CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP017312	Aneurinibacillus soli strain CB4	1 crisprs	DEDDh,csa3,cas14j,DinG,c2c9_V-U4,WYL,cas14k,PrimPol,cas3,c2c10_CAS-V-U3,c2c4_V-U1	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP017312_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP017312_1

173771-173968

Orphan

Consensus_repeat	Method
ACACCCTGATTAAAAGTCAGGTGCTCTACCAACTGAGCTA	PILER-CR

2 spacers

The CRISPR arrays of NZ_AP017312_1

>merge|NZ_AP017312|1|173771-173968|PILER-CR
GTGCTCTACCAACTGAGCTATGTCCGCACATAGTGTTTATTGATATAAATAATGAGCCATACTGGACTCGAACCAGTGACACCCTGATTAAAAGTCAGGTGCTCTACCAACTGAGCTAATGGCTCTTAAAGATGCCGGCGAAAGGACTTGAACCCTCAACCCCCTGATTACAAGTCAGGTGCTCTACCAATTGAGCTA

>NZ_AP017312|1|1|173771-173968|PILER-CR
GTGCTCTACCAACTGAGCTATGTCCGCACATAGTGTTTAT	TGATATAAATAATGAGCCATACTGGACTCGAACCAGTGACACCCTGATTAAAAGTCAG
GTGCTCTACCAACTGAGCTAATGGCTCTTAAAGATGCCGG	CGAAAGGACTTGAACCCTCAACCCCCTGATTACAAGTCAG
GTGCTCTACCAATTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP017312.1\|WP_157737758.1\|180730_181360_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|273990
NZ_AP017312.1\|WP_096463188.1\|170553_170970_-\|hemerythrin-family-protein	unknown	unknown	gnl\|CDD\|213982
NZ_AP017312.1\|WP_096463196.1\|184216_186298_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
NZ_AP017312.1\|WP_096463198.1\|186893_187316_-\|30S-ribosomal-protein-S12	unknown	unknown	gnl\|CDD\|235355
NZ_AP017312.1\|WP_096463200.1\|187795_191437_-\|DNA-directed-RNA-polymerase-subunit-beta'	unknown	unknown	gnl\|CDD\|234794
NZ_AP017312.1\|WP_172890937.1\|180467_180701_+\|glutaredoxin-family-protein	unknown	unknown	gnl\|CDD\|239274
NZ_AP017312.1\|WP_096463197.1\|186376_186847_-\|30S-ribosomal-protein-S7	unknown	unknown	gnl\|CDD\|235398
NZ_AP017312.1\|WP_172890745.1\|172730_173075_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133380
NZ_AP017312.1\|WP_096463199.1\|187451_187706_-\|50S-ribosomal-protein-L7ae-like-protein	unknown	unknown	gnl\|CDD\|184174
NZ_AP017312.1\|WP_096463186.1\|169036_170083_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_AP017312.1\|WP_096463191.1\|171718_172558_-\|SPFH-domain-containing-protein	unknown	unknown	gnl\|CDD\|259800
NZ_AP017312.1\|WP_172890741.1\|168831_168984_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP017312.1\|WP_096467577.1\|179486_180137_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|376838
NZ_AP017312.1\|WP_096463194.1\|181571_182759_+\|putative-lipid-II-flippase-FtsW	unknown	unknown	gnl\|CDD\|274232
NZ_AP017312.1\|WP_096463190.1\|171523_171715_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227214
NZ_AP017312.1\|WP_096463195.1\|182886_184077_-\|elongation-factor-Tu	unknown	unknown	gnl\|CDD\|234596
NZ_AP017312.1\|WP_096463187.1\|170110_170530_-\|hemerythrin-family-protein	unknown	unknown	gnl\|CDD\|213982
NZ_AP017312.1\|WP_146226661.1\|167916_168303_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP017312.1\|WP_172890743.1\|171129_171522_+\|kinase	unknown	unknown	gnl\|CDD\|378054
NZ_AP017312.1\|WP_096463185.1\|168461_168809_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP017312.1\|WP_157737758.1\|180730_181360_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|273990	TIGR02135, Uncharacterized_protein, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. [Regulatory functions, Other, Transport and binding proteins, Anions].	1.27598e-43
NZ_AP017312.1\|WP_096463188.1\|170553_170970_-\|hemerythrin-family-protein	gnl\|CDD\|213982	cd12107, Hemerythrin, Hemerythrin. Hemerythrin (Hr) is a non-heme diiron oxygen transport protein found in four marine invertebrate phyla including priapulida, brachiopoda, sipunculida, and annelida, as well as in protozoa. Myohemerythrin (Mhr), a hemerythrin homolog, is found in the muscle tissue of sipunculids as well as in polycheate and oligocheate annelids. In addition to oxygen transport, Mhr proteins are involved in cadmium fixation and host anti-bacterial defense. Hr and Mhr proteins have the same "four alpha helix bundle" motif and active site structure. Hr forms oligomers, the octameric form being most prevalent, while Mhr is monomeric.	2.88951e-26
NZ_AP017312.1\|WP_096463196.1\|184216_186298_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	0
NZ_AP017312.1\|WP_096463200.1\|187795_191437_-\|DNA-directed-RNA-polymerase-subunit-beta'	gnl\|CDD\|234794	PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional.	0
NZ_AP017312.1\|WP_172890937.1\|180467_180701_+\|glutaredoxin-family-protein	gnl\|CDD\|239274	cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, could be a mechanism for regulating the oxidation state of the protein.	2.2498e-18
NZ_AP017312.1\|WP_096463198.1\|186893_187316_-\|30S-ribosomal-protein-S12	gnl\|CDD\|235355	PRK05163, rpsL, 30S ribosomal protein S12; Validated.	1.31969e-86
NZ_AP017312.1\|WP_172890745.1\|172730_173075_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	4.09639e-21
NZ_AP017312.1\|WP_096463199.1\|187451_187706_-\|50S-ribosomal-protein-L7ae-like-protein	gnl\|CDD\|184174	PRK13602, PRK13602, 50S ribosomal protein L7ae-like protein.	3.35582e-29
NZ_AP017312.1\|WP_096463186.1\|169036_170083_-\|HD-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	5.66522e-43
NZ_AP017312.1\|WP_096463191.1\|171718_172558_-\|SPFH-domain-containing-protein	gnl\|CDD\|259800	cd03402, SPFH_like_u2, Uncharacterized family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes an uncharacterized family of proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease, and in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.	1.33967e-130
NZ_AP017312.1\|WP_096463197.1\|186376_186847_-\|30S-ribosomal-protein-S7	gnl\|CDD\|235398	PRK05302, PRK05302, 30S ribosomal protein S7; Validated.	4.85377e-109
NZ_AP017312.1\|WP_096467577.1\|179486_180137_-\|YitT-family-protein	gnl\|CDD\|376838	pfam02588, YitT_membrane, Uncharacterized 5xTM membrane BCR, YitT family COG1284. This is probably a bacterial ABC transporter permease (personal obs:Yeats C).	6.9818e-36
NZ_AP017312.1\|WP_096463194.1\|181571_182759_+\|putative-lipid-II-flippase-FtsW	gnl\|CDD\|274232	TIGR02614, Putative_lipid_II_flippase_FtsW, cell division protein FtsW. This family consists of FtsW, an integral membrane protein with ten transmembrane segments. In general, it is one of two paralogs involved in peptidoglycan biosynthesis, the other being RodA, and is essential for cell division. All members of the seed alignment for this model are encoded in operons for the biosynthesis of UDP-N-acetylmuramoyl-pentapeptide, a precursor of murein (peptidoglycan). The FtsW designation is not used in endospore-forming bacterial (e.g. Bacillus subtilis), where the member of this family is designated SpoVE and three or more RodA/FtsW/SpoVE family paralogs are present. SpoVE acts in spore cortex formation and is dispensible for growth. Biological rolls for FtsW in cell division include recruitment of penicillin-binding protein 3 to the division site. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	5.83704e-118
NZ_AP017312.1\|WP_096463190.1\|171523_171715_-\|hypothetical-protein	gnl\|CDD\|227214	COG4877, COG4877, Uncharacterized protein conserved in bacteria [Function unknown].	1.11282e-14
NZ_AP017312.1\|WP_096463195.1\|182886_184077_-\|elongation-factor-Tu	gnl\|CDD\|234596	PRK00049, PRK00049, elongation factor Tu; Reviewed.	0
NZ_AP017312.1\|WP_096463187.1\|170110_170530_-\|hemerythrin-family-protein	gnl\|CDD\|213982	cd12107, Hemerythrin, Hemerythrin. Hemerythrin (Hr) is a non-heme diiron oxygen transport protein found in four marine invertebrate phyla including priapulida, brachiopoda, sipunculida, and annelida, as well as in protozoa. Myohemerythrin (Mhr), a hemerythrin homolog, is found in the muscle tissue of sipunculids as well as in polycheate and oligocheate annelids. In addition to oxygen transport, Mhr proteins are involved in cadmium fixation and host anti-bacterial defense. Hr and Mhr proteins have the same "four alpha helix bundle" motif and active site structure. Hr forms oligomers, the octameric form being most prevalent, while Mhr is monomeric.	3.20531e-22
NZ_AP017312.1\|WP_172890743.1\|171129_171522_+\|kinase	gnl\|CDD\|378054	pfam08810, KapB, Kinase associated protein B. This bacterial protein forms an anti-parallel beta sheet with an extending alpha helical region.	1.8616e-49

>NZ_AP017312.1|WP_172890745.1|172730_173075_+|MerR-family-transcriptional-regulator
MTEVKEGWGRLSYKHKKVITIGIVSELTGLSERQIRYYEERRLIEPERTRGGTRKFSFTDVEKLVEIANQMEDGLQTAEIRRLEQKAQQQKDAKVRDQMIRGQLNAAFPNRNKS
>NZ_AP017312.1|WP_096463191.1|171718_172558_-|SPFH-domain-containing-protein
MAEKQVATVNGFVGILLLLLIGLGGAYVLVLMQNPFGLILLIGAILLASGIVIVQPNQAKAVIFFGRYLGTISNNGMWLTVPFTVRRSVSLKVRNFNSARLKVNDVEGNPIEIAAVVVFKVVDSAKALFDVDNYETFVEIQSETALRYVASRYPYDHAHGEGYSLRGNSEEIAEELVRELQSRLTVAGVEVMEARLTHLAYATEIASAMLQRQQASAIISARQQIVEGAVGMVQLAIAQLEQDGFVLDEERKAAMINNLLVAIVSERSAQPVINSGSLY
>NZ_AP017312.1|WP_096463190.1|171523_171715_-|hypothetical-protein
MAEKKRFLLRLDPKLYEALEGWAADEFRSVNTHIEFLLREAVRKSGRLSARKADRRPDEEEME
>NZ_AP017312.1|WP_172890743.1|171129_171522_+|kinase
MPDITLTPGTLVTASYKSGEYIGEIVELYPPRVAVVKILAVQKHPAQGDLHHPFATDVPLFHQRRALSYQEKASAPLASVRLHTGEVPGYKESLLAALDAEIHTLQNDDSEWAKRALSELHALQNEYRTL
>NZ_AP017312.1|WP_096463188.1|170553_170970_-|hemerythrin-family-protein
MEIQWSSDLETGIGIVDDQHRELFDRIIEFFRVADQNDTVLTLQTVDYLAEYVIEHFSAEEGIMIKDSYPGFASHRDEHSKFIKNVYQIKRKIAVGGVTPELVATLKTDLVDWLVNHINVRDKHLATIHQKEVSRYRW
>NZ_AP017312.1|WP_096463187.1|170110_170530_-|hemerythrin-family-protein
MSEEITKVEFTDDLYTGIEFVDDQHRQLIDRINMLLDAIQQNDEEFIEDTVGYVLQYTLFHFKSEENVMMRSLYEEFEMHRDQHSIFIKKMFALKMEIEESGITQALVQTLKKELLEWLIMHIQVQDKKLASIEMEAHL
>NZ_AP017312.1|WP_096463186.1|169036_170083_-|HD-domain-containing-protein
MDRVPVRELRPGMVVKEDVTCPRTKMVLVKAGVTLNEVVISSLEKRSILSVAINDRYTLMLNPIDSLKQKLLQMSEERLALYAPDDRGANLSDQVYDVAARVRPMMHQVLNNEDLLSLLMELRVLDNDSFYNHIVNSGVLSMLVGGLMNLSDEDVYCIGMGAFLHDVGLREMPFLIGGKELSSYEKAQFAEHSRYGYYILKEMGMPGSVADMVLNHHERWDGSGYPSAKKGEEIPLSSRIVAVVEEYDTLVNMNGKLPREALGILMEGKNKYFDGSVVDVFCKHIAVYPLGSLVSLSTGETGVVINVRKNSGVTPIVKVYFNRVNRPMKQPKIVDLAEEKEIHIKKIL
>NZ_AP017312.1|WP_172890741.1|168831_168984_+|hypothetical-protein
MTKNHNPGVDKNLQNVVKDLNQVKAGSFHAKQIQQDVNDRRHQDDMNHNE
>NZ_AP017312.1|WP_096463185.1|168461_168809_+|hypothetical-protein
MKLSQLPINQEQLVQAWQQTLPSTFHPTDRVEVTADTRNPQSLLIHVHTAGHSNYSFDYECRYMDPREVQVRLIEMQRDGYAISKPSPDIEDLSGTYMRHIHECAQTLHPTTHPH
>NZ_AP017312.1|WP_146226661.1|167916_168303_-|hypothetical-protein
MIDIANVVGFINNIAAQTTASVSRVNETISRMQQETEEVECGTKVVMCQLNVQLKQSNQAIEALEKPHRKMHDLAFAIYRASVDGKSKEAREMLRELERCSGEVVQQLRRLASDISNTEIELMGMERL
>NZ_AP017312.1|WP_096467577.1|179486_180137_-|YitT-family-protein
MSWKKQMIMIITGCMLVALGIRIFAASHIVLGGTAGMGLILHRVTGLSIGMLFFVINIPFYFLSVRQLGVHFTLKTFLSVTLLSITTDLMDSFLKIEVPYTIIGAVVGGALIGFGLTVLFRSNSSLGGINILALFLDRRYGIHPGKTILVSDICIVLSALAVFTIVEVAYSILAIFIMSTVLGRYHKKSPIEKNNKNLDEMEKEAASIEGETAQLQ
>NZ_AP017312.1|WP_172890937.1|180467_180701_+|glutaredoxin-family-protein
MHMSIIVYSAPGCSTCELVKNFLREKEYDFEVRDLLANREYQKEVEAFGLLGIPVTVINGKAIKGFDPAALERMLTE
>NZ_AP017312.1|WP_157737758.1|180730_181360_-|phosphate-signaling-complex-protein-PhoU
MVTLKNEVADMAQIAQNGFLQAWKAFQTGSVKQAKEVIIRDEKLNVLAARIFKMGLSLIARQAPVAKDLRTIGAYLKVVTDLERIGDLSGDIASVVVRLEGGPQRVPLFEIPDMAASVQEILALSVRALKMGDTRQLRSLDDMDDVIDAYYSRCFVYLERSMESESGYVQEGVQLFKVIQALERIGDHATNIGEWTLYMSTGNIADLNT
>NZ_AP017312.1|WP_096463194.1|181571_182759_+|putative-lipid-II-flippase-FtsW
MKTRGRPDFVILIFTLLFVGFGIVMVYSASSVYALNRFHTDTYFVKKQLISAVIGLVAMSFAMNIPYTFYKKNFVQIALGIILLLLLVLIPGIGLWRNGARSWLNLGIFQLQPAEFAKLAVVIYLSALISKKGQQIETWKKGLQPAITVIGIFGILIAAQPDMGSAAILGLTAVSVLVAGGAKFKYLLRIAIPIAAAAIALIVTSPYRMSRVTNIGDPWSDGMNGLGSGFQLAHSYFAIAHGGMVGTGFGKSIEKYLYLPEVQTDFIFSIIGEELGFIGATLFLILFILYLWRIILITRRVNDLFANLIGIGVASMISIQALVNIGGVTGLIAITGVPLPFISYGGSSLLLNMLSIGIVLSISREAYRQAVQKAEGKGGATNSSVVPFNASRRKA
>NZ_AP017312.1|WP_096463195.1|182886_184077_-|elongation-factor-Tu
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLAQTGGATAMDYGSIDAAPEERERGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLSRQVGVPYIVVFMNKCDMVDDEELLELVEMEIRDLLSEYDFPGDDIPVVKGSAKEALENPTGEWAQRIIELMAEVDAYIPTPERAVDLPFLMPVEDVFSITGRGTVATGRVERGIVKVGDQVEIIGLTEEPKTTTVTGVEMFRKLLDQAQAGDNIGALLRGVDRTDIERGQVLGKPGSVKPHTTFTAQIYVLSKEEGGRHTPFFGNYRPQFYFRTTDVTGIIKLPEGTEMVMPGDNVEITVELISPIAMEEGTRFAIREGGRTVGAGAVAAIQK
>NZ_AP017312.1|WP_096463196.1|184216_186298_-|elongation-factor-G
MGREFPLAKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHEGASQMDWMEQEQERGITITSAATTAQWKEHRVNIIDTPGHVDFTVEVERSLRVLDGAVGVLDAQSGVEPQTETVWRQATTYGVPRIVFINKMDKLGADFLYSVGTLHERLQANAHPIQLPIGAEDEFRGIIDLVEKKTYIYTNDLGTDIEITEGFPAEFADQAEEYRGKLIEAVSDFDEELMMKYLEGEEVTIAELKNAIRKATISVQFFPVTCGSAFKNKGVQPMLDAVIDYLPSPLDVPSIKGTVPDSEEETVRESSDEIPFSALAFKIMTDPYVGKLTFFRVYSGTIDSGSYVLNSTKGKRERIGRILQMHANTREEIKTVYSGDIAAAVGLKDTTTGDTLCDEKAPVILESMNFPDPVISIAIEPKTKADQDKMGMALAKLAEEDPTFKTFTDQETGQTIISGMGELHLDIIVDRMRREFKVEANVGAPQVAYKESFRQGAKVEAKYAKQSGGKGQYGHVVVEFEPGEPGSGYVFENKVVGGAIPREYVPAVQNGIEESMKNGVLAGYPLLDLKARLVHGSYHEVDSSEMAFKIAGSMALKEAGKKCNPAILEPMMKVEVTVPDEYMGDIMGDISSRRGRVEGMEARGTAQVVRGFVPLSEMFGYATALRSRTQGRGTYSMHFDHYEEVPRNVADEIIKKAKGV
>NZ_AP017312.1|WP_096463197.1|186376_186847_-|30S-ribosomal-protein-S7
MPRKGPVARRDVLPDPIYNSKLVTRLINRMMLDGKRGVSQRILYDAFNLVQQRTSREPMEVFEEAMKNIMPVLEVRARRVGGANYQVPIEVRPERRTTLGLRWLVEYSRKRGEKTMEERLAGEILDAANSTGAAVKKREDTHKMAEANKAFAHYRW
>NZ_AP017312.1|WP_096463198.1|186893_187316_-|30S-ribosomal-protein-S12
MPTINQLVRKGREKKVYKSKSPALGKGYNSMKKELTNTNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYKIVRGALDTAGVQNRLQSRSKYGAKRPKAPKA
>NZ_AP017312.1|WP_096463199.1|187451_187706_-|50S-ribosomal-protein-L7ae-like-protein
MSYEKVEQASGLIIGAKQTARAVEADSLVEVIVARDADAKLTGKIISICKDKGLPIHYVESMRRLGRACGIDVGTAVVGLKHNK
>NZ_AP017312.1|WP_096463200.1|187795_191437_-|DNA-directed-RNA-polymerase-subunit-beta'
MLDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKEGLFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIPSRMGLVLDMSPRSLEEVIYFASYVVTDAGETPLEKKQLLSEKEYRNYREKYGQAFTAQMGAEAIKKLLAEIDLDKEVDFLKEELKSAQGQRRNRVIKRLEVLESFRNSGNFPDWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVSKGLAHNIKSAKRKVERVHPEVWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGTYYLTMENKESTGEGKVFSNPNQAIAAYANDHVTLHARIAIPPTSLGKTSFTPEQINAPLMVTTVGKLIFNEILPPELPYINDPTKYNLQKQVPDKFFIFDKGTNVKEFLENLPEHEAVKKGYLGTIISECFRRFGTTQTSVILDDIKANGFKFSTQAGITVAVADIKTPEEKQQILADADAEVEVVQQQFRRGLITDNERYDRVISIWSKAKDRVTKVLMASLDKFNAINMMATSGARGNVSQITQLAGMRGLMANPSGRIIELPIKSNFREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTDKGVEAMAIRDGKEIIEDLYDRLVGRYSFQTLRHPETDEVMVGRNELIDENLADEIIAAGIEKVTIRSVIGCRTHHGVCKKCYGRNLATGKNVDVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQAVITEIDGEVVDMREGKDRREVEIRGETESKVYQIPYGSRLKVAIGRKVDIGEELTEGSIDPKEMLKVRGMRGVQYYILQEVQKVYRMQGVEINDKHVEVMIRQMLRKVRVIDSGETDLLPGAYVEIHEFEEANKKVLWEGRQPAVARSVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKVDRLLGLKENVIIGKLVPAGTGMNRYRNIKLQHDLMPAEETVEQSLVEEGAGLEEVSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

376142 : 385053

Bacillus_phage(33.33%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096463356.1\|376142_377432_+	adenylosuccinate synthase	G5CQQ4	Megavirus	5.6e-70	36.7
WP_157737761.1\|377559_378198_+	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	7.9e-25	48.6
WP_096463358.1\|378318_379038_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-39	37.3
WP_096463359.1\|379034_380849_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.1e-31	30.4
WP_096463360.1\|380835_382200_+	hypothetical protein	NA	NA	NA	NA
WP_096463361.1\|382186_382966_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_096463362.1\|383017_383815_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	9.2e-47	40.0
WP_096463363.1\|383841_385053_+\|protease	serine protease	W5SAB9	Pithovirus	4.2e-11	27.8

DBSCAN-SWA_2

617299 : 624347

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096463552.1\|617299_618250_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	1.3e-18	24.3
WP_096463553.1\|618275_618920_+	NeuD/PglB/VioB family sugar acetyltransferase	NA	NA	NA	NA
WP_096463554.1\|618927_619755_+	3-keto-5-aminohexanoate cleavage protein	A0A1V0SL81	Klosneuvirus	9.1e-74	53.5
WP_096467611.1\|619961_621056_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	4.5e-20	42.7
WP_096463555.1\|621070_621940_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.2e-105	63.9
WP_096463556.1\|621964_622753_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_096463557.1\|622765_623314_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.8e-36	42.3
WP_096463558.1\|623327_624347_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.1e-79	46.7

DBSCAN-SWA_3

1709773 : 1771014

Bacillus_phage(48.39%)

head,terminase,tail,portal,tRNA,protease,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096465028.1\|1709773_1710535_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_096465030.1\|1710682_1711030_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_096465032.1\|1711101_1711659_+	signal peptidase I	NA	NA	NA	NA
WP_096465034.1\|1711681_1712581_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_096467689.1\|1712677_1713436_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	6.1e-24	40.2
WP_096465035.1\|1713457_1714930_+	hypothetical protein	NA	NA	NA	NA
WP_096465037.1\|1714926_1715211_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_096465039.1\|1715207_1715570_+	YraN family protein	NA	NA	NA	NA
WP_157737883.1\|1715792_1716869_+	YifB family Mg chelatase-like AAA ATPase	NA	NA	NA	NA
WP_096465043.1\|1716846_1718445_-	recombinase family protein	A0A0K2CYN0	Paenibacillus_phage	8.3e-140	50.8
WP_146226556.1\|1718556_1719135_-	hypothetical protein	NA	NA	NA	NA
WP_096465046.1\|1719127_1719727_-	hypothetical protein	NA	NA	NA	NA
WP_096465048.1\|1720155_1721064_-	hypothetical protein	NA	NA	NA	NA
WP_096465050.1\|1721153_1721711_-\|terminase	terminase	NA	NA	NA	NA
WP_096465052.1\|1721776_1722229_-	SHOCT domain-containing protein	A0A1D9C9Q4	Salinivibrio_phage	2.6e-06	29.9
WP_096465054.1\|1722323_1722698_-	helix-turn-helix transcriptional regulator	K7PLZ5	Enterobacterial_phage	3.3e-07	42.6
WP_096465056.1\|1722861_1723110_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_096465058.1\|1723248_1723476_-	hypothetical protein	NA	NA	NA	NA
WP_157737885.1\|1723613_1723757_+	hypothetical protein	NA	NA	NA	NA
WP_096465060.1\|1723753_1723960_+	hypothetical protein	NA	NA	NA	NA
WP_096465061.1\|1723956_1724214_+	hypothetical protein	NA	NA	NA	NA
WP_096465063.1\|1724321_1724843_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_096465065.1\|1724839_1725067_+	hypothetical protein	NA	NA	NA	NA
WP_157737887.1\|1725063_1725216_+	hypothetical protein	NA	NA	NA	NA
WP_096465067.1\|1725443_1725740_+	hypothetical protein	NA	NA	NA	NA
WP_096465069.1\|1725755_1725959_+	hypothetical protein	NA	NA	NA	NA
WP_157737889.1\|1726055_1726229_+	hypothetical protein	NA	NA	NA	NA
WP_096465071.1\|1726240_1726825_+	host-nuclease inhibitor Gam family protein	Q9ZXC8	Bacillus_phage	2.9e-10	29.3
WP_096465073.1\|1726965_1727799_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.8e-30	50.4
WP_096465075.1\|1727927_1728932_+	hypothetical protein	NA	NA	NA	NA
WP_157737891.1\|1728870_1729734_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	6.8e-56	43.2
WP_096465081.1\|1729918_1730359_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	3.6e-45	61.2
WP_172890836.1\|1731294_1731432_+	hypothetical protein	NA	NA	NA	NA
WP_096465083.1\|1731677_1731977_+	hypothetical protein	NA	NA	NA	NA
WP_096465085.1\|1731969_1732383_+	hypothetical protein	NA	NA	NA	NA
WP_096465087.1\|1732396_1732765_+	hypothetical protein	A0A1S5S893	Streptococcus_phage	1.4e-10	37.1
WP_096465089.1\|1733014_1733677_+	hypothetical protein	A0A2P1JTX0	Anoxybacillus_phage	5.5e-21	40.4
WP_146226555.1\|1733935_1735024_+	hypothetical protein	NA	NA	NA	NA
WP_096465095.1\|1735618_1735801_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.8e-17	70.0
WP_096465097.1\|1735977_1736724_+	hypothetical protein	NA	NA	NA	NA
WP_096465099.1\|1736788_1737148_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	1.4e-26	54.0
WP_096465101.1\|1737221_1737524_+	hypothetical protein	A0A0K2CZ01	Paenibacillus_phage	7.8e-07	26.5
WP_096465103.1\|1737644_1737968_+\|terminase	phage terminase small subunit P27 family	A0A0K2CYB1	Paenibacillus_phage	1.1e-35	72.9
WP_096465105.1\|1737942_1739724_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	1.6e-253	68.9
WP_096465107.1\|1739755_1740964_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	6.8e-102	49.1
WP_096465109.1\|1740938_1741685_+\|protease	Clp protease ClpP	A0A0K2CZ28	Paenibacillus_phage	5.0e-63	52.6
WP_096465111.1\|1741677_1742817_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	7.2e-146	70.5
WP_096465112.1\|1742831_1743095_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	5.2e-15	49.4
WP_096465114.1\|1743108_1743333_+	hypothetical protein	NA	NA	NA	NA
WP_096465116.1\|1743274_1743637_+\|head	phage head closure protein	A6M954	Geobacillus_virus	3.8e-16	43.1
WP_096465118.1\|1743593_1744022_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	6.2e-26	43.4
WP_096465120.1\|1744018_1744387_+	DUF3168 domain-containing protein	Q2I8F3	Bacillus_phage	5.5e-31	59.3
WP_096465122.1\|1744389_1744953_+\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	4.3e-35	42.9
WP_096465124.1\|1745021_1745336_+	hypothetical protein	A0A288WFU6	Bacillus_phage	8.7e-09	33.7
WP_096465126.1\|1745512_1750723_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	7.0e-111	54.0
WP_096465128.1\|1750722_1752141_+	hypothetical protein	NA	NA	NA	NA
WP_096465130.1\|1752137_1752578_+	hypothetical protein	NA	NA	NA	NA
WP_096465132.1\|1752589_1753330_+	hypothetical protein	NA	NA	NA	NA
WP_096465134.1\|1753329_1754277_+	hypothetical protein	NA	NA	NA	NA
WP_096465136.1\|1754277_1754526_+	hypothetical protein	NA	NA	NA	NA
WP_157737893.1\|1754525_1754681_+	hypothetical protein	NA	NA	NA	NA
WP_096465138.1\|1754806_1755034_-	hypothetical protein	NA	NA	NA	NA
WP_096465140.1\|1755164_1755347_+	UviB-like protein	J9PTZ1	Bacillus_phage	8.0e-07	39.8
WP_096465142.1\|1755351_1756104_+	N-acetylmuramoyl-L-alanine amidase	Q9FZW0	Bacillus_phage	1.0e-15	29.1
WP_096465144.1\|1756251_1756980_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_096465146.1\|1757005_1757671_-	hypothetical protein	NA	NA	NA	NA
WP_096465148.1\|1757814_1758948_+	hypothetical protein	NA	NA	NA	NA
WP_157737895.1\|1759456_1759621_+	hypothetical protein	NA	NA	NA	NA
WP_157737897.1\|1759717_1760062_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_172890838.1\|1760136_1760667_+	ATP-binding protein	NA	NA	NA	NA
WP_096465155.1\|1760862_1760991_+	sporulation histidine kinase inhibitor Sda	NA	NA	NA	NA
WP_096465157.1\|1761187_1762348_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_096465159.1\|1762375_1763284_+	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_096465161.1\|1763391_1764498_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.0e-32	42.2
WP_096465163.1\|1764574_1766656_+	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	1.6e-103	40.0
WP_096465165.1\|1766677_1767985_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_096465167.1\|1768131_1769034_+	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	2.2e-33	34.1
WP_096465169.1\|1769057_1769603_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_096465171.1\|1769616_1771014_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	7.7e-41	29.1

DBSCAN-SWA_4

2244949 : 2252914

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096467722.1\|2244949_2246005_-	phosphoadenosine phosphosulfate reductase family protein	H7BVI4	unidentified_phage	3.4e-57	34.7
WP_096467723.1\|2246063_2246804_-	DNA adenine methylase	U5P0W8	Brevibacillus_phage	3.4e-88	65.2
WP_096465903.1\|2246916_2248677_-	DEAD/DEAH box helicase	A0A160DHD3	Gordonia_phage	5.0e-45	29.6
WP_110546190.1\|2248729_2249158_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.1e-41	66.7
WP_110546191.1\|2249166_2250300_-	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	5.0e-107	56.1
WP_096465904.1\|2250347_2250695_-	hypothetical protein	NA	NA	NA	NA
WP_096465905.1\|2250741_2251161_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_096465906.1\|2251187_2251517_-	hypothetical protein	NA	NA	NA	NA
WP_096465907.1\|2251660_2252914_-	hypothetical protein	A0A0H3UZM4	Geobacillus_virus	3.2e-38	41.4

DBSCAN-SWA_5

2315744 : 2325960

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096465969.1\|2315744_2316302_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	8.4e-31	44.3
WP_096465970.1\|2316303_2316768_+	single-stranded DNA-binding protein	S5MNH0	Brevibacillus_phage	1.9e-36	51.0
WP_096465971.1\|2316802_2317021_+	IDEAL domain-containing protein	NA	NA	NA	NA
WP_096465972.1\|2317022_2317361_+	hypothetical protein	NA	NA	NA	NA
WP_157737947.1\|2317424_2318357_+	DnaD domain protein	A0A0S2GLI6	Bacillus_phage	1.1e-38	49.4
WP_096465974.1\|2318346_2318601_+	hypothetical protein	NA	NA	NA	NA
WP_096465975.1\|2318607_2319981_+	hypothetical protein	A0A1B1IQ90	uncultured_Mediterranean_phage	1.1e-07	25.5
WP_096465976.1\|2319988_2320321_+	hypothetical protein	NA	NA	NA	NA
WP_096465977.1\|2320322_2320727_+	hypothetical protein	NA	NA	NA	NA
WP_146226544.1\|2320747_2321764_+	hypothetical protein	A7XXK6	Thermus_virus	6.7e-10	25.1
WP_096465979.1\|2321766_2322036_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	6.7e-18	59.5
WP_096465980.1\|2322032_2322257_+	hypothetical protein	NA	NA	NA	NA
WP_157737948.1\|2322253_2322664_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_096465982.1\|2322660_2323179_+	Holliday junction resolvase RecU	R9TMF8	Paenibacillus_phage	1.6e-47	52.7
WP_096465983.1\|2323277_2323793_+	hypothetical protein	D6R425	Bacillus_phage	4.4e-50	56.5
WP_096465984.1\|2323918_2324362_+	ArpU family transcriptional regulator	D2XR57	Bacillus_phage	3.1e-28	48.3
WP_096465985.1\|2324575_2325271_+	hypothetical protein	NA	NA	NA	NA
WP_096465986.1\|2325285_2325960_+	hypothetical protein	A0A0K2FLT2	Brevibacillus_phage	1.3e-17	32.6

DBSCAN-SWA_6

3030480 : 3106785

Bacillus_phage(36.0%)

head,terminase,transposase,tail,portal,protease,integrase,capsid,plate

attL 3048311:3048331|attR 3105291:3105311

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096466615.1\|3030480_3031179_-\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_096467775.1\|3031327_3031798_-	hypothetical protein	NA	NA	NA	NA
WP_096466616.1\|3031918_3032878_-	asparaginase	NA	NA	NA	NA
WP_096466617.1\|3032892_3033864_-	YpdA family putative bacillithiol disulfide reductase	G3MA85	Bacillus_virus	1.5e-06	23.7
WP_096466618.1\|3033963_3035256_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_096466619.1\|3035547_3036141_-	genetic competence negative regulator	NA	NA	NA	NA
WP_096466620.1\|3036327_3037170_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_096466621.1\|3037368_3039672_-	pyruvate synthase	NA	NA	NA	NA
WP_096466622.1\|3039693_3040698_-	2-oxoacid:acceptor oxidoreductase family protein	NA	NA	NA	NA
WP_096466623.1\|3041125_3042043_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_096466624.1\|3042035_3043691_-	helicase-associated domain-containing protein	B2CRJ8	Acidianus_filamentous_virus	1.2e-16	24.4
WP_157738003.1\|3043743_3044469_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_157738004.1\|3044521_3045121_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_096466626.1\|3045107_3046682_-	ATP-dependent DNA helicase RecQ	M1PGQ0	Moumouvirus	4.4e-53	34.4
WP_157738005.1\|3046685_3047759_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_096466628.1\|3047968_3048178_+	ferredoxin	A0A127AYY7	Bacillus_phage	1.2e-11	47.8
3048311:3048331	attL	NA	NA	NA	NA
WP_096466629.1\|3048530_3048746_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	2.2e-19	66.7
WP_096466630.1\|3049044_3049404_-	hypothetical protein	NA	NA	NA	NA
WP_096466631.1\|3049708_3050254_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_096466632.1\|3050276_3050873_+	hypothetical protein	NA	NA	NA	NA
WP_096466633.1\|3051097_3051298_-	hypothetical protein	NA	NA	NA	NA
WP_096466634.1\|3051299_3052121_-	M15 family metallopeptidase	A0A127AWA8	Bacillus_phage	2.1e-38	50.0
WP_096466635.1\|3052136_3052382_-	hemolysin XhlA family protein	NA	NA	NA	NA
WP_096466636.1\|3052425_3052641_-	hypothetical protein	NA	NA	NA	NA
WP_096466637.1\|3052875_3053439_-	hypothetical protein	NA	NA	NA	NA
WP_096466638.1\|3053431_3053788_-	hypothetical protein	NA	NA	NA	NA
WP_096466639.1\|3053792_3056600_-	exo-alpha-sialidase	G3MAG8	Bacillus_virus	7.8e-16	28.2
WP_096467776.1\|3056599_3056899_-	hypothetical protein	NA	NA	NA	NA
WP_157738006.1\|3056913_3057573_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_096466641.1\|3057569_3058415_-\|plate	baseplate J/gp47 family protein	NA	NA	NA	NA
WP_096466642.1\|3058404_3058854_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_096466643.1\|3058843_3059272_-	DUF2577 family protein	NA	NA	NA	NA
WP_096466644.1\|3059274_3060255_-	hypothetical protein	NA	NA	NA	NA
WP_096466645.1\|3060264_3060912_-	hypothetical protein	NA	NA	NA	NA
WP_096466646.1\|3060915_3064485_-\|tail	tail tape measure protein	S5MBW5	Brevibacillus_phage	1.9e-14	28.0
WP_096466647.1\|3064688_3065099_-	hypothetical protein	NA	NA	NA	NA
WP_096466648.1\|3065165_3065609_-	hypothetical protein	NA	NA	NA	NA
WP_096466649.1\|3065612_3066965_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A2H4J187	uncultured_Caudovirales_phage	4.3e-20	28.3
WP_110546208.1\|3066945_3067149_-	hypothetical protein	NA	NA	NA	NA
WP_096466651.1\|3067181_3067676_-	hypothetical protein	NA	NA	NA	NA
WP_096466652.1\|3067672_3068113_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_157738007.1\|3068099_3068678_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_096466654.1\|3068693_3069287_-\|head,tail	phage head-tail connector protein	A0A2H4J8C5	uncultured_Caudovirales_phage	5.3e-07	61.9
WP_096466655.1\|3069310_3069724_-	hypothetical protein	NA	NA	NA	NA
WP_096466656.1\|3069775_3071014_-\|capsid	phage major capsid protein	A0A142K632	Streptomyces_phage	4.1e-102	47.8
WP_096466657.1\|3071014_3071665_-\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	4.4e-39	48.2
WP_096467777.1\|3071684_3073694_-\|portal	phage portal protein	A0A142K630	Streptomyces_phage	5.6e-109	34.3
WP_096466658.1\|3073733_3075428_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.1e-210	66.5
WP_096466659.1\|3075427_3075955_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.3e-49	64.1
WP_096467778.1\|3076054_3076450_-	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	1.5e-26	47.1
WP_096466660.1\|3076556_3077594_-	hypothetical protein	NA	NA	NA	NA
WP_157738008.1\|3077786_3078044_-	stage V sporulation protein S	NA	NA	NA	NA
WP_146226571.1\|3078594_3078819_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	9.8e-07	62.5
WP_146226573.1\|3078803_3078884_+	hypothetical protein	NA	NA	NA	NA
WP_096466662.1\|3078962_3079982_-	hypothetical protein	NA	NA	NA	NA
WP_096466663.1\|3080066_3080444_-	ArpU family transcriptional regulator	A0A2H4J748	uncultured_Caudovirales_phage	7.0e-13	38.8
WP_096466664.1\|3080455_3080707_-	hypothetical protein	NA	NA	NA	NA
WP_096466665.1\|3080879_3081080_-	hypothetical protein	NA	NA	NA	NA
WP_096466666.1\|3081173_3081425_-	hypothetical protein	NA	NA	NA	NA
WP_096466667.1\|3081444_3082149_-	hypothetical protein	NA	NA	NA	NA
WP_096466668.1\|3082242_3083571_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_157738009.1\|3083641_3084517_-	ATP-binding protein	A0A1B1P8D0	Bacillus_phage	9.4e-61	42.9
WP_096466670.1\|3084440_3085319_-	phage replisome organizer N-terminal domain-containing protein	A0A1S5SCN0	Streptococcus_phage	8.8e-43	55.8
WP_146226569.1\|3085469_3085673_-	hypothetical protein	NA	NA	NA	NA
WP_096466672.1\|3085952_3086228_-	hypothetical protein	NA	NA	NA	NA
WP_096466673.1\|3086354_3086852_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_096466674.1\|3086995_3087211_-	DNA-binding protein	A0A1B0T6C2	Bacillus_phage	2.2e-11	52.5
WP_096466675.1\|3087225_3087486_-	hypothetical protein	NA	NA	NA	NA
WP_172890899.1\|3087661_3088309_+	helix-turn-helix domain-containing protein	S5MAC0	Brevibacillus_phage	2.3e-11	31.1
WP_096467779.1\|3088625_3088835_+	hypothetical protein	NA	NA	NA	NA
WP_096466677.1\|3088827_3092310_+	NACHT domain-containing protein	NA	NA	NA	NA
WP_096466678.1\|3092664_3093594_-	hypothetical protein	NA	NA	NA	NA
WP_096466679.1\|3093786_3094275_+	hypothetical protein	NA	NA	NA	NA
WP_096466680.1\|3094334_3094826_+	DUF3993 domain-containing protein	NA	NA	NA	NA
WP_096466681.1\|3095144_3096698_-	hypothetical protein	NA	NA	NA	NA
WP_096466682.1\|3096794_3097499_-	DsbA family protein	NA	NA	NA	NA
WP_110546202.1\|3097935_3098790_+	thermonuclease family protein	A0A1P8CWK6	Bacillus_phage	1.4e-37	51.1
WP_096466683.1\|3098814_3099120_+	hypothetical protein	NA	NA	NA	NA
WP_096466684.1\|3099230_3099644_-	DUF1842 domain-containing protein	NA	NA	NA	NA
WP_096466685.1\|3100512_3102999_-	S-layer homology domain-containing protein	A0A222ZEQ0	Arthrobacter_phage	1.3e-06	60.3
WP_096466686.1\|3103452_3103989_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_096466687.1\|3104152_3105283_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	6.6e-83	45.2
WP_157738010.1\|3106551_3106785_+\|transposase	transposase	NA	NA	NA	NA
3105291:3105311	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3165168 : 3171695

Staphylococcus_phage(57.14%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096466773.1\|3165168_3165750_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.4e-17	33.7
WP_096466774.1\|3165761_3166505_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	7.8e-08	30.4
WP_096466775.1\|3166523_3167162_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_096466776.1\|3167328_3167796_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.8e-42	57.7
WP_096466777.1\|3167816_3169010_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.1e-110	51.3
WP_096466778.1\|3169024_3169675_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.8e-33	38.9
WP_096466779.1\|3169659_3170775_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.5e-60	39.5
WP_096466780.1\|3171257_3171695_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	5.8e-19	44.0

DBSCAN-SWA_8

4039591 : 4049486

Prochlorococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096467503.1\|4039591_4041133_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.2e-76	52.0
WP_096467504.1\|4041163_4041769_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.0e-26	36.7
WP_096467505.1\|4041768_4042809_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	3.0e-66	43.8
WP_096467824.1\|4042821_4044246_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.1e-53	34.6
WP_096467506.1\|4044242_4046543_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-169	43.4
WP_096467507.1\|4046451_4047144_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_096467508.1\|4047147_4047396_-	phosphoribosylformylglycinamidine synthase subunit PurS	A0A1D7SRI3	Cyanophage	8.9e-09	38.8
WP_096467509.1\|4047388_4048108_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	4.5e-45	42.5
WP_096467510.1\|4048190_4049486_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.7e-18	24.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage