CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP014946	Variibacter gotjawalensis strain GJW-30	1 crisprs	WYL,csa3,DEDDh	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014946_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014946_1

1565632-1565721

Orphan

Consensus_repeat	Method
GCAACCGCGCGCGCGAAGTCGCGCGCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014946_1

>merge|NZ_AP014946|1|1565632-1565721|CRISPRCasFinder
GCAACCGCGCGCGCGAAGTCGCGCGCCTGATTGTGTCTCGGCAGTCCCACTATTCCAAGCCTGCAACCGCGCGCGCGAAGTCGCGCGCCT

>NZ_AP014946|1|1|1565632-1565721|CRISPRCasFinder
GCAACCGCGCGCGCGAAGTCGCGCGCCT	GATTGTGTCTCGGCAGTCCCACTATTCCAAGCCT
GCAACCGCGCGCGCGAAGTCGCGCGCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014946.1\|WP_096353741.1\|1569265_1570039_-\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_AP014946.1\|WP_130364795.1\|1567231_1567549_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_AP014946.1\|WP_096353739.1\|1568973_1569234_-\|glutaredoxin-3	unknown	unknown	gnl\|CDD\|239510
NZ_AP014946.1\|WP_096358709.1\|1555025_1556051_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_AP014946.1\|WP_096353717.1\|1560352_1561054_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184854
NZ_AP014946.1\|WP_096353733.1\|1566711_1567125_+\|thioesterase-family-protein	unknown	unknown	gnl\|CDD\|227783
NZ_AP014946.1\|WP_096353737.1\|1568088_1568970_-\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143596
NZ_AP014946.1\|WP_096353723.1\|1561846_1562665_-\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|131461
NZ_AP014946.1\|WP_096353729.1\|1564644_1565613_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
NZ_AP014946.1\|WP_096353714.1\|1557937_1560232_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_AP014946.1\|WP_096353735.1\|1567621_1568092_-\|DUF1178-family-protein	unknown	unknown	gnl\|CDD\|377685
NZ_AP014946.1\|WP_096353727.1\|1563381_1564644_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_AP014946.1\|WP_096353720.1\|1561050_1561683_-\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_AP014946.1\|WP_096353749.1\|1571574_1572093_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239535
NZ_AP014946.1\|WP_096353711.1\|1556837_1557812_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014946.1\|WP_096353725.1\|1562727_1563300_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_AP014946.1\|WP_096353746.1\|1571033_1571498_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_AP014946.1\|WP_096353708.1\|1556050_1556848_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_AP014946.1\|WP_096353743.1\|1570098_1570980_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273953
NZ_AP014946.1\|WP_096353752.1\|1572094_1572538_+\|DUF1801-domain-containing-protein	unknown	unknown	gnl\|CDD\|227936

Protein	Function_ID	Function_description	E-value
NZ_AP014946.1\|WP_096353741.1\|1569265_1570039_-\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	2.50741e-60
NZ_AP014946.1\|WP_096353723.1\|1561846_1562665_-\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|131461	TIGR02408, putative_L-proline_4-hydroxylase, ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.	2.0326e-50
NZ_AP014946.1\|WP_096353739.1\|1568973_1569234_-\|glutaredoxin-3	gnl\|CDD\|239510	cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including E. coli GRX1 and GRX3, which are members of this subfamily.	2.20488e-39
NZ_AP014946.1\|WP_096358709.1\|1555025_1556051_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	7.87032e-70
NZ_AP014946.1\|WP_096353717.1\|1560352_1561054_+\|hypothetical-protein	gnl\|CDD\|184854	PRK14852, PRK14852, hypothetical protein; Provisional.	3.44326e-05
NZ_AP014946.1\|WP_096353733.1\|1566711_1567125_+\|thioesterase-family-protein	gnl\|CDD\|227783	COG5496, COG5496, Predicted thioesterase [General function prediction only].	7.30325e-31
NZ_AP014946.1\|WP_096353737.1\|1568088_1568970_-\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143596	cd07572, nit, Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases). This subgroup includes mammalian Nit1 and Nit2, the Nit1-like domain of the invertebrate NitFhit, and various uncharacterized bacterial and archaeal Nit-like proteins. Nit1 and Nit2 are candidate tumor suppressor proteins. In NitFhit, the Nit1-like domain is encoded as a fusion protein with the non-homologous tumor suppressor, fragile histidine triad (Fhit). Mammalian Nit1 and Fhit may affect distinct signal pathways, and both may participate in DNA damage-induced apoptosis. Nit1 is a negative regulator in T cells. Overexpression of Nit2 in HeLa cells leads to a suppression of cell growth through cell cycle arrest in G2. These Nit proteins and the Nit1-like domain of NitFhit belong to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 10.	1.19582e-137
NZ_AP014946.1\|WP_130364795.1\|1567231_1567549_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	2.69568e-08
NZ_AP014946.1\|WP_096353729.1\|1564644_1565613_-\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.69984e-119
NZ_AP014946.1\|WP_096353714.1\|1557937_1560232_+\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	9.19101e-115
NZ_AP014946.1\|WP_096353735.1\|1567621_1568092_-\|DUF1178-family-protein	gnl\|CDD\|377685	pfam06676, DUF1178, Protein of unknown function (DUF1178). This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.	6.44406e-76
NZ_AP014946.1\|WP_096353727.1\|1563381_1564644_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.47913e-77
NZ_AP014946.1\|WP_096353720.1\|1561050_1561683_-\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	4.38741e-37
NZ_AP014946.1\|WP_096353749.1\|1571574_1572093_+\|MaoC-family-dehydratase	gnl\|CDD\|239535	cd03451, FkbR2, FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2 has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. The function of FkbR2 is unknown.	3.04899e-84
NZ_AP014946.1\|WP_096353725.1\|1562727_1563300_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.39626e-12
NZ_AP014946.1\|WP_096353746.1\|1571033_1571498_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	3.84773e-11
NZ_AP014946.1\|WP_096353708.1\|1556050_1556848_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	8.8004e-98
NZ_AP014946.1\|WP_096353743.1\|1570098_1570980_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|273953	TIGR02072, Malonyl-_O-methyltransferase, malonyl-acyl carrier protein O-methyltransferase BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, carries out an enzymatic step prior to the formation of pimeloyl-CoA, namely O-methylation of the malonyl group preferentially while on acyl carrier protein. The enzyme is recognizable as a methyltransferase by homology. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin].	4.74607e-31
NZ_AP014946.1\|WP_096353752.1\|1572094_1572538_+\|DUF1801-domain-containing-protein	gnl\|CDD\|227936	COG5649, COG5649, Uncharacterized conserved protein [Function unknown].	1.41891e-48

>NZ_AP014946.1|WP_096353729.1|1564644_1565613_-|hypothetical-protein
MLTRRHALIAGAAALVASRAQAQTFPSRPITIVVPYPAGGPVDLLARLIAQEATGNLGQPITVDNRGGGAGTIGTTLVARAEPDGHTLVLGTNQTHATNQSLLKEISYDGVKDFAPVIGIAETPHVLVVRKELGVTSVEELIALAKQKPGALNYGSTGNGSASHLCAELFKVKAGLQMQPVHFRGSAPMLQELLGERLDLSFATLPTVISQIDSGALPALAVASAKRAIRLGGVPTLGESGIEGVEADAWFTLFAPAKTPPANVERLHAAIAAALKHDGPKAAIAQQGLTAALRSPAEVAASLPTEVERWAAVIKAANIKSE
>NZ_AP014946.1|WP_096353727.1|1563381_1564644_+|MFS-transporter
MSDTAQAKAASDRISSQQLMILGGAAVMLSLSMGMRQSFGLFQPGIIRDVGVTSADFSLAISIQNIIWGISQPFIGLLADRYGARWVSMGGVCVYLLGLVTMIFATGTLTLILGAGICIGLALSCTASSIAMSVTSKTVSPAKRSVAMGSVSAAGSLGLVLAAPLAQTLITHAGWQVALVAFLGLAAVMIPAAFSVGGADKYPAASSLGNDTSVTETVRAALGHSGYVIMALAFFVCGLQLVFITTHLPTYLALCGMDPGLGATTLALVGLFNVIGSYLFGYLGGIYPKQYLLGGVYLLRSLAVAVYFMTPPSVTSTLVFGAVMGTLWLGVVPLVNGLVAQLFGLRYMATLTGIAFFSHQVGSFLGAWGGGLIYDRLGSYDRAWQAAVLIGVIAGLAQMTMNVTPPAPKDAPGVPVPRAA
>NZ_AP014946.1|WP_096353725.1|1562727_1563300_-|TetR/AcrR-family-transcriptional-regulator
MPTMRETQAEAKPRDTRDRILRAADELFYGHGINSVGVDAIAAAAGVTKRTLYHHFDSKDALVAAYVGAHTANFRIHADRSAREQILRAFEKLAQRLQDDGFRGCAFINAAAELSDRKHPAVAVATNAKDAREAWFRDLAKLGRASRPELLAKQLAILFDGTIAQFLVRRDATVAAAALAAAEALTADLT
>NZ_AP014946.1|WP_096353723.1|1561846_1562665_-|phytanoyl-CoA-dioxygenase-family-protein
MKLSQEQVKQFDDQGYMFFPECFSAEEIALMSIEADNILKMDRPEVWREKSGAPRTGFAAHTFNEVFRLLAHHPRLVEPLQQVFGEPVYVHQFKLNAKAAFTGDVWQWHQDYGTWARDDGMPEPRAMNIAVYLDEVHPFNGALMLVPKSHKHGTLEAGHDLSTTSYPLWTLDESTVTRLCREAEEDGKPGIVAPVGKPGSVLMFHGNLVHGSAPNITPYPRKIIYLTLCAVSNHITKFTRPEFIAHRDFTPIQPVDDGALLEHARAHRVAAE
>NZ_AP014946.1|WP_096353720.1|1561050_1561683_-|glutathione-S-transferase-family-protein
MYTLYSMQRSGNCYKVRLALTQLAIPHRAVEIDILKGESRTPDFLAMNPNGRVPVLEVGPQRYLAESNAILWFVGDGTPLAPTDRIQRAEAMQWMFFEQHSLEPNLGQAYFWLTLVKGGRELQSHAIEDWMERGYQALGVMEKHLQSHDYFVDGRYSIADIALYAYTHCAEESGFDLALFPALRAWLSRVAAQTDHVPMLALQSAQRLPA
>NZ_AP014946.1|WP_096353717.1|1560352_1561054_+|hypothetical-protein
MLAANKSEDQLSFTDRVAAFLENVDYRLMSSPEDRETIYRLRYDAYLREGTIEPSPSRRITDKYDDLENSWIFGIYYEEELLSSIRLSVSLPGHSIIPALGVFGDHLEGPIANGTVYVDPTRFVADAEAARRYPVLPYVTLRAAFLAGGYFNADYVLATVRREHQAFYKRVLQCTPLCPPRNYPSLTKPISLMSVHYPTSSLKVAQRYPFFHSTVAERRALFSRPPRSVHAAA
>NZ_AP014946.1|WP_096353714.1|1557937_1560232_+|EAL-domain-containing-protein
MPLTEDNKSKNLPADVYVSLVDALYREPLTLFIGALAAAGGVLLTAWTSGSFLLYGTAAVVVLAALLRLHDMRSFAKYRDNLTAEKAWHWELRYIIGVAGVLLPLGAWCIIGFAYLKDPFVQTICYGATVAYMIGIAGRNFAIERIVTAQIVFSAVPMAIAFFAMGTIEYFLAGLLMAGFFVTLKMISDRLRSNYLDAIISTRNVTELATRFDTALNNMPHGLAMFNATGRLEVANRRLIDLFKLPLTIADGKTNVRGLVAAGRRSGAILSSDVKQLAEELELRTAREKSGVMATDLADGRSLEITIQPMSNGGSVALIEDVTERKAAEAKIAHLARFDALTGLPNRAYFRERMDRVIALTQRGESCAVLFVDLDQFKNVNDTLGHPIGDALLRVVAERLGSIVRDTDLVSRFGGDEFVILQSPIKGPEQAASLARRILSALGEVFGIADHQIVVGASVGIAMAPTDGRDADTLLKNADMALYRAKSDGRAGWRFFEPDMDVKAQARRALELDLRTAVTTDAFEVYYQPLLNAQTMEITTCEALIRWPHAKRGMVSPAEFIPIAEEMGLISEIGKRVLRKACAECMKWPKHVRVAVNISAVQVKRGNVPAVIREALEGSGLAANRLEIEITESVLLQDTEATHTFIRELHEMGVRLSLDDFGTGYSSLSYLHSYPLDKIKIDRSFLKDIESQDRVRKLVEGVARLSSELGLSVAVEGVETESQCDLLRSIPYVTEMQGFLFSRPVPRLEVRKMLDGTTPIRKVA
>NZ_AP014946.1|WP_096353711.1|1556837_1557812_+|hypothetical-protein
MEPDLYAVLAGFVPDTDTGWSLGTFGAIAEFTRDPGEPVELVSRSSRLSAVTGRGGILLFPNTHLRLVASEAVTKSGWSQKVALCLPLDHSAMSRRATLTEIGIDTEALRDEDRGDILFDLGLDVGHLDACVRVSPQVAAQLRRHCGRSLFESGNTAIHDILAAKPHRVFVTRVGRIEVFQPIPPADGRSPEGPHTHLLPALLAHRRTHPATELIPEGLVPVAHFYPPHPVSMGTEFAPDRHESFQQLLRAFGDAGYVRFKDDVSARLDAASTELAPASKADRIAYRVAIKQAHAQGRIIPDSWSISAVHDGDVDPEMVEQHPH
>NZ_AP014946.1|WP_096353708.1|1556050_1556848_+|ABC-transporter-ATP-binding-protein
MRIDARDIAFSYGDTPVLDGVSLSLHPGEFVGLIGPNGAGKSSLLRVLANLRAPNGGTVRYDDADAASIGARRLAQRLAFLAQDSQAYWPLRVDAVVALGRHPYRKPFRGADETDRAAIARAIQAADVTAFSQRTMAQLSGGERMRVLLARALAVEAETLLCDEPTASLDPAHQIDTMNLLRAAAHSDRSVVVVLHDLSLAARYCDRLILLSGGKILADGPPDAVLTDRNLADAYGIDVVRGTHDGVPFLLPWAALPAPGGKGGA
>NZ_AP014946.1|WP_096358709.1|1555025_1556051_+|iron-ABC-transporter-permease
MDRGRARGALVTAPRLWPLILALSVLTLALFAISLAAGYVSLDLMTAFGDVLAGRETLEATVLTQLRLPRALLGALVGFSLGITGAALQGLLRNPLAEPGIVGVSGAAAFGAVLMFYFGFAGALSLALPLGGIAGAAASTLILYALAGRDAGTMTLILAGVAVNALAGALTSLALNLSPNPYAALEIVFWLMGSLADRSLPYVWLTAPLMIIGWALLLASAPALDALTLGEDTAKSLGINLQRLRFQLVAGAALAVGSAVAVTGAIGFVGLVVPHVLRPLVGHRPGKLLLVSGLGGAALTLAADIAIRVIPIRPELKLGVITALIGAPFLFSLIYRLRQEA
>NZ_AP014946.1|WP_096353733.1|1566711_1567125_+|thioesterase-family-protein
MALSVGLTNSEEIVVTEALTVPAMAHAFGSFTSMPPVFATAFMVAFAEYACLQLADEHLPPEQRTVGTHVDLSHLAATPIGMRVTANVELVEVEGRKLRYRVECRDEKDVICEGFHERAVIDVAKFGGRLAAKSQAA
>NZ_AP014946.1|WP_130364795.1|1567231_1567549_+|H-NS-histone-family-protein
MSRSAQSNDIDLRSLSVDELIALDAKILELIKSKRQTLQAKIAMIELHMGPLPEGPRKRGVKKGTKLAAKYKGPNGETWSGRGLQPKWLTALVGRSGSVEKYRLR
>NZ_AP014946.1|WP_096353735.1|1567621_1568092_-|DUF1178-family-protein
MIRYTLRCAKDHHFESWFADSAAYDKQAKRGLVTCPNCGSTKVEKSLMAPQLGRTERQKSSRKKAATPAVANEASPIAMMSDGERELRTKLKELRDHVVKNATDVGAKFPEEARKMHYGESETRSIYGEASFDDAKALHEEGIEVLPLPVLPDDRN
>NZ_AP014946.1|WP_096353737.1|1568088_1568970_-|carbon-nitrogen-hydrolase-family-protein
MTDIKDKIRIGLIQMRASRTPADNVDAAAKLIREAKDQGAVYVQTPEMTNIMEVKRDVLFEKINEEEKCVSLAAFCSLARELGIHIHVGSMAIKVAPDRAANRGFMIDPSGEVLASYDKIHMFDVDLANGESYRESRTYRPGEQAVLVDLPFGRVGMTICYDLRFPALYRALAESGASFLTIPSAFTRQTGEAHWSTLMRSRAIENGSFVLAAAQAGTHENGRETYGHSMVVDPWGRVIAEGGTEPGVVMADLDAEEITTSRARVPSLQHGRRFEITAPLAEPAHLHVVGAKT
>NZ_AP014946.1|WP_096353739.1|1568973_1569234_-|glutaredoxin-3
MAQIDIYTTPMCGYCAAAKALLKRKGAAFNEIDVSGSDGDKRREMLGRSNGRWTVPQIFIGSTHVGGSDDLHALERDGKLDALIAS
>NZ_AP014946.1|WP_096353741.1|1569265_1570039_-|ComF-family-protein
MDFSRAHALTSYVRRGWSLALGAALPPLCPVCRDPVADPAGLCPHCWSRLSFISRPYCERLGTPFAYDSGPGLLSPEAIAEPPAYNRARAAVGFDDVSRTLVHAFKYGDRMDLAPMLAGWMTRAGAELLADADALVPVPLHWRRLWARRFNQSATLAKRIGAASDRPVLSDVLKRIRATQQQVGLSQAERVRNIQGAFAVPEGRRHAVAGRNLVLVDDVLTSGATVQACARTLMRAGAARVDVLVFARVVNHIGPPI
>NZ_AP014946.1|WP_096353743.1|1570098_1570980_+|methyltransferase-domain-containing-protein
MTTPMDTAPQIFDRALIARRQRRALRDPATFLLDRVVDELADRLSVILREFPVAVDLATPGGRLAPLLAARRGATQTITTGAGGELVADAEALPFAEASLDLIVSALALQFVNDLPGTLAQARRALRPDGLFLAALLGGDTLTELRQSFAEAETELTGGVSPRVAPFADVRTLGMLLQRAGFALPVTDVDRVTVRYETPFALLHDLRRMGATNPLTERRRVPLRRGVLLRMAEIYKQRFAGADGRVMATFDIVWLTGWAPHASQQQPLRPGSAKTRLADALRTTERPAGEKAG
>NZ_AP014946.1|WP_096353746.1|1571033_1571498_+|nuclear-transport-factor-2-family-protein
MDAKATLKEFCSAVERRDGKALAALFTEEGVYHDIFYGAFKGRAKIAELIDDWFYRTAQDFLWDMHDPVTDGRTLYARYTFSYKSNLPEAKGGRAMFEGVAIITLKDGLFAEYHEVANTATAFVDLNFAPERIAKIVAKQGAALKARPEMARHL
>NZ_AP014946.1|WP_096353749.1|1571574_1572093_+|MaoC-family-dehydratase
MAGTTKEVGPNRYRESFGRYYEEFVVGDVYEHRPGRTITETENTWFTLLTMNQHPIHFDSEYAKHSEFGRCIVASPFTVSLLVGMSVSDVSQKAIANLGWTDIKLTHPVFAGDTLYGESEVLEKRESKSRPDAGIVSVRTIGKNQDGVVVCTFDRTMLVQREGHALEEKAKY
>NZ_AP014946.1|WP_096353752.1|1572094_1572538_+|DUF1801-domain-containing-protein
MAKAVAKPKPAKTGEPVLLSGGNPQIAKGYGDAPVQAYIAAMPGWKSDVGRKIDALITKTVPGVKKAVKWNSPLYGIEEGRWFLGVHVFAKYVKVAFFEGAKLKPEPPVASKQQHVRYFHIHENDAIDETQFAKWVKQASKLPGEKM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

465197 : 471482

Brucella_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096351104.1\|465197_466010_-	transglycosylase SLT domain-containing protein	A0A191VYT0	Roseobacter_phage	8.5e-16	35.1
WP_096351107.1\|466122_467352_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-05	29.5
WP_096351110.1\|467418_468597_-	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_096351113.1\|468772_470077_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	2.7e-141	56.7
WP_096351116.1\|470073_470370_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.8e-16	45.3
WP_096351119.1\|470371_470662_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.6e-28	61.5
WP_096358609.1\|470714_471482_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-24	36.7

DBSCAN-SWA_2

2954378 : 2963300

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096356465.1\|2954378_2955383_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.9e-20	41.9
WP_096358843.1\|2955403_2956297_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.5e-29	34.6
WP_096356467.1\|2956310_2957069_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.8e-45	51.8
WP_096358844.1\|2957180_2958257_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.5e-12	34.8
WP_096356469.1\|2958322_2958574_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.4e-06	60.5
WP_096356471.1\|2958627_2959179_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_096356473.1\|2959175_2959970_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.7e-53	46.6
WP_096356475.1\|2960139_2961573_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.1e-97	44.5
WP_096356477.1\|2961761_2962535_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-39	40.4
WP_096356479.1\|2962676_2963300_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.5e-23	42.2

DBSCAN-SWA_3

3790153 : 3840582

Paracoccus_phage(22.22%)

protease,tRNA,head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096357910.1\|3790153_3790897_+\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_096357911.1\|3790956_3791790_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_096357912.1\|3791807_3792827_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_165391585.1\|3792988_3793144_+	hypothetical protein	NA	NA	NA	NA
WP_165391629.1\|3793162_3793978_-	Ku protein	NA	NA	NA	NA
WP_130364587.1\|3794084_3794279_+	hypothetical protein	NA	NA	NA	NA
WP_096357916.1\|3794291_3794687_-	DUF930 domain-containing protein	NA	NA	NA	NA
WP_096358921.1\|3794796_3795828_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	6.3e-16	30.3
WP_096357917.1\|3795881_3797171_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096357918.1\|3797238_3798117_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_096357919.1\|3798113_3798953_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_130364589.1\|3798949_3799792_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_096357921.1\|3799798_3801082_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_096357922.1\|3801071_3801410_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_096357923.1\|3801571_3802867_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_096357924.1\|3802964_3803828_+	VOC family protein	NA	NA	NA	NA
WP_096357925.1\|3803847_3805449_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096357926.1\|3805473_3806448_+	ABC transporter permease	NA	NA	NA	NA
WP_096357927.1\|3806447_3807278_+	ABC transporter permease	NA	NA	NA	NA
WP_096357928.1\|3807274_3808903_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-18	31.0
WP_157746833.1\|3809132_3810518_+	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase	NA	NA	NA	NA
WP_157746789.1\|3810570_3811374_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_096357931.1\|3811471_3814084_+	aminopeptidase N	NA	NA	NA	NA
WP_096357932.1\|3814300_3816610_+	PAS-domain containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	3.3e-28	34.8
WP_096357933.1\|3816606_3819603_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_096357934.1\|3819599_3821009_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_172887646.1\|3820992_3821730_-	response regulator transcription factor	NA	NA	NA	NA
WP_096357935.1\|3821995_3823537_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	3.8e-25	28.3
WP_096358923.1\|3823908_3824379_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_096357936.1\|3824378_3826358_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_096357937.1\|3826354_3826837_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_096357938.1\|3826841_3827936_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_096357939.1\|3828069_3829443_-	ATP-binding protein	NA	NA	NA	NA
WP_096357940.1\|3829432_3830104_-	response regulator transcription factor	NA	NA	NA	NA
WP_096357941.1\|3830113_3830428_-	hypothetical protein	NA	NA	NA	NA
WP_096357942.1\|3830477_3831149_-	nitroreductase	NA	NA	NA	NA
WP_096357943.1\|3831221_3831836_-	hypothetical protein	NA	NA	NA	NA
WP_096357944.1\|3831840_3832443_-	lysozyme	M4STA9	Rhodobacter_phage	7.4e-33	50.7
WP_096357945.1\|3832458_3836301_-\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	4.8e-226	38.5
WP_130364591.1\|3836304_3836874_-	C40 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	8.9e-28	45.9
WP_096357948.1\|3837613_3838252_-	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	1.1e-45	47.4
WP_096357949.1\|3838254_3838890_-\|tail	phage tail tape measure protein	A0A1B2AP03	Escherichia_phage	1.5e-07	44.2
WP_096357950.1\|3838882_3839077_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_096357951.1\|3839073_3839421_-	gene transfer agent family protein	NA	NA	NA	NA
WP_096357952.1\|3839422_3839830_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_096357953.1\|3839840_3840248_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_096357954.1\|3840258_3840582_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage