CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009929	Burkholderia mallei strain FMH chromosome 1, complete sequence	0 crisprs	csa3,DEDDh,DinG,WYL,cas3	0	0	10	0
NZ_CP009930	Burkholderia mallei strain FMH chromosome 2, complete sequence	1 crisprs	cas3,csa3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

92202 : 156299

Leptospira_phage(12.5%)

protease,portal,tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191998.1\|92202_93666_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004189319.1\|93771_94095_-	DUF1840 domain-containing protein	NA	NA	NA	NA
WP_004189649.1\|94297_96082_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_004197747.1\|96160_97009_+	cell division protein	NA	NA	NA	NA
WP_004190112.1\|97060_97699_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_004190175.1\|97715_98495_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_004203497.1\|98647_99361_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_004536310.1\|99600_100068_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_004190133.1\|100578_102165_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004189357.1\|102398_104045_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	1.5e-19	26.1
WP_004189449.1\|104339_105419_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_004189604.1\|105480_105717_-	hypothetical protein	NA	NA	NA	NA
WP_004525974.1\|105708_107520_+	bifunctional isocitrate dehydrogenase kinase/phosphatase	NA	NA	NA	NA
WP_004189176.1\|107577_108348_+	carbonate dehydratase	NA	NA	NA	NA
WP_004190136.1\|108334_109528_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_004189135.1\|109558_110242_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	9.7e-05	30.7
WP_004188900.1\|110273_110726_+	YchJ family protein	NA	NA	NA	NA
WP_004189232.1\|112794_114141_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	NA	NA	NA	NA
WP_004189736.1\|114137_115322_+	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	3.9e-17	24.1
WP_004189380.1\|115318_116041_+	dethiobiotin synthase	NA	NA	NA	NA
WP_004189222.1\|116104_117124_+	biotin synthase BioB	NA	NA	NA	NA
WP_004190017.1\|117250_117964_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_080516936.1\|118342_119155_-	hypothetical protein	NA	NA	NA	NA
WP_004189785.1\|119184_120588_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_024900437.1\|120620_122060_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_004205137.1\|122350_122731_-	hypothetical protein	NA	NA	NA	NA
WP_004189763.1\|123187_123703_-	hypothetical protein	NA	NA	NA	NA
WP_038802950.1\|123724_124845_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004197759.1\|125222_125777_+	YaeQ family protein	NA	NA	NA	NA
WP_004197761.1\|125976_126393_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_004190110.1\|126794_127889_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	3.8e-19	37.4
WP_004200726.1\|127885_128827_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004204797.1\|128998_130600_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_004189592.1\|130618_132067_-	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	4.9e-30	33.5
WP_011203779.1\|132063_132315_-	hypothetical protein	NA	NA	NA	NA
WP_004189689.1\|132330_132879_-	hypothetical protein	NA	NA	NA	NA
WP_004189874.1\|133471_134041_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_004189434.1\|134143_135112_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004201742.1\|135254_136349_+	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004190014.1\|136377_137490_+	histone deacetylase	A0A2K9KZC4	Tupanvirus	3.2e-37	30.8
WP_004189258.1\|137500_138376_+	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	9.6e-74	47.3
WP_011203781.1\|138582_138747_+	hypothetical protein	NA	NA	NA	NA
WP_004188948.1\|139399_140413_+\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	1.3e-194	99.4
WP_004188977.1\|140485_140770_-	hypothetical protein	NA	NA	NA	NA
WP_004200731.1\|140766_141249_-	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_096325434.1\|141300_142421_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004187628.1\|142601_143822_-\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	7.8e-239	99.5
WP_004200732.1\|144212_144617_+	PaaI family thioesterase	NA	NA	NA	NA
WP_004189208.1\|144654_145524_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_004188904.1\|145644_146661_-	D-2-hydroxyacid dehydrogenase family protein	NA	NA	NA	NA
WP_004189230.1\|147110_148166_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004200734.1\|148387_150997_-	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	7.7e-18	25.7
WP_004190199.1\|151207_151579_-	thioredoxin family protein	NA	NA	NA	NA
WP_004190020.1\|151638_152829_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.0e-21	39.2
WP_004201745.1\|153057_153561_+	peptide deformylase	A0A067XQZ3	Caulobacter_phage	2.7e-12	34.3
WP_004200737.1\|153592_154576_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-07	38.0
WP_004189288.1\|154696_155332_+	LysE family translocator	NA	NA	NA	NA
WP_004189409.1\|155441_156299_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA

DBSCAN-SWA_2

438545 : 447375

Tanapox_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190087.1\|438545_439388_+	alpha/beta hydrolase	A7XCB7	Tanapox_virus	7.2e-18	27.2
WP_004188957.1\|439730_440654_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_085962730.1\|440781_442128_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004532363.1\|442353_443256_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.9e-53	39.9
WP_004204273.1\|443267_443567_-	hypothetical protein	NA	NA	NA	NA
WP_004189725.1\|443579_443897_-	competence protein ComE	NA	NA	NA	NA
WP_004190173.1\|443968_444961_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004200795.1\|445019_446006_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	8.8e-15	26.5
WP_004189214.1\|445974_447375_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.1e-78	38.3

DBSCAN-SWA_3

465233 : 527548

Leptospira_phage(27.27%)

integrase,transposase

attL 465186:465245|attR 528214:529450

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
465186:465245	attL	NA	NA	NA	NA
WP_038802950.1\|465233_466354_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004200808.1\|467728_468415_+	phospholipid methyltransferase	NA	NA	NA	NA
WP_004189371.1\|468595_468859_-	hypothetical protein	NA	NA	NA	NA
WP_004195993.1\|468960_470067_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004189882.1\|470197_470671_+	formate dehydrogenase subunit gamma	NA	NA	NA	NA
WP_004189204.1\|470667_472233_+	formate dehydrogenase beta subunit	NA	NA	NA	NA
WP_004195994.1\|472247_475202_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_004190152.1\|475209_475470_+	formate dehydrogenase subunit delta	NA	NA	NA	NA
WP_004200810.1\|475845_477462_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_011203819.1\|477609_479490_+	tetratricopeptide repeat protein	F2Y1J7	Organic_Lake_phycodnavirus	1.7e-11	32.2
WP_004188918.1\|479878_481174_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.2e-65	37.5
WP_073699190.1\|481227_481452_-	hypothetical protein	NA	NA	NA	NA
WP_011203820.1\|481662_482733_-	gamma-glutamyl-gamma-aminobutyrate hydrolase	NA	NA	NA	NA
WP_011203821.1\|482865_483603_+	hypothetical protein	NA	NA	NA	NA
WP_004550105.1\|483599_484976_+	amidase	NA	NA	NA	NA
WP_004189653.1\|485084_485594_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_011203822.1\|485757_486108_-	hypothetical protein	NA	NA	NA	NA
WP_004189595.1\|486102_487125_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.1e-44	37.8
WP_004189005.1\|487166_488192_+	adenosine deaminase	NA	NA	NA	NA
WP_004189169.1\|488279_489656_+	NCS2 family permease	NA	NA	NA	NA
WP_004189962.1\|489681_490992_+	guanine deaminase	NA	NA	NA	NA
WP_004189253.1\|491072_491483_+	hypothetical protein	NA	NA	NA	NA
WP_004189913.1\|491479_492052_+	TMEM165/GDT1 family protein	NA	NA	NA	NA
WP_004189569.1\|492385_493099_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_004189242.1\|493157_493295_-	hypothetical protein	NA	NA	NA	NA
WP_004189239.1\|493319_496022_+	aminopeptidase N	NA	NA	NA	NA
WP_004189599.1\|496369_498664_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_004189234.1\|498780_499713_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004189384.1\|499842_500859_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	5.4e-52	36.4
WP_004186184.1\|501206_502427_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	6.6e-238	99.0
WP_004190100.1\|502768_503029_+	hypothetical protein	NA	NA	NA	NA
WP_004197792.1\|503051_503528_+	hypothetical protein	NA	NA	NA	NA
WP_004550102.1\|503696_503945_+	hypothetical protein	NA	NA	NA	NA
WP_011205188.1\|504602_504950_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_004189798.1\|505236_505725_-	hypothetical protein	NA	NA	NA	NA
WP_004554214.1\|505721_506993_-	exo-alpha-sialidase	NA	NA	NA	NA
WP_004188913.1\|506980_509317_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011203824.1\|509463_509940_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_011203825.1\|510465_511059_+	chorismate mutase	NA	NA	NA	NA
WP_004557196.1\|511055_511268_-	hypothetical protein	NA	NA	NA	NA
WP_038802950.1\|511620_512741_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004189780.1\|512955_513534_-	pseudouridine synthase	NA	NA	NA	NA
WP_004189552.1\|513801_515061_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189626.1\|515033_515216_-	hypothetical protein	NA	NA	NA	NA
WP_004189292.1\|515228_516839_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_004191998.1\|516997_518461_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004189917.1\|521299_522010_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004197804.1\|522580_522775_+	hypothetical protein	NA	NA	NA	NA
WP_004190145.1\|522962_523469_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_004189867.1\|523947_525342_-	class II fumarate hydratase	NA	NA	NA	NA
WP_011203828.1\|525344_525530_+	hypothetical protein	NA	NA	NA	NA
WP_038802950.1\|525725_526846_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004189968.1\|526876_527548_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.3e-46	46.1
528214:529450	attR	NA	NA	NA	NA

DBSCAN-SWA_4

786195 : 794127

Bacillus_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192968.1\|786195_787536_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	37.7
WP_038802950.1\|788000_789121_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004198608.1\|790118_791606_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	8.7e-59	33.0
WP_004193459.1\|792140_792473_+	YnfA family protein	A0A218MNG8	uncultured_virus	2.0e-24	57.6
WP_004531112.1\|792900_793623_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-39	40.0
WP_004193456.1\|793680_794127_-	ribonuclease HI	J9Q745	Salmonella_phage	1.2e-43	53.1

DBSCAN-SWA_5

889787 : 913619

uncultured_Caudovirales_phage(50.0%)

plate,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192127.1\|889787_891638_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004193292.1\|891665_893081_-	hypothetical protein	NA	NA	NA	NA
WP_004193592.1\|893104_893371_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_004192367.1\|893630_893858_-	hypothetical protein	NA	NA	NA	NA
WP_004196687.1\|893891_896699_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	4.0e-28	25.1
WP_004192570.1\|896701_897535_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_038802950.1\|897768_898889_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004193365.1\|898983_899376_+	hypothetical protein	NA	NA	NA	NA
WP_004193170.1\|899635_900949_+	divalent metal cation transporter	NA	NA	NA	NA
WP_011203888.1\|900997_901174_+	hypothetical protein	NA	NA	NA	NA
WP_011203889.1\|901465_901720_-	hypothetical protein	NA	NA	NA	NA
WP_004552605.1\|901804_902113_+	lipoprotein	NA	NA	NA	NA
WP_004193855.1\|902365_902647_-	H-NS histone family protein	NA	NA	NA	NA
WP_009937836.1\|902646_902907_-	hypothetical protein	NA	NA	NA	NA
WP_004192394.1\|903114_904107_-	amidohydrolase family protein	NA	NA	NA	NA
WP_004196700.1\|904151_905348_-	MFS transporter	NA	NA	NA	NA
WP_009920897.1\|905503_905641_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|905854_906748_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004531175.1\|907085_907307_+	hypothetical protein	NA	NA	NA	NA
WP_004542449.1\|907392_907578_+	hypothetical protein	NA	NA	NA	NA
WP_004192149.1\|907564_908110_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|908162_908723_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004526783.1\|908799_909324_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191504.1\|909341_910181_+	molecular chaperone	NA	NA	NA	NA
WP_004196717.1\|912653_913619_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_6

1065700 : 1128187

Leptospira_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190171.1\|1065700_1066921_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	1.0e-238	99.3
WP_009942176.1\|1067112_1067421_+	hypothetical protein	NA	NA	NA	NA
WP_009973369.1\|1067403_1067580_-	hypothetical protein	NA	NA	NA	NA
WP_004191349.1\|1068657_1069428_+	molecular chaperone	NA	NA	NA	NA
WP_004204691.1\|1069434_1071987_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_073699456.1\|1071983_1072949_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_011203909.1\|1073791_1073977_+	hypothetical protein	NA	NA	NA	NA
WP_004197781.1\|1074120_1077159_+	membrane protein	NA	NA	NA	NA
WP_011203910.1\|1077166_1077415_+	hypothetical protein	NA	NA	NA	NA
WP_073699454.1\|1077875_1078058_-	hypothetical protein	NA	NA	NA	NA
WP_080549337.1\|1078514_1079000_+	hypothetical protein	NA	NA	NA	NA
WP_004193126.1\|1079297_1079963_+	response regulator transcription factor	NA	NA	NA	NA
WP_004191146.1\|1079962_1080109_+	hypothetical protein	NA	NA	NA	NA
WP_011203911.1\|1081136_1081475_-	hypothetical protein	NA	NA	NA	NA
WP_004192661.1\|1081553_1083926_-	penicillin acylase family protein	NA	NA	NA	NA
WP_004197788.1\|1084050_1085226_-	carbamoyltransferase	E3SL71	Synechococcus_phage	1.8e-46	35.9
WP_038802950.1\|1085313_1086433_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004191362.1\|1086939_1088493_+	collagen-like triple helix repeat-containing protein	NA	NA	NA	NA
WP_004192734.1\|1088542_1089808_+	collagen-like triple helix repeat-containing protein	NA	NA	NA	NA
WP_011203914.1\|1089958_1091638_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_009920703.1\|1091762_1091894_+	hypothetical protein	NA	NA	NA	NA
WP_004193599.1\|1091881_1092343_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004191720.1\|1092579_1092990_-\|transposase	transposase	NA	NA	NA	NA
WP_004526858.1\|1092961_1093180_-	hypothetical protein	NA	NA	NA	NA
WP_004550551.1\|1093184_1094282_-	cell division protein ZapE	NA	NA	NA	NA
WP_004191219.1\|1094388_1095819_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-42	27.8
WP_004192735.1\|1095918_1097193_-	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_004191889.1\|1097320_1100185_-	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_004193111.1\|1100523_1102350_-	translational GTPase TypA	NA	NA	NA	NA
WP_009930591.1\|1102346_1102502_-	hypothetical protein	NA	NA	NA	NA
WP_004192835.1\|1102642_1103140_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_004191557.1\|1103239_1104736_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192058.1\|1104803_1106039_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004193982.1\|1106061_1107621_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011203915.1\|1107891_1108827_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_004199441.1\|1108853_1109222_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_004197388.1\|1109327_1112255_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	5.2e-23	25.3
WP_004193517.1\|1112346_1113822_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_004193908.1\|1113818_1114280_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_004191876.1\|1114584_1116249_-	pseudouridine synthase	NA	NA	NA	NA
WP_004192767.1\|1116312_1117641_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.3e-23	35.1
WP_004193481.1\|1118059_1118962_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.5e-10	23.6
WP_004550556.1\|1119155_1119353_-	hypothetical protein	NA	NA	NA	NA
WP_004199443.1\|1119380_1119782_+\|transposase	transposase	NA	NA	NA	NA
WP_009920735.1\|1119801_1119903_+	hypothetical protein	NA	NA	NA	NA
WP_004521676.1\|1119987_1120245_+	hypothetical protein	NA	NA	NA	NA
WP_004199444.1\|1120403_1120721_-	hypothetical protein	NA	NA	NA	NA
WP_004192638.1\|1120921_1121644_+	YdcF family protein	NA	NA	NA	NA
WP_004192834.1\|1121882_1122161_+	hypothetical protein	NA	NA	NA	NA
WP_004191628.1\|1122309_1122567_+	hypothetical protein	NA	NA	NA	NA
WP_004193694.1\|1122616_1122907_-	hypothetical protein	NA	NA	NA	NA
WP_096325460.1\|1123306_1124427_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004197405.1\|1125246_1126473_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_038802950.1\|1127067_1128187_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_7

2309033 : 2364524

Leptospira_phage(18.75%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038802333.1\|2309033_2310153_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004550771.1\|2310415_2310937_-	hypothetical protein	NA	NA	NA	NA
WP_004191998.1\|2311205_2312669_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004186453.1\|2312791_2313772_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_004186190.1\|2313774_2314230_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_004185928.1\|2314368_2315205_+	JAB domain-containing protein	NA	NA	NA	NA
WP_004186391.1\|2315498_2315732_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_004185395.1\|2315749_2315917_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_004554550.1\|2316039_2317686_+	L-aspartate oxidase	NA	NA	NA	NA
WP_004197485.1\|2317657_2317876_-	hypothetical protein	NA	NA	NA	NA
WP_004185611.1\|2317877_2318762_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_004185886.1\|2318758_2319895_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_004186237.1\|2320063_2321260_-	aminotransferase	NA	NA	NA	NA
WP_004186398.1\|2321456_2322809_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_004186079.1\|2322820_2324083_-	RsmB/NOP family class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_004185746.1\|2324079_2324742_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-25	40.0
WP_004535897.1\|2324866_2325859_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_004185348.1\|2325970_2328808_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.6e-80	26.0
WP_004186086.1\|2328807_2329308_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_004186216.1\|2329369_2330581_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.0e-41	31.9
WP_004186718.1\|2330644_2331091_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	7.9e-48	64.4
WP_004185819.1\|2331179_2331962_-	membrane protein	NA	NA	NA	NA
WP_004185697.1\|2332126_2332873_-	hypothetical protein	NA	NA	NA	NA
WP_038802950.1\|2333112_2334233_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_071810810.1\|2334420_2334639_+	hypothetical protein	NA	NA	NA	NA
WP_004185496.1\|2334836_2335346_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|2335646_2337761_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7
WP_009936593.1\|2338042_2338249_+	hypothetical protein	NA	NA	NA	NA
WP_004186292.1\|2338209_2338863_-	hypothetical protein	NA	NA	NA	NA
WP_004186341.1\|2341015_2341861_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.4e-23	29.9
WP_004185897.1\|2342029_2342776_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004197492.1\|2343491_2344853_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004185818.1\|2345392_2346832_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011204107.1\|2346839_2347448_+	hypothetical protein	NA	NA	NA	NA
WP_004200476.1\|2347474_2348749_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004185918.1\|2348880_2349486_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011204108.1\|2349769_2349931_-	hypothetical protein	NA	NA	NA	NA
WP_004186428.1\|2350009_2351032_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_004185585.1\|2351047_2351575_-	DUF962 domain-containing protein	NA	NA	NA	NA
WP_004185910.1\|2351659_2352415_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_004186611.1\|2352648_2353854_+	chromate efflux transporter	NA	NA	NA	NA
WP_096325460.1\|2353942_2355063_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004185841.1\|2356125_2356704_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-44	44.7
WP_004197496.1\|2356900_2358283_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	6.1e-30	27.5
WP_004200482.1\|2358277_2358508_+	hypothetical protein	NA	NA	NA	NA
WP_004555967.1\|2358740_2359769_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_004196455.1\|2359749_2359956_+	Trm112 family protein	NA	NA	NA	NA
WP_004185994.1\|2360129_2360921_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_009929233.1\|2360941_2361139_+	hypothetical protein	NA	NA	NA	NA
WP_004185840.1\|2361129_2361792_+	adenylate kinase	NA	NA	NA	NA
WP_004191998.1\|2361906_2363370_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004196460.1\|2363473_2363677_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_004194131.1\|2364209_2364524_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6

DBSCAN-SWA_8

2414670 : 2423907

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194112.1\|2414670_2416218_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2
WP_004194373.1\|2416254_2416782_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004194274.1\|2416778_2417462_+	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.6e-05	26.0
WP_004194137.1\|2417526_2418342_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004194350.1\|2418517_2420524_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	9.7e-53	35.0
WP_004194374.1\|2420557_2421688_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	2.9e-22	27.6
WP_004194034.1\|2421954_2423907_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2

DBSCAN-SWA_9

2736935 : 2791264

Burkholderia_phage(16.67%)

protease,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198091.1\|2736935_2738156_-\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	2.3e-238	99.3
WP_004198364.1\|2738309_2742548_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.3e-72	27.9
WP_004198365.1\|2742569_2746676_-	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	4.6e-25	21.4
WP_004198366.1\|2747039_2747414_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_004199864.1\|2747477_2747975_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_004185135.1\|2748272_2748971_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_004198368.1\|2748971_2749403_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_004198369.1\|2749548_2750106_-	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_004185179.1\|2750107_2750488_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_004198356.1\|2750665_2751856_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	27.9
WP_096325434.1\|2752806_2753926_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004199869.1\|2754131_2754251_-	hypothetical protein	NA	NA	NA	NA
WP_004198375.1\|2754330_2755467_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_004198376.1\|2755463_2755805_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_004198377.1\|2756532_2758182_+	GMC family oxidoreductase	A0A1V0SI18	Klosneuvirus	2.0e-56	30.9
WP_004198379.1\|2758266_2759064_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.3e-12	28.8
WP_004198380.1\|2759109_2759919_+	hypothetical protein	NA	NA	NA	NA
WP_004198382.1\|2759929_2760322_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_004198383.1\|2760377_2761883_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_011204146.1\|2761879_2761972_+	hypothetical protein	NA	NA	NA	NA
WP_004197126.1\|2762099_2763359_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004197127.1\|2763363_2764242_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_004197128.1\|2764238_2765288_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_004197129.1\|2765284_2766007_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-07	25.5
WP_004538585.1\|2766379_2767111_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.6e-05	25.3
WP_004199873.1\|2767233_2768193_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004197133.1\|2768592_2769693_-	porin	NA	NA	NA	NA
WP_011204147.1\|2769844_2770147_-	hypothetical protein	NA	NA	NA	NA
WP_004197137.1\|2770230_2773260_-	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	2.2e-181	38.7
WP_004266287.1\|2773300_2775334_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	3.3e-85	33.5
WP_004197141.1\|2775570_2775753_-	hypothetical protein	NA	NA	NA	NA
WP_004549852.1\|2775788_2776916_-	porin	NA	NA	NA	NA
WP_004197150.1\|2777248_2777926_-	response regulator	NA	NA	NA	NA
WP_004197153.1\|2777936_2779316_-	sensor histidine kinase	NA	NA	NA	NA
WP_004199876.1\|2779393_2780251_-	ABC transporter permease	NA	NA	NA	NA
WP_004199877.1\|2780269_2781067_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	35.3
WP_004199878.1\|2781150_2782164_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004199879.1\|2782321_2782843_-	DUF2938 domain-containing protein	NA	NA	NA	NA
WP_004199880.1\|2782835_2783711_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004199881.1\|2783792_2784221_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004201278.1\|2784540_2785323_-	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_004199882.1\|2785441_2785714_-	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_038802950.1\|2786338_2787459_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_076835668.1\|2788239_2788563_+	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	4.1e-54	97.2
WP_004202809.1\|2788565_2788922_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_004199886.1\|2788965_2790021_-\|portal	phage portal protein	K4NZV0	Burkholderia_phage	5.7e-206	99.4
WP_004199888.1\|2790017_2790515_-\|terminase	terminase	K4NXI4	Burkholderia_phage	2.6e-55	100.0
WP_004539219.1\|2790736_2791264_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.0e-21	51.0

DBSCAN-SWA_10

2879853 : 2926749

Streptococcus_phage(28.57%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191998.1\|2879853_2881317_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004196837.1\|2881423_2881627_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.3e-21	73.1
WP_038802950.1\|2881946_2883066_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_011204166.1\|2883177_2883309_-	hypothetical protein	NA	NA	NA	NA
WP_004196846.1\|2883292_2883490_-	hypothetical protein	NA	NA	NA	NA
WP_004196848.1\|2883512_2884919_+	amino acid permease	NA	NA	NA	NA
WP_004551036.1\|2885232_2885568_-	c-type cytochrome	NA	NA	NA	NA
WP_004196853.1\|2885594_2886395_-	BON domain-containing protein	NA	NA	NA	NA
WP_004196857.1\|2886413_2886992_-	SIS domain-containing protein	NA	NA	NA	NA
WP_011204167.1\|2887114_2887597_-	YraN family protein	NA	NA	NA	NA
WP_004196861.1\|2887595_2888483_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_004191998.1\|2888577_2890041_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004198058.1\|2890250_2891513_-	Hsp70 family protein	NA	NA	NA	NA
WP_004198059.1\|2892110_2892716_-	nitroreductase family protein	NA	NA	NA	NA
WP_004198060.1\|2892677_2893253_+	hypothetical protein	NA	NA	NA	NA
WP_004198061.1\|2893212_2894496_-	MFS transporter	NA	NA	NA	NA
WP_004198062.1\|2894654_2895299_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011204168.1\|2895289_2895640_+	hypothetical protein	NA	NA	NA	NA
WP_004198063.1\|2895636_2896260_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_004198065.1\|2896344_2897241_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004198067.1\|2897368_2898505_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011204169.1\|2898501_2898717_-	hypothetical protein	NA	NA	NA	NA
WP_004185303.1\|2898861_2899980_-	acyltransferase	NA	NA	NA	NA
WP_004199981.1\|2899978_2900389_+	hypothetical protein	NA	NA	NA	NA
WP_011204170.1\|2900382_2900925_-	hypothetical protein	NA	NA	NA	NA
WP_009922408.1\|2901356_2901452_-	hypothetical protein	NA	NA	NA	NA
WP_004204896.1\|2901490_2903656_+	peptidase	A0A0P0IY26	Acinetobacter_phage	1.9e-46	27.1
WP_071893038.1\|2904237_2904636_+	hypothetical protein	NA	NA	NA	NA
WP_011205259.1\|2904678_2904948_+	hypothetical protein	NA	NA	NA	NA
WP_004204906.1\|2905050_2905281_+	hypothetical protein	NA	NA	NA	NA
WP_012729786.1\|2905514_2905871_-	hypothetical protein	NA	NA	NA	NA
WP_004199991.1\|2905896_2907165_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004199993.1\|2907179_2909441_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	4.2e-36	27.7
WP_004199995.1\|2909437_2910886_+	TolC family protein	NA	NA	NA	NA
WP_004199997.1\|2911096_2912053_-	hypothetical protein	NA	NA	NA	NA
WP_004527832.1\|2912064_2913030_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_011204174.1\|2913047_2913326_+	hypothetical protein	NA	NA	NA	NA
WP_004200001.1\|2913301_2917195_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004200003.1\|2917191_2918181_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_004185296.1\|2918185_2919118_+	OmpA family protein	NA	NA	NA	NA
WP_004200005.1\|2919316_2920438_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004200009.1\|2920527_2923221_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	9.5e-88	31.5
WP_004200010.1\|2923254_2924355_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_080549347.1\|2924318_2926145_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_011205263.1\|2926236_2926749_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009930

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009930_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009930_1

2198921-2199013

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009930_1

>merge|NZ_CP009930|1|2198921-2199013|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP009930|1|1|2198921-2199013|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009930.1\|WP_004187423.1\|2202984_2203242_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009930.1\|WP_004188438.1\|2200475_2200967_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP009930.1\|WP_004198322.1\|2193807_2194311_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009930.1\|WP_004188525.1\|2187681_2188806_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP009930.1\|WP_004198321.1\|2194387_2195413_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP009930.1\|WP_044302747.1\|2191134_2192739_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP009930.1\|WP_004187376.1\|2188955_2190791_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP009930.1\|WP_004188073.1\|2201408_2203013_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP009930.1\|WP_011204278.1\|2205150_2206581_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP009930.1\|WP_004201694.1\|2200174_2200483_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP009930.1\|WP_004188303.1\|2195627_2196476_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP009930.1\|WP_004187346.1\|2199476_2200178_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP009930.1\|WP_004188458.1\|2206577_2207756_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP009930.1\|WP_004198323.1\|2190884_2191043_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009930.1\|WP_004188840.1\|2203373_2205167_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|213656
NZ_CP009930.1\|WP_004188221.1\|2200963_2201419_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057
NZ_CP009930.1\|WP_004187158.1\|2193240_2193750_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009930.1\|WP_004188355.1\|2196472_2198485_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP009930.1\|WP_004188377.1\|2184463_2187679_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009930.1\|WP_004187193.1\|2199231_2199480_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067

Protein	Function_ID	Function_description	E-value
NZ_CP009930.1\|WP_004188840.1\|2203373_2205167_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	6.3979e-179
NZ_CP009930.1\|WP_004188073.1\|2201408_2203013_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP009930.1\|WP_004188525.1\|2187681_2188806_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	6.54035e-26
NZ_CP009930.1\|WP_004198321.1\|2194387_2195413_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP009930.1\|WP_044302747.1\|2191134_2192739_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.56608e-79
NZ_CP009930.1\|WP_004187376.1\|2188955_2190791_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	2.51413e-132
NZ_CP009930.1\|WP_011204278.1\|2205150_2206581_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP009930.1\|WP_004201694.1\|2200174_2200483_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	3.23546e-10
NZ_CP009930.1\|WP_004188303.1\|2195627_2196476_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	1.10329e-32
NZ_CP009930.1\|WP_004187346.1\|2199476_2200178_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP009930.1\|WP_004188458.1\|2206577_2207756_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP009930.1\|WP_004188438.1\|2200475_2200967_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	7.77353e-17
NZ_CP009930.1\|WP_004188221.1\|2200963_2201419_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63
NZ_CP009930.1\|WP_004188355.1\|2196472_2198485_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP009930.1\|WP_004188377.1\|2184463_2187679_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.59115e-92
NZ_CP009930.1\|WP_004187193.1\|2199231_2199480_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37

>NZ_CP009930.1|WP_004188355.1|2196472_2198485_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPIAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGTLDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVSREVSHEADRDAAADAARVAGRAPGRAEPDRAVPRAMPDGPPRAQADGDRASASRPPPDARGDAARTAPSPQGGADANVNADANVDAEAEARHKR
>NZ_CP009930.1|WP_004188303.1|2195627_2196476_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGETAAGARAAPRARFVVVLCSEQGFVGAYNAQLIEHATRPGPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP009930.1|WP_004198321.1|2194387_2195413_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP009930.1|WP_004198322.1|2193807_2194311_-|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREAGAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDTHLGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP009930.1|WP_004187158.1|2193240_2193750_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAADGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVSTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP009930.1|WP_044302747.1|2191134_2192739_-|methyl-accepting-chemotaxis-protein
MAPFHRRTTRNARTPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP009930.1|WP_004198323.1|2190884_2191043_+|hypothetical-protein
MRARRSHGAGIRLGFDKPSGTHSSPHDGWVQTDIAMRLPQISLMPDQALANE
>NZ_CP009930.1|WP_004187376.1|2188955_2190791_+|response-regulator
MHVEVFAQHPSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLDPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP009930.1|WP_004188525.1|2187681_2188806_+|ABC-transporter-permease
MRRLAIIYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP009930.1|WP_004188377.1|2184463_2187679_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQEAQGGAGERPGAGERAAGESVAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSEVASEAGLAASAESGSERGVAHGAERAREPAADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHELYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP009930.1|WP_004187193.1|2199231_2199480_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP009930.1|WP_004187346.1|2199476_2200178_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP009930.1|WP_004201694.1|2200174_2200483_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFAAGACHFVSLGWNSRLFVAGRAGVALALQFARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP009930.1|WP_004188438.1|2200475_2200967_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREARDDAARGDARHAGAGAAPDDPRGAARRDPSPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP009930.1|WP_004188221.1|2200963_2201419_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP009930.1|WP_004188073.1|2201408_2203013_-|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAVCAERDASDVGDVSDVGDARDEGAGRVVAVRGAVVDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVRATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPLLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVFVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASGAGPGTTSDPASGSAEPQGARHGR
>NZ_CP009930.1|WP_004187423.1|2202984_2203242_+|hypothetical-protein
MPFVACGSATVAPVWLVRRWLHHNGARRPPADLGQETGNRQTKRGIAQSETIDASASGADKVRAASIVDSNQIPQTYAWLQWPCQ
>NZ_CP009930.1|WP_004188840.1|2203373_2205167_+|alpha/beta-fold-hydrolase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASITLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP009930.1|WP_011204278.1|2205150_2206581_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MCSRNKECRVDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGTRLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP009930.1|WP_004188458.1|2206577_2207756_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRHVRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLSVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1225633 : 1289506

Leptospira_phage(40.0%)

integrase,transposase,protease

attL 1225565:1225624|attR 1260541:1261777

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1225565:1225624	attL	NA	NA	NA	NA
WP_038802950.1\|1225633_1226753_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004199610.1\|1226775_1227933_+	DUF746 domain-containing protein	NA	NA	NA	NA
WP_011204482.1\|1228294_1228750_+	hypothetical protein	NA	NA	NA	NA
WP_004197697.1\|1228840_1230538_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_004197696.1\|1230611_1231292_-	1,6-didemethyltoxoflavin N1-methyltransferase	NA	NA	NA	NA
WP_004197695.1\|1231288_1232986_-	WD40 repeat domain-containing protein	NA	NA	NA	NA
WP_004539149.1\|1232982_1233627_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.2e-34	44.6
WP_011204481.1\|1233645_1233960_-	hypothetical protein	NA	NA	NA	NA
WP_004266238.1\|1233956_1235495_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004199160.1\|1235629_1238731_-	MMPL family transporter	S5VTK5	Leptospira_phage	3.6e-46	22.0
WP_004184876.1\|1238727_1239825_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004199157.1\|1239975_1240647_+	transcriptional regulator	NA	NA	NA	NA
WP_011204480.1\|1240777_1242544_-	amidohydrolase family protein	NA	NA	NA	NA
WP_011204479.1\|1242668_1243301_-	hypothetical protein	NA	NA	NA	NA
WP_004199606.1\|1243916_1245917_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	1.1e-104	46.2
WP_004197883.1\|1246041_1246650_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_004184790.1\|1246949_1248305_-	amino acid permease	NA	NA	NA	NA
WP_004197880.1\|1248572_1249058_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_004197879.1\|1249384_1249873_+	membrane protein	NA	NA	NA	NA
WP_004205924.1\|1249860_1250091_-	hypothetical protein	NA	NA	NA	NA
WP_004524134.1\|1250525_1250666_+	bacteriophage protein	NA	NA	NA	NA
WP_004197875.1\|1251063_1251348_+	hypothetical protein	NA	NA	NA	NA
WP_004197874.1\|1251364_1251550_+	hypothetical protein	NA	NA	NA	NA
WP_133307164.1\|1251610_1252969_+	TolC family protein	NA	NA	NA	NA
WP_004197872.1\|1252979_1254449_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004197870.1\|1254494_1257728_+	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_004197868.1\|1257734_1258424_+	heavy metal response regulator transcription factor IrlR	W8CYM9	Bacillus_phage	1.7e-36	36.8
WP_004184766.1\|1258420_1259815_+	heavy metal sensor histidine kinase IrlS	W8CYF6	Bacillus_phage	1.2e-20	28.9
WP_004197866.1\|1259927_1260200_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004539130.1\|1260192_1260393_+	hypothetical protein	NA	NA	NA	NA
WP_038802950.1\|1260609_1261729_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_011204475.1\|1261774_1264426_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
1260541:1261777	attR	NA	NA	NA	NA
WP_004197861.1\|1264346_1273748_-	hybrid non-ribosomal peptide synthetase/type I polyketide synthase	A0A2K9KZV5	Tupanvirus	5.5e-82	21.3
WP_004184597.1\|1273797_1274601_-	2OG-Fe dioxygenase family protein	NA	NA	NA	NA
WP_004551759.1\|1275035_1275356_-	acyl carrier protein	NA	NA	NA	NA
WP_004184547.1\|1275336_1277130_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_004184602.1\|1277126_1278887_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_011857806.1\|1278883_1280716_-	fatty acyl-AMP ligase	NA	NA	NA	NA
WP_011204474.1\|1280811_1280928_+	hypothetical protein	NA	NA	NA	NA
WP_009934344.1\|1281033_1281282_+	hypothetical protein	NA	NA	NA	NA
WP_004184214.1\|1281311_1281836_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_009934348.1\|1282173_1282500_-	hypothetical protein	NA	NA	NA	NA
WP_011204473.1\|1282474_1282615_-	hypothetical protein	NA	NA	NA	NA
WP_004536930.1\|1282613_1283204_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.8e-22	39.4
WP_076802790.1\|1283333_1284410_+	DMT family transporter	NA	NA	NA	NA
WP_076841794.1\|1284513_1284957_-	metal transporter	NA	NA	NA	NA
WP_004184355.1\|1285126_1286425_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004184552.1\|1286503_1287220_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_038802950.1\|1288385_1289506_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_2

1387314 : 1429952

Leptospira_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038802950.1\|1387314_1388435_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004199591.1\|1388792_1389380_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_004187839.1\|1389422_1390892_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_004188051.1\|1390911_1392609_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.2e-48	29.0
WP_154218748.1\|1392917_1393220_-	DNA polymerase III subunit gamma/tau	NA	NA	NA	NA
WP_009934481.1\|1393493_1393664_-	hypothetical protein	NA	NA	NA	NA
WP_004198884.1\|1393688_1397066_+	hypothetical protein	NA	NA	NA	NA
WP_004188750.1\|1397290_1398727_+	MFS transporter	NA	NA	NA	NA
WP_004188253.1\|1398807_1400286_-	PAS domain-containing protein	NA	NA	NA	NA
WP_004188466.1\|1400282_1400735_-	response regulator	NA	NA	NA	NA
WP_009934486.1\|1400738_1402910_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	4.9e-18	25.2
WP_004188566.1\|1403497_1403983_-	peroxiredoxin	NA	NA	NA	NA
WP_004188126.1\|1404021_1404954_-	2-hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	1.9e-19	32.1
WP_011204450.1\|1405170_1405557_-	hypothetical protein	NA	NA	NA	NA
WP_004188475.1\|1405713_1406145_+	DUF3761 domain-containing protein	NA	NA	NA	NA
WP_004187451.1\|1406258_1406555_-	hypothetical protein	NA	NA	NA	NA
WP_004188047.1\|1406506_1406722_-	hypothetical protein	NA	NA	NA	NA
WP_004198135.1\|1406718_1406901_-	hypothetical protein	NA	NA	NA	NA
WP_004187926.1\|1406922_1407126_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.7e-19	67.2
WP_009934491.1\|1407161_1407431_-	hypothetical protein	NA	NA	NA	NA
WP_011204448.1\|1407435_1407807_+	hypothetical protein	NA	NA	NA	NA
WP_004202502.1\|1407778_1407991_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_009925642.1\|1407888_1408128_-	hypothetical protein	NA	NA	NA	NA
WP_011204447.1\|1408108_1408648_-	hypothetical protein	NA	NA	NA	NA
WP_004188502.1\|1408628_1409090_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_038802950.1\|1412511_1413631_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_038802950.1\|1414459_1415580_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004199588.1\|1415725_1416136_-	heme-binding protein	NA	NA	NA	NA
WP_004198129.1\|1416195_1417596_-	4Fe-4S binding protein	NA	NA	NA	NA
WP_004198128.1\|1417592_1418435_-	iron transporter OFeT family	NA	NA	NA	NA
WP_004198127.1\|1418494_1418824_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_004266710.1\|1418883_1419435_-	membrane protein	NA	NA	NA	NA
WP_004199587.1\|1419658_1421749_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_004198124.1\|1422036_1423236_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_004191998.1\|1423379_1424843_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_011204445.1\|1424887_1425022_-	hypothetical protein	NA	NA	NA	NA
WP_004204588.1\|1425047_1425836_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_004198121.1\|1426023_1426995_+	NADP-dependent aryl-alcohol dehydrogenase	NA	NA	NA	NA
WP_004198120.1\|1427143_1427989_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_011204443.1\|1428001_1428328_-	hypothetical protein	NA	NA	NA	NA
WP_011204222.1\|1428488_1429952_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	2.0e-79	38.3

DBSCAN-SWA_3

1883394 : 1924691

Leptospira_phage(28.57%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190851.1\|1883394_1884384_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004196180.1\|1884380_1886243_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190879.1\|1886256_1886688_-	GPW/gp25 family protein	NA	NA	NA	NA
WP_004196178.1\|1886767_1887295_-	type VI secretion protein	NA	NA	NA	NA
WP_004530038.1\|1887438_1888950_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_038802950.1\|1889483_1890603_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004196172.1\|1892035_1893295_-	ABC transporter permease	NA	NA	NA	NA
WP_004190781.1\|1893395_1894442_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004190757.1\|1894516_1895617_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-24	31.5
WP_004196166.1\|1895734_1897255_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_004190433.1\|1897356_1898391_-	lipase secretion chaperone	NA	NA	NA	NA
WP_004196164.1\|1898435_1899461_-	triacylglycerol lipase	NA	NA	NA	NA
WP_004190808.1\|1899811_1902049_-	TonB-dependent copper receptor	NA	NA	NA	NA
WP_004190837.1\|1902136_1902532_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_004190603.1\|1902692_1903229_-	cytochrome b	NA	NA	NA	NA
WP_004190805.1\|1903497_1904133_+	hypothetical protein	NA	NA	NA	NA
WP_011204344.1\|1904263_1905028_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_011204343.1\|1905306_1905624_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011204342.1\|1906062_1906395_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004190614.1\|1906593_1908009_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	2.1e-41	30.2
WP_004190588.1\|1907997_1908141_+	hypothetical protein	NA	NA	NA	NA
WP_011204341.1\|1908464_1909079_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_004190245.1\|1909104_1910043_-	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	1.4e-14	25.3
WP_004190776.1\|1910039_1911464_-	cytosine permease	NA	NA	NA	NA
WP_011204340.1\|1911980_1912961_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_045589205.1\|1912973_1913735_+	acyltransferase family protein	NA	NA	NA	NA
WP_038802950.1\|1913634_1914754_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_011204338.1\|1914782_1915811_-	RHS repeat protein	NA	NA	NA	NA
WP_004196151.1\|1915770_1916424_-	hypothetical protein	NA	NA	NA	NA
WP_004203275.1\|1916498_1918703_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_004190714.1\|1918699_1921354_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.3e-78	30.8
WP_004196149.1\|1921332_1922823_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004190509.1\|1922819_1924691_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009929

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009930

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection