NA	NA	NA
2068536:2068595	attL	NA	NA	NA	NA
WP_157762005.1\|2068758_2069115_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_095843760.1\|2069077_2069356_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_014479904.1\|2069544_2069862_-\|transposase	transposase	NA	NA	NA	NA
WP_095843761.1\|2071296_2072418_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	9.7e-95	49.2
WP_014479904.1\|2073206_2073524_+\|transposase	transposase	NA	NA	NA	NA
WP_033880480.1\|2073520_2074435_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
WP_043857661.1\|2076564_2076924_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	1.7e-61	99.2
2074472:2074693	attR	NA	NA	NA	NA
WP_134819451.1\|2077183_2077267_+	hypothetical protein	NA	NA	NA	NA
WP_014479996.1\|2077555_2078089_-	GNAT family N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
WP_014479997.1\|2078148_2078703_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
WP_014479998.1\|2078758_2079217_-	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
WP_095843762.1\|2079229_2081116_-	HNH endonuclease	A0A1P8CWI7	Bacillus_phage	2.1e-158	80.4
WP_141556159.1\|2081215_2081773_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	2.0e-101	95.7
WP_141556158.1\|2081900_2083322_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.0e-07	32.1

DBSCAN-SWA_7

2297799 : 2303895

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223904.1\|2297799_2298393_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_015714192.1\|2298382_2299138_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.4e-09	25.8
WP_041053269.1\|2299418_2299943_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|2299956_2300331_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_041053270.1\|2300443_2300908_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.6e-43	59.3
WP_003230496.1\|2300940_2302137_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.3e-115	54.9
WP_014480161.1\|2302151_2302799_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_004398763.1\|2302809_2303895_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_8

2652466 : 2705927

uncultured_Mediterranean_phage(14.29%)

tRNA,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229725.1\|2652466_2653612_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|2653638_2654667_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_095843862.1\|2654696_2654897_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003229718.1\|2654889_2655894_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_003229717.1\|2655904_2656510_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003229715.1\|2656648_2657161_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_003246197.1\|2657208_2658516_-	MFS transporter	NA	NA	NA	NA
WP_041339258.1\|2658586_2659612_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_003229707.1\|2660532_2660655_-	hypothetical protein	NA	NA	NA	NA
WP_161792531.1\|2660760_2661186_+	DUF5412 domain-containing protein	NA	NA	NA	NA
WP_017696343.1\|2661192_2661333_+	hypothetical protein	NA	NA	NA	NA
WP_017696342.1\|2661496_2662951_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_041339264.1\|2662990_2663713_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_017696340.1\|2663816_2664413_-	spore germination protein SgpA	NA	NA	NA	NA
WP_095843863.1\|2664560_2665724_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_017696338.1\|2665840_2666947_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_017696337.1\|2666933_2667803_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_017696336.1\|2667756_2669352_-	L-aspartate oxidase	NA	NA	NA	NA
WP_017696335.1\|2669454_2670642_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	8.6e-33	27.4
WP_017696334.1\|2670601_2671144_+	transcription repressor NadR	NA	NA	NA	NA
WP_004398512.1\|2671168_2672026_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|2672042_2672486_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_017696333.1\|2672546_2673833_-	GTPase ObgE	NA	NA	NA	NA
WP_004399131.1\|2673866_2674445_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_129093560.1\|2674500_2674644_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|2674764_2675049_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|2675061_2675400_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|2675402_2675711_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_014480452.1\|2675857_2676724_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_017696330.1\|2676716_2677511_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_014664846.1\|2677659_2678466_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_017696329.1\|2678467_2679148_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|2679200_2679719_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_009967915.1\|2679715_2680588_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|2680618_2681632_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_003246034.1\|2681723_2682419_-	DNA repair protein RadC	NA	NA	NA	NA
WP_004398496.1\|2682455_2683025_-	septum formation protein Maf	NA	NA	NA	NA
WP_095843864.1\|2683177_2684176_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_072592551.1\|2684309_2685056_-	prepilin peptidase	NA	NA	NA	NA
WP_041339279.1\|2685196_2686489_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_095843865.1\|2686548_2689191_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	1.1e-160	42.5
WP_003222590.1\|2689638_2689830_+	hypothetical protein	NA	NA	NA	NA
WP_041336242.1\|2689848_2690874_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_095843866.1\|2690906_2692634_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_015384279.1\|2692764_2694057_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_015483525.1\|2694086_2695061_-	porphobilinogen synthase	NA	NA	NA	NA
WP_021480246.1\|2695057_2695846_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_021480247.1\|2695835_2696780_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|2696812_2697643_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_004399038.1\|2697650_2699018_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_041052471.1\|2699246_2699744_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|2699765_2700353_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003229618.1\|2700349_2702674_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
WP_041052472.1\|2702854_2704513_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|2704664_2705927_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_9

3295117 : 3306325

Organic_Lake_phycodnavirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015714710.1\|3295117_3295798_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_095843943.1\|3295814_3296735_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095843944.1\|3296746_3297400_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_095843945.1\|3297416_3298562_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.0e-14	32.2
WP_014478002.1\|3298845_3299379_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_095843947.1\|3300083_3301055_+	sporulation-delaying protein SdpB	NA	NA	NA	NA
WP_003243360.1\|3301097_3301709_+	sporulation delaying protein SdpC	NA	NA	NA	NA
WP_003228357.1\|3301755_3302379_-	immunity protein SdpI	NA	NA	NA	NA
WP_003243541.1\|3302375_3302648_-	sporulation delaying system autorepressor SdpR	NA	NA	NA	NA
WP_003244403.1\|3302868_3303558_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_095844146.1\|3303575_3304487_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228349.1\|3304506_3305160_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|3305182_3306325_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_10

3658384 : 3743902

Bacillus_phage(22.22%)

transposase,tRNA,bacteriocin,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017696002.1\|3658384_3658549_+\|transposase	transposase	NA	NA	NA	NA
WP_157762006.1\|3659176_3659386_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.7e-05	46.2
WP_080320312.1\|3660085_3660541_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.1e-19	40.3
WP_003227612.1\|3660596_3662204_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-153	52.1
WP_095844014.1\|3662445_3662967_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_014481201.1\|3663149_3664289_-	acyl-CoA dehydrogenase AcdA	NA	NA	NA	NA
WP_014481202.1\|3664285_3666403_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_041334673.1\|3666557_3667754_+	cardiolipin synthase	NA	NA	NA	NA
WP_095844015.1\|3667766_3668729_+	UV DNA damage repair endonuclease UvsE	A0A127AW32	Bacillus_phage	1.7e-39	34.2
WP_003227597.1\|3668809_3669082_+	hypothetical protein	NA	NA	NA	NA
WP_042975469.1\|3669123_3669648_-	dihydrofolate reductase	NA	NA	NA	NA
WP_095844016.1\|3669657_3671385_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.2e-60	31.2
WP_095844017.1\|3671473_3672976_-	cardiolipin synthase	NA	NA	NA	NA
WP_003227587.1\|3673500_3674172_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_095844018.1\|3674168_3674723_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_041850416.1\|3674748_3676212_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	3.2e-21	43.6
WP_095844019.1\|3676201_3679888_-	nitrate reductase subunit alpha	NA	NA	NA	NA
WP_003243032.1\|3680078_3680555_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_014481214.1\|3680698_3681418_+	YwiC-like family protein	NA	NA	NA	NA
WP_003227573.1\|3681449_3682166_-	fumarate/nitrate reduction transcriptional regulator Fnr	NA	NA	NA	NA
WP_010886631.1\|3682264_3683452_-	nitrate transporter NarK	NA	NA	NA	NA
WP_041334658.1\|3683587_3685258_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003243604.1\|3685254_3685683_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3685995_3686127_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|3686083_3686236_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_041334655.1\|3686260_3687607_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_041334652.1\|3687619_3687781_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_003227564.1\|3687777_3688497_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
WP_095844020.1\|3688489_3689800_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_095844150.1\|3689789_3690950_+	insulinase family protein	NA	NA	NA	NA
WP_095844021.1\|3690954_3692235_+	insulinase family protein	NA	NA	NA	NA
WP_095844022.1\|3692231_3692933_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_095844023.1\|3692938_3694315_-	YncE family protein	NA	NA	NA	NA
WP_095844024.1\|3694353_3695709_-	YncE family protein	NA	NA	NA	NA
WP_095844025.1\|3695938_3697084_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.1e-83	44.8
WP_014665774.1\|3697067_3697187_+	PhrC/PhrF family phosphatase-inhibitory pheromone	NA	NA	NA	NA
WP_095844026.1\|3697782_3698655_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|3698715_3699546_-	spermidine synthase	NA	NA	NA	NA
WP_095844027.1\|3699748_3701824_+	penicillin-binding protein	NA	NA	NA	NA
WP_015714898.1\|3702116_3702635_-	YwhD family protein	NA	NA	NA	NA
WP_003243167.1\|3702648_3703308_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3703416_3703605_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_003242889.1\|3703647_3704067_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_095844028.1\|3704186_3706103_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.7e-142	43.2
WP_069703980.1\|3706939_3708349_-	MFS transporter	NA	NA	NA	NA
WP_017696247.1\|3708348_3708819_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|3708930_3709431_-	YwgA family protein	NA	NA	NA	NA
WP_003243873.1\|3709466_3710768_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|3710929_3711154_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_095844029.1\|3711369_3712149_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	3.8e-05	28.4
WP_095844030.1\|3712292_3713183_-	DMT family transporter	NA	NA	NA	NA
WP_095844031.1\|3713350_3714196_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_088272553.1\|3714244_3715144_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_017696241.1\|3715289_3716261_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_121549190.1\|3716536_3717301_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_095844032.1\|3718214_3719414_-	transaminase BacF	NA	NA	NA	NA
WP_080529927.1\|3719414_3720599_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_038427999.1\|3720595_3722014_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_041334816.1\|3722032_3722794_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
WP_009968341.1\|3723480_3724095_-	prephenate decarboxylase	NA	NA	NA	NA
WP_095844033.1\|3724246_3725485_-	MFS transporter	NA	NA	NA	NA
WP_015250969.1\|3725693_3727106_-	amino acid permease	NA	NA	NA	NA
WP_095844034.1\|3727105_3728806_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_095844035.1\|3728879_3730427_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_095844036.1\|3730653_3731928_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_095844037.1\|3732105_3732570_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_014481242.1\|3732894_3733350_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	NA	NA	NA	NA
WP_069837836.1\|3733342_3734194_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.3
WP_095844038.1\|3734207_3735155_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.8e-72	43.8
WP_017696230.1\|3735154_3735895_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	7.7e-48	42.0
WP_017696229.1\|3735919_3736939_-\|coat	spore coat protein	NA	NA	NA	NA
WP_017696228.1\|3736941_3737664_-\|coat	spore coat protein	NA	NA	NA	NA
WP_095844039.1\|3737656_3738778_-	N-acetylneuraminate synthase family protein	NA	NA	NA	NA
WP_095844040.1\|3738777_3739647_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095844041.1\|3739647_3740817_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	4.2e-16	26.9
WP_095844042.1\|3740837_3742262_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_015250957.1\|3742266_3743037_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_014481253.1\|3743356_3743902_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

DBSCAN-SWA_11

3834350 : 3870439

uncultured_virus(25.0%)

integrase,protease,transposase

attL 3837138:3837153|attR 3877318:3877333

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095844068.1\|3834350_3836039_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_095844069.1\|3836096_3836294_+	hypothetical protein	NA	NA	NA	NA
WP_017697235.1\|3836307_3837147_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
3837138:3837153	attL	NA	NA	NA	NA
WP_003242648.1\|3837253_3838351_-	maltodextrin ABC transporter ATP-binding protein MsmX	G9BWD6	Planktothrix_phage	2.4e-21	31.2
WP_019712848.1\|3838471_3839365_-	PucR family transcriptional regulator	NA	NA	NA	NA
WP_095844070.1\|3839548_3841006_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003242615.1\|3841047_3841884_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.0e-40	33.6
WP_120028571.1\|3842454_3842997_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_003244356.1\|3843071_3844091_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	8.5e-98	51.4
WP_029726184.1\|3844318_3844792_+	DUF1453 family protein	NA	NA	NA	NA
WP_095844071.1\|3844809_3846030_+	two-component system sensor histidine kinase YxjM	NA	NA	NA	NA
WP_095844072.1\|3846016_3846673_+	two-component system response regulator YxJL	NA	NA	NA	NA
WP_003244314.1\|3846722_3847955_+	peptidase T	NA	NA	NA	NA
WP_095844073.1\|3848480_3848735_+	hypothetical protein	NA	NA	NA	NA
WP_014481330.1\|3848863_3849352_+	LURP-one-related family protein	NA	NA	NA	NA
WP_014481331.1\|3849605_3850739_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	3.6e-89	46.2
WP_046664015.1\|3850991_3852128_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	5.2e-88	45.8
WP_017697224.1\|3852961_3853612_-	CoA transferase subunit B	NA	NA	NA	NA
WP_014481335.1\|3853608_3854325_-	succinyl-CoA--3-ketoacid CoA transferase subunit A	NA	NA	NA	NA
WP_041338353.1\|3854348_3855767_-	GntP family permease	NA	NA	NA	NA
WP_041338355.1\|3855920_3856769_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_017695658.1\|3857958_3859452_-	cardiolipin synthase	NA	NA	NA	NA
WP_095844074.1\|3860428_3861289_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_009336483.1\|3861318_3861525_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_041332738.1\|3861536_3861887_-	stage V sporulation protein AE	NA	NA	NA	NA
WP_013352386.1\|3861883_3862903_-	stage V sporulation protein AD	NA	NA	NA	NA
WP_013352385.1\|3862902_3863382_-	stage V sporulation protein AC	NA	NA	NA	NA
WP_009336487.1\|3863399_3863873_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_013352384.1\|3863955_3864162_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_017697721.1\|3865128_3865344_-	YuzF family protein	NA	NA	NA	NA
WP_000226102.1\|3865751_3866204_-	hypothetical protein	NA	NA	NA	NA
WP_095844075.1\|3867078_3867612_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_095844076.1\|3867556_3867802_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_095843641.1\|3867989_3868307_-\|transposase	transposase	NA	NA	NA	NA
WP_017697717.1\|3868594_3868897_-	N-acetylmuramoyl-L-alanine amidase	A0A142F1B8	Bacillus_phage	7.8e-15	50.7
WP_017697718.1\|3869258_3869735_+	hypothetical protein	NA	NA	NA	NA
WP_080480857.1\|3869722_3870055_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.6e-27	54.7
WP_095844077.1\|3870094_3870439_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.2e-15	49.4
3877318:3877333	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP023257

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection