CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP017422	Filimonas lacunae strain NBRC 104114	2 crisprs	cas3,csa3,DEDDh,WYL,c2c10_CAS-V-U3,RT	2	2	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP017422_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP017422_1

1324738-1324928

Orphan

Consensus_repeat	Method
GGCGGCGGCGGTGGATACCGTGGCGGCAATGGTGGCGGTGGAGACCGTGACCGTGGTGGCGA	PILER-CR

2 spacers

The CRISPR arrays of NZ_AP017422_1

>merge|NZ_AP017422|1|1324738-1324928|PILER-CR
GGCGGCGGCGGTGGTTACCGTGGCGGCAATGGCGGCGGCGGTGGATATCGCGGTGGCGATGGTGGTGGTGGCGGTGGATACCGTGACCGTGGTGGTGAAGGCGGTGGTTACCGTGGTGGAAGTGGAGAAGGCGGCGGCGGTGGATACCGTGGCGGCAATGGTGGCGGTGGAGACCGTGACCGTGGTGGCGA

>NZ_AP017422|1|1|1324738-1324928|PILER-CR
GGCGGCGGCGGTGGTTACCGTGGCGGCAATGGCGGCGGCGGTGGATATCGCGGTGGCGATGG	TGGTGGTGGCGGTGGATACCGTGACCG
TGGTGGTGAAGGCGGTGGTTACCGTGGTGGAAGTGGAGAAGGCGGCGGCGGTGGATACCGTG	GCGGCAATGGTGGCGGTGGAGACCGTGACCG
TGGTGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP017422.1\|WP_076382609.1\|1327678_1329331_-\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|225828
NZ_AP017422.1\|WP_076382608.1\|1329350_1330775_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374525
NZ_AP017422.1\|WP_076382619.1\|1312637_1314071_+\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	unknown	unknown	gnl\|CDD\|185760
NZ_AP017422.1\|WP_076382616.1\|1319659_1320946_+\|WG-repeat-containing-protein	unknown	unknown	unknown
NZ_AP017422.1\|WP_076382613.1\|1323313_1324273_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197761
NZ_AP017422.1\|WP_076382606.1\|1331607_1333089_-\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	unknown	unknown	gnl\|CDD\|185760
NZ_AP017422.1\|WP_076382617.1\|1319110_1319509_-\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679
NZ_AP017422.1\|WP_076382603.1\|1338540_1339383_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
NZ_AP017422.1\|WP_076382621.1\|1307640_1308837_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|226235
NZ_AP017422.1\|WP_076382605.1\|1336693_1337875_-\|FecR-family-protein	unknown	unknown	gnl\|CDD\|377406
NZ_AP017422.1\|WP_076382614.1\|1321434_1322331_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_AP017422.1\|WP_076382604.1\|1337928_1338489_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274376
NZ_AP017422.1\|WP_084206554.1\|1333107_1336458_-\|SusC/RagA-family-TonB-linked-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274948
NZ_AP017422.1\|WP_159445198.1\|1330781_1331591_-\|DUF4843-domain-containing-protein	unknown	unknown	gnl\|CDD\|374383
NZ_AP017422.1\|WP_076382610.1\|1326537_1327671_-\|AhpC/TSA-family-protein	unknown	unknown	gnl\|CDD\|239264
NZ_AP017422.1\|WP_076382670.1\|1316859_1319004_+\|glycoside-hydrolase-family-97-protein	unknown	unknown	gnl\|CDD\|371140
NZ_AP017422.1\|WP_076382618.1\|1314102_1316559_+\|zinc-dependent-metalloprotease	unknown	unknown	gnl\|CDD\|379818
NZ_AP017422.1\|WP_076382615.1\|1320949_1321435_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_AP017422.1\|WP_076382611.1\|1325126_1326458_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_AP017422.1\|WP_076382620.1\|1308948_1312620_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274948

Protein	Function_ID	Function_description	E-value
NZ_AP017422.1\|WP_076382609.1\|1327678_1329331_-\|PKD-domain-containing-protein	gnl\|CDD\|225828	COG3291, COG3291, FOG: PKD repeat [General function prediction only].	4.01301e-08
NZ_AP017422.1\|WP_076382608.1\|1329350_1330775_-\|hypothetical-protein	gnl\|CDD\|374525	pfam16407, PKD_2, PKD-like family. This is a PKD-like family of proteins found in various Bacteroides species.	3.49962e-29
NZ_AP017422.1\|WP_076382619.1\|1312637_1314071_+\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	gnl\|CDD\|185760	cd08977, SusD, starch binding outer membrane protein SusD. SusD-like proteins from Bacteroidetes, members of the human distal gut microbiota, are part of the starch utilization system (Sus). Sus is one of the large clusters of glycosyl hydrolases, called polysaccharide utilization loci (PULs), which play an important role in polysaccharide recognition and uptake, and it is needed for growth on amylose, amylopectin, pullulan, and maltooligosaccharides. SusD, together with SusC, a predicted beta-barrel porin, forms the minimum outer-membrane starch-binding complex. The adult human distal gut microbiota is essential for digestion of a large variety of dietary polysaccharides, for which humans lack the necessary glycosyl hydrolases.	3.50687e-34
NZ_AP017422.1\|WP_076382613.1\|1323313_1324273_+\|hypothetical-protein	gnl\|CDD\|197761	smart00497, IENR1, Intron encoded nuclease repeat motif. Repeat of unknown function, but possibly DNA-binding via helix-turn-helix motif (Ponting, unpublished).	1.18079e-07
NZ_AP017422.1\|WP_076382606.1\|1331607_1333089_-\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	gnl\|CDD\|185760	cd08977, SusD, starch binding outer membrane protein SusD. SusD-like proteins from Bacteroidetes, members of the human distal gut microbiota, are part of the starch utilization system (Sus). Sus is one of the large clusters of glycosyl hydrolases, called polysaccharide utilization loci (PULs), which play an important role in polysaccharide recognition and uptake, and it is needed for growth on amylose, amylopectin, pullulan, and maltooligosaccharides. SusD, together with SusC, a predicted beta-barrel porin, forms the minimum outer-membrane starch-binding complex. The adult human distal gut microbiota is essential for digestion of a large variety of dietary polysaccharides, for which humans lack the necessary glycosyl hydrolases.	9.36118e-21
NZ_AP017422.1\|WP_076382617.1\|1319110_1319509_-\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	5.92824e-25
NZ_AP017422.1\|WP_076382603.1\|1338540_1339383_-\|SDR-family-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	4.97216e-77
NZ_AP017422.1\|WP_076382621.1\|1307640_1308837_+\|FecR-family-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	1.08553e-15
NZ_AP017422.1\|WP_076382605.1\|1336693_1337875_-\|FecR-family-protein	gnl\|CDD\|377406	pfam04773, FecR, FecR protein. FecR is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognizes iron dicitrate in the periplasm.	8.6311e-20
NZ_AP017422.1\|WP_076382614.1\|1321434_1322331_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	4.46104e-69
NZ_AP017422.1\|WP_076382604.1\|1337928_1338489_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274376	TIGR02985, Sig70_bacteroi1, RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.	2.78461e-37
NZ_AP017422.1\|WP_084206554.1\|1333107_1336458_-\|SusC/RagA-family-TonB-linked-outer-membrane-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	6.17233e-170
NZ_AP017422.1\|WP_159445198.1\|1330781_1331591_-\|DUF4843-domain-containing-protein	gnl\|CDD\|374383	pfam16132, DUF4843, Domain of unknown function (DUF4843). This family consists of uncharacterized proteins around 220 residues in length and is mainly found in various Bacteroides species. Distant homology analysis suggest distant relation between this family and other families of proteins with immunoglobulin-like folds, which are often involved in substrate binding. However, specific function of this family is unknown. There is distant homology to the Calx-beta family pfam03160.	2.14407e-53
NZ_AP017422.1\|WP_076382670.1\|1316859_1319004_+\|glycoside-hydrolase-family-97-protein	gnl\|CDD\|371140	pfam10566, Glyco_hydro_97, Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.	6.8219e-142
NZ_AP017422.1\|WP_076382610.1\|1326537_1327671_-\|AhpC/TSA-family-protein	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	4.9164e-39
NZ_AP017422.1\|WP_076382618.1\|1314102_1316559_+\|zinc-dependent-metalloprotease	gnl\|CDD\|379818	pfam16313, DUF4953, Met-zincin. This is a family of uncharacterized proteins that carry the highly characteristic met-zincin mmotif HExxHxxGxxH, the extended zinc-binding domain of metallopeptidases.	2.65294e-136
NZ_AP017422.1\|WP_076382615.1\|1320949_1321435_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	4.82443e-17
NZ_AP017422.1\|WP_076382611.1\|1325126_1326458_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.15089e-35
NZ_AP017422.1\|WP_076382620.1\|1308948_1312620_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	6.24501e-143

>NZ_AP017422.1|WP_076382613.1|1323313_1324273_+|hypothetical-protein
MINEKPTTAVPAYKDDCLEDRPGEVWKEIPGLSGDFLVSNCGRIKRVARQVVDAQGGMYTLPAKIRKAQVNKDRNMRCHDWTYRLQVVLQLRNVKYSFQVARLVYHCFVQTFNLKDATVNVTTKNGNGLDLRPENLLLVSLSEKAQRPYDTGRQLSHLQTDKYKLLEIVNASREKTSLMISQYDGSGLWMKTYPSIMDAYRTTGISYGNISKAVKRPASKAGGFYWRYGDGNKINLKEVHEHEKRRQRSYKEKQGRKVTQFDLEGNPLAWYSALSEAAKKAKISHKSITTHLKGITRHAGGFLWKLGHHREKVLFSIAN
>NZ_AP017422.1|WP_076382614.1|1321434_1322331_-|pirin-family-protein
MSHIDLIIEERPADIGNFLVGRLLPFRGKRMVGPFIFIDHMGPVRLDDHHNMDIGPHPHIGLSTLTYLFEGNIMHKDTLGTEVEVKAGEVNWMTAGKGIVHSERTPDYLRHSDKPLHGLQIWVAMPKELEQMHPEFYHVSKEDIPTWEKDSVSYKLIAGSALGHNSPVPVYSKLFLLEIKSTTRQTIQVGHELFGEAGMYILEGSVESEGNVYEPKRILVAKDSSLCQFTMEAGTTIYLFGGEPFPEERYIYWNFVSSSLDIIEKAKEDWKTQRFPTIPGETGYIPLPEANPLVKQKK
>NZ_AP017422.1|WP_076382615.1|1320949_1321435_-|GNAT-family-N-acetyltransferase
MTIQQLNNSHSQQIVNLILPIQQIEFNVPITLEKQQDLLDIEKHYIGPGGNFWGVIHDNEVVGTIALIATGHNAGAIRKMFVKKEFRGKELGIAQQLLDELLRYCQQNNITDLYLGTVEILKAAHRFYERNGFQKISKEDLPDYFPFMQPDTIFYHLHMQA
>NZ_AP017422.1|WP_076382616.1|1319659_1320946_+|WG-repeat-containing-protein
MKLRVFLPLLCIGVSAKAQTRFYPYFDKTAWGVANERKEVVIAPQFDTIICERGGVLKLGHSKNVSTTSGAVIFPDTYTQLEMIKGAAEIKATTAGGEEVLLSIKTGKLAGSKAFTRILSYCGCQQAFYAVKIGDKVGVYNVATDAMAVQPEYDNVEFMGGGWTGMVDVVTGNKHGVLEVASGKLVLPVEYEQLEWDVFSSKKEVKATAASGIIYTMDETGAVLLADSSIVKARIAAAKPKKPATQARTTLVKHMETPEPGGSIMVNTSLKAEDRANGLSVEKVSDDSWKVTTRYMDYNDKSAAETLELTGYSQLKPIEYRKTNKGSAKLMAVKEGKAGIIDATGKVLLAFNYDSIDCERSRYWVYTSLNGKTGLVRTSTLIEVKKPVLKQVIKNVISLSAFLVEMPDGKKGYMDEENGTLYIPGVVE
>NZ_AP017422.1|WP_076382617.1|1319110_1319509_-|OsmC-family-protein
MTQISATIGTELYRMQIQTATNALIADEPEELGGQDLGFSPADLLAASLGACTCATLRMYADKKGWDLTDVQADVTFERDFANNQSHFTRTITLTGNLDEEQRQRLLTIANNCFIHKTLTNPIDIATSLSPL
>NZ_AP017422.1|WP_076382670.1|1316859_1319004_+|glycoside-hydrolase-family-97-protein
MRKTILLVCICFLCTLVKAQDVTSPDKNFVLKFTLQSQGVPAYSLTYKGKEVIKPSHLGLELKNSTSLLDSFEVAEAKTATFDETWSPVWGEVKQIRNNYNELAVRLHQTSTDRFIVIRFRLFNDGLGFRYEFPQQKKLDYFVIKEEKTQFALAGDHKTFWIPGDFDTEEYSYVTSNLSEVRGKMKEAVTPNCSQTTFSPTGVQTPLMMKSKDGLYINIHEAALINYAALNLNLDDKNMVLESVLTPDAVGDKGYLQAPCLSPWRTVVVSDKAGDILESKLILNLNDPATVKDADSWVKPIKYIGVWWEMITGKSTWSYTNIENVQLGITDYSKLPPNGTHGATTAHVKEYIDFAAKHGFGGVLVEGWNEGWEDWFGKTKDYVFDFVTPYPDFDVQELHRYAASKGVKIIMHHETSGSIRNYERHMDTAYKFMVANGYNAVKSGYVGNMIPRGEHHYGQWLVNHYLYAIDKAAKYKIMVDAHESVHMTGLSRTYPNLLAQESARGTEYESFGGNNPDHTTILPFTRLMGGPMDYTPGIFQTRINAINPNNNSWVRSTLTRQLALYVTMYSPFQMAADLPENYNKFLDAFQFIKDVAVDWDDSKVLEAEPGDYITYARKAKGTNNWFIGSTCDENGRTSKIDFKYLDEGKKYIATVYSDAKDAHYEKNPQAYTIRKGIVTNKSDLSLLCAPGGGYAISVIEVTDANALKGLKPLK
>NZ_AP017422.1|WP_076382618.1|1314102_1316559_+|zinc-dependent-metalloprotease
MKKVMALAALTAAIQAGAQDKTKVVTKDSAVVSKPAASGIQAYDKVITKGAISRPGMFTVHLVDNKYFFEIPDSLFNRDILTVTRYVATPEHLKLYGGEKVNEQTLYFEKGAQNKVFLRVDLFYVATKDSTEALYKAVQTANVKPIAAAFDIKAINPANGNVVIEITDFFRKDNSVVSFQAEEKSEIKLGGLADDRTFIHSIRSYPINIEVRTTKTYTTSSSATPAGSAAGALTFELNTSMVLLPKEPMRKRLFDERVGYFANKYILFDDNAQSTKDFSTIQRYRLEPREEDLEKYKRGELVEPKKQIVYYIDPATPKKWRPYLIAGVNDWQKAFEQAGFKNAIVAKEWPEQDSTMSMEDARFSVIRYFASETANAYGPRISDPRSGEIIESHVGWYHNVMKLVHDWYMIQAGAIDPRARKMEFDDELMGDLIRFVSSHEVGHSLGLRHNMGASSQTPVEKLRDKAWVEANGHTVSIMDYARFNYVAQPQDNIGKAGIYPRIGMYDKWAIQWGYKNIFNTPDEYADRMVLNKWIIDSLKTNPRLWFGGEGKGEDPRSQTEDLSDNAVKASDYGIENLKRIMPLLPEWTAEEGDMYNNLQRIYKRASAQYLLYVTHVMKNLGGGMYVTQKSTEEAGNVYEYIPKERIKAAIDFMGRQVMQPPLWLYPAAISNKIKLNAMEEIGNLQNNFLNTLLNPGLLYNVLQASFANKDAFTVTEYLNEIKKMAWKPLSGNAELDAYQRNIQRIYIERLAMILKPKSIEEGKMLTNAERSDARIYAKMHLVQLKNELTTMPAASAIQAEHKKELITQINKILTNAAK
>NZ_AP017422.1|WP_076382619.1|1312637_1314071_+|RagB/SusD-family-nutrient-uptake-outer-membrane-protein
MKKNLAYYIVLALLTIPAMSCKKYLDLTPTGKSIITSASDYYNLLSLPNRGYPISGNIQYLNDENYLKESSILSLTKGIMTISFYFDSSESRVNYLTASSLYNQAYKYINRWNMVYSLVDESEGEESVKKLAKAEAQVLRAFDHFILVNVFARPYSATAATDGGICIMDKYDIEAKPVKSTVAEVYAFIEKDLDEALPYLQVTPKDVYHPSLAFAWAFKAKVHLFKREWQKAKDAALKALSYNSSLLDLVAYTKAGGPTTVLMPAGSNPETLSYMYVNGYTEMSSAYTFMISPELRALFSGNDTRFKYFFDTTSTTFLDVAAKAAYWKVKYTSFFRPTVGIQVPEVYLTLAEAYARLGELEDAMKYLNALRVKRISDVAEATLATPATIKETMDFIITERRKELMFGYNRFFDLKRYNLDAEYAKTVERKFPLVSTSVPQVTYKLPPNSKLYVIPFSQDVLKKNTSLTINTDETLPW
>NZ_AP017422.1|WP_076382620.1|1308948_1312620_+|SusC/RagA-family-TonB-linked-outer-membrane-protein
MAHCFLLKRTFTTKMLGLFIAAMLAGVVGMAQTINYTGDKVSVEKLLGVIKQQTGYSVMFNPDLLSKANPVTIEAHAMPLKEFLDKILAGNTLSYTIENKTIFIKKGVDHSKMDHSKMDHSGMAMMRIFKVRGKVVDENGKPLSGVSVSLDNSSFGIATDVKGNFELEDVKKISTITFNHLGYLKSTVSIAACCTDGSTLPAGVNASVANDNVTMTINVAMTADVKSLDDISVVNNGFQVVTRERSTAAAAKVTNAELNTQLNTNLSSALEGKAAGLSMYRGQPLLRGVGTFSQEVGTQPLLVIDGLPTGGDLNSINIYDVESVTLLKDAAATSIYGAVAANGVLVITTKRANKGSTQVSINADYFISTKPDMDKMHYATTGQMLDYETDVYNFKRKAYSGTTSEFFNSFGYIDNAGKLNNSISYYSPLYDLYRKQNDGKVTSAQVDSTLSQWRNNDFINEYTQKVWRNEVKRRYNLAVSSATDKNNSYFSINYEGNQLRTIYNKNDNVNLYLKNTFTPVKWLSATVGINGYYTDAVETNTSYNDYMIQPRYAAMEDASGKKVYADYIKTSDALNSNIAAYLATSSNFKNTRFNLLDEIGKGLTKTKALRLRAFTDINVKLPAGFSYNMKLQYETNKTEETTYDEADSYVMRMLYNRYTYYNSTALTWNHAIPDGARLTRLNPTSRNYTFRNQLNYFKQFNTAGKNSDITALVGTEIRESASNTGNTSVLYGFNPVTLASTTVDWNTISVTGINTFLYGTSRASYIPANYDQTIHRFFSMYGNAGYTFDGKYNLTGSVRVDQADLFGTDPKYRYRPMWSAGGGWNVTQEEFMRRIHWVDYLKVRVTYGIAGSVDRSSSPFIVGAAKSDKLYTGLQYTDISDLPNPKLRWEKTTTTNLGLDYTLFHNKLTGSIDYYVKRGSDLFATVALDPTVGASSMRINNGIISNKGIEVKIGSDWLKKKDLVLTSTFIIAFNKSNVVTTGAITTSAYDRIGSPTVYYEANTPYNSVYAYKFANITNGYPTFYDEKGTNNVTFATDGTPTVKQISSVSAISRVGTFIPVFNGSFQQGVFYKGFQLNALFAFYGGHKLRKDVVSLDGYDQTDRAIANRWSESNPDGLRLQIDYPTTASTSAAGNLSQYYRYSDVNIASASFVRLRNISLSYTLPVQVCRQLHMKGVKFTAQANNLWLWSAVGNDIDPETYSLSSGTRSVPTSKTFLFGASLTL
>NZ_AP017422.1|WP_076382621.1|1307640_1308837_+|FecR-family-protein
MSEQTHYTNSYYNELAHKWSTGTITAEERQILEQWYSQEQDAAVTVPAELAVSEAVHEAQLLQKIQQRIAAEHSATPVRTLRSRNYWWAAAAVILLLCAGGYIWQTQTRQQQVPTAKVKVQDIAPGKAGAILTLADGSTMVLDSMPNGVITTQQGTQVVLKNGQLAYQQAAGSATATGSNTITTPRGRQFVIALQDGTNVWLNAASSLTFPTAFTGKDRVVSVTGEAYFEVAKTGTGAVNRPFKVKVNNQAEVEVLGTQFNVNAYADEAGMQTTLLQGAVRISANNDSKVLKPGQAAKIPAGNTAGITVVKHADTEQAIAWKNGSFYFKERTGIEEVMRQLSRWYDVEVVYVDGIPNAVFTGEMERTLSLMQMIKGLDNMGVRFTIEGRKLLVSSDSK
>NZ_AP017422.1|WP_076382611.1|1325126_1326458_+|HAMP-domain-containing-histidine-kinase
MQITTTLTNLWHWLIGTRPSFSKANIAFNTIGIITLMILLVFLPFNLAMGLGNIAVSLILLITLQLVFYYFSRFRKQYSVSIICYAIVSYIAMAALFFFNSGSKGPTIFLFFLTFQLLIAFSANRWHFVWFIAHFLVIPMLMLIEYFKPEWVPDTYGTRKDYFIDLVVSYLVILVGIYWITNYLRKNYLRKKNIVDEYAAKIEQQHREILVKNAQLEKLNQEKTKLFSVVSHDLRTPLAVAVSLNELINDFPLEETERMQLQRELYELAKNTLDMFNNLQAWSSGQLKGGVRVNLGKVQVKPVVDKVVLAQQLFAAKKQVKMNVKVHEDFAVTADMDMLELIVRNLVQNAIKFTPVSGEIHIEHVTEDGRGIITIRDTGVGMTDQQIQNLFTLQLSPSYGTGNEKGSGIGLHLCKEFVLLQEGEIWVDSVINKGSAFYVALPV
>NZ_AP017422.1|WP_076382610.1|1326537_1327671_-|AhpC/TSA-family-protein
MKKQLLTPLALLPLLVAAQAPNFTVTGKIGHLNAPAKVYFDYMDDGKSKSDSAFVKDGAFRFTGHTSPYSYVRMGLSHDGSGKQRAVYGGDVIYFYMGKEKVKIQSADSLIHATISGSKVNEEYNAYNRFIGGTIMELTKAVNIAFSSGTAAQQKDTAYFQTIDKQYRQNIANRATKQIEFAQQYPNSYFSVIALSEAGGMKGVSSVETLYNNLSEELRNTDPGKELAQRINAAHTIVEGATAPAFTQNNINGQPVTLNSYRGKYVLLEFWASWCSPCRAENPNLRKQYAQYKDKGFEVLGVSLDDDKQKWAQAIEADQLPWTHVSDLKGWNNEVGRLYGIRAVPASFLLNPEGKIIGINLRGETLNNKLATIWPQE
>NZ_AP017422.1|WP_076382609.1|1327678_1329331_-|PKD-domain-containing-protein
MKKQVWYTALATLSIITATATGCNKKEAVDSGSQKAPTADFNFTIGANTALPVSVQFTNTSKNATSYSWDFGDGTTATTADVQHTYKAGGSLKVKLIAYNNFGKDSMMKELGIAGGEESPVAWQEHWGEHAQLVKRMYVSNNVAVYYDDDVNRVVTWPFDFFDNVWSYTKRVYGDFGKNISKDDRLYVILHTDKYYGGHPAGYVDDSHDYRNVIDLGASGGKNAWVDKAGWNIGASVHEIGHIVEGCSYGVKESPAFDIWGDSKWAEIFVYDVFKGVGLTTEAASTYDECMNISDTYPTAGSQWFRDWFYPIYSKYGESKALAKFFQLLSQYFPKSKFDAVYLYDRRMNMGEFIHFYSGAAGTNLQPLAAKAFGWNSDWTTQLNNARSAYASITYSGSGDALVIPGADVNITTSSTFTVSQENAGGATASEGSNQLLDNNADTKFSAGFTSGFTFNFQLKSAAAVNSYTLTSGDGDSSNDPKTWTFEASNNGNSWTKLDEQTTQWFPGRKQFRRFRFSNTNTYQYYRLVVNSTRGSSNIQLSETGIWKTN
>NZ_AP017422.1|WP_076382608.1|1329350_1330775_-|hypothetical-protein
MKRIHILTFLLLAAFITSSCYKDKGNYTYSKPEAPAINNLDTLYYAVVGDSLVIDPKVTIGNAAHLSLEWKIGGPDLESDLVYTGDQLRIIFSLGATHYDGHLTITNNDNGMKYFKDFSIQGRTDFSTGTTVLSKENGITQLSFIKNDGSIRPRIYEALNGAALPNNPTRLLGLIKENIVPRAVTSYWIITNDGVNGGVQVDANNLKKIKTLANNYFDPPSSLTVNNLEDNTSGTLQGVIDGKFVWGYDLTWNQAPIYGMFGVPLEGDYQLSPWFIYNNAATPFYIGYDVNTKSFLRINLYGTPVFFGTNYESIDTAGAFDPKNVGLDLIHMKQINNNYCYAFGKDASGTLYELRFVVNFNGPFTFTTNYKRAFKQPELITANTKWQSTDDRIFYFSSGTKVYRYNPESQTIQPLAADFGSKEVSMLKLLNQNTLVAGIDNKLLYLDIQTGSSGNIIKTIEGIPGTPIDIYQRD
>NZ_AP017422.1|WP_159445198.1|1330781_1331591_-|DUF4843-domain-containing-protein
MKKIFFVLLFIQPLFFSCKKADELLYDSADNICFNFLEKQKDSIIYTFAYTPEKAFDTIFLPVRISGLQRPFDRKFVLTVMQDSSTAQEGLHYEALKDYYIMPADTGKTKVPLIIYNKDAALIENSVSIRLLLQSSGDFGANILTAIKGKVVFSATLERPDWWGSWPLGTYSRTKHQLFIIATGVTTLTTSGLDAPKNLYLVSLLTSLLNDPFTWVKRNSDKGYVIEALAGSNDYYFYSTSNPAKKFLYRKDDAGAGYHFIDEKGLLIN
>NZ_AP017422.1|WP_076382606.1|1331607_1333089_-|RagB/SusD-family-nutrient-uptake-outer-membrane-protein
MKKYWIALVATSILLGSCNKWLDIQPEAQVSEDQLFSTEEGFEESLNGIYTRCIQTDIYGEELTFGLPEVLAQNYTLYSFNGLAPELDYSEDVIYNFTNSRFIARKDKIWQGLYNAIGNCNLLLKNLELKKTLFTPSRYALLKGEALGLRGYLHFDALRLFAPSYTSNPVAKAIPYVVTFTDAPTPLSTVSETLDKIVTDLKEAKALLAPVDSIAKASYVVGYESDPTVTENSAPFLFLQNRRNRMNYYAVCGSLARVYLYKDDKINAALNAQEIIDAKKFPWTTKADFINSNAALKDRINYKEVMFGWPIPKQEENLVKRFKVFTFSKTDGDILYEYPGIAAEDNRYKEWLLLNSTNSTYELQKYVRNQNAKTDDATTNRHPLTAPAIRLSEMYYILAECTYDTDPTKANALVDSVRYHRGIGIPFTASSKAEFLDGLVREARKELYAEGQIFYMYKRLNKSIIGPAGRIYPAGYNIFVLPLPNDEIEYGGR
>NZ_AP017422.1|WP_084206554.1|1333107_1336458_-|SusC/RagA-family-TonB-linked-outer-membrane-protein
MQLTAVLLLTCCLQVAGAAVAQKVTLSENNASLKKVLNAIKKQTGYAFFLNEQIVEKGQPVTIDVQNMPLEQVLNQCFQNQPLTYHIVNKTIVVSAKTERNATFLLQAATPPVVVSGKVTDGVNNAPVESATITVKGTKKRTVTNKEGNFTIDAEPGSILVISFVGFENREIAITDARFLSIALTPKAKEAPLDDVVITGFQRIRKESFTGTAISVSGEDLKKMNPQNILQSIQVFDPSFKIVQNNVLGSNPNRLPVINVRGNTAIPTGSNEVLSRSNLTGNTNLPTFILDGYEVSLEKVYDLDINRVQSITLLKDAAATAIYGSRAANGVLVITTIPPQEGKLQLSYNYELNPTTPDLSDYHVLNAADKLEYERLAGLYDANKNQALTQSQLDRLYYSKKENVVGGVNTYWLSQPLQTGFGQKHSAYLEGGNKSIRYGLELRYHTMPGVMKGSERNRYSAGMNLSYSPDNRFIFKNTLTVTQVDTKESPYGNFADYVKTNPYYAKTDSVGNTVRELETWQRREGANMAIENFTMLNPMYNATLKSFIKSAYLELIDAFSAEWNINKSLRLRGQLSVNKTKYTADDFASPLANEFYYYSTNDYKLKGRYIYNTSDMTSVDGNLLVSYNKQAGNHFINFTAGSNFRTSNTDNKGFTAVGFTNDRFSNIGYAGSYPDGSTPQSSHPQTRLASVLASVNYTFANKYLMDLSYRLDGSSTFGKDQRMAPFGSIGLGWNLHKEKFFHNTSVSQLKIRASTGITGSVSFPPFMGITSYNYYTNQWYATGIGASVSSLGNDELKWQKTTNYDAGFDLGLFNDKIFISPRYYYKYTKGLLSNIILAPSTGSTGKMANLGDMQNTGWEVNIKATVFKNNKWNVGIFTNLTGNKNKIVKISNSLKKYNDKADAAQESDDYKGVPLLRYNEGQSTDAIYAVRSLGIDPENGKELFLKRNGQTTYEWDVKDILPIIDATPKAYGYFGASAAYKNFLVTATFYTRFGGYDYNQTLVDRIENADPRYNVDQRVFDEKWKKPGDHTFYKNISDLGQTQTSSRFIQKDNVIELSSLYASYDFNKVVISRLGMKTLRLAVTMNDIWRWGSVKLERGLEYPFARNLTFSLQTRF
>NZ_AP017422.1|WP_076382605.1|1336693_1337875_-|FecR-family-protein
MQQWNKAALSRLANKYIQGTATEAEIKELQQWYHAFDENDLTVIVPAESEEEEAITEARMRQRLQDIIHTPAIPATRRYKWISYAAAAALLTAIGCIVFYINKHVAPPSLQKKELAGKPTSTVQPGGNKATLTLADGRIIVLDNKQKDTIGNQNGSLIIKLNNGRLAYQPHDIPAGIPLLPAYNTITTPKGGQYQVTLPDGSIVWLNASSSLRFPATFNGKVREVNLTGEACFEIAPNATMPFIVKTHNLQVNVLGTLFNVMAYADEPAIKTTLISGKVGINTGNGVADKILKPGQQALLPPGVDMKIISDVDVEEVLAWKNGRFRFQEADAKAVLRQIGRWYDIEVAYAGDVPNEKFTGEIPRNSSIEEVITILKLSNIRCSLSDRTLIVKP
>NZ_AP017422.1|WP_076382604.1|1337928_1338489_-|sigma-70-family-RNA-polymerase-sigma-factor
MTTHPQYSKEELVLLLRSGNEHAFNQIYTLYWRKLYALAYQRLRNKQAAEDVVQEVLAGVWQRRTTSLINNLEAYLATATRYAVIRQLGKEHAVTTETEQASDLTTDEMHDTRLLWHTLQKEIHKLPEKCRLVFQYSRELGLTNKEIADSLDISQKAVEKHITKAIRALRDHLKLFSFYVIKIFSF
>NZ_AP017422.1|WP_076382603.1|1338540_1339383_-|SDR-family-oxidoreductase
MSFALVTGAAKGIGRAIAAQLAKKQYHLLLVDIDNENLAQTAAALTQQYAIQVYHLHLDLSAPDAMERLTIFTSPYHQHLSVVVSNAGYGLNGAFEQLTLAEQLNIIDVNIKAQVSISHAYLPVLRAQTVGYLLNLGSTTAYQTVPYLNIYAASKAFAVSFTRGLRYELRNSNVSVSCLSPGSTDTDFVNRARMGDSIKKTAERFNMTAEKVAEIAIKGLFKGKAEILPGFLNKLNAFLPKFFPKTLVEKIAGNIYEPKTSVVKAPAHFTTAVHGKVSTE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP017422_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP017422_2

4141580-4141716

Orphan

Consensus_repeat	Method
GCCATTCTGGAATGTTGACCCACCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_AP017422_2

>merge|NZ_AP017422|2|4141580-4141716|PILER-CR
CCATTCTGGATGTTGACCCACCCGTTTAGAAGGTTTTTCTGGGATTCGTTTTTTAGCGATTCTGGAATGTTGACCCACCCCCAACCGTAATTCTGGTTACGAAACACCATTGTCATTCTGGCATGTTGACCCACCCG

>NZ_AP017422|2|2|4141580-4141716|PILER-CR
CCATTCTGGATGTTGACCCACCCGTT	TAGAAGGTTTTTCTGGGATTCGTTTTTTAGC
GATTCTGGAATGTTGACCCACCCCCA	ACCGTAATTCTGGTTACGAAACACCATTGT
CATTCTGGCATGTTGACCCACCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP017422.1\|WP_076377447.1\|4140172_4141336_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_AP017422.1\|WP_076381572.1\|4144112_4144544_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|131478
NZ_AP017422.1\|WP_076381571.1\|4145726_4147724_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|227038
NZ_AP017422.1\|WP_076377451.1\|4138430_4139525_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_AP017422.1\|WP_076381566.1\|4155683_4156421_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_AP017422.1\|WP_076377449.1\|4139619_4140042_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|334619
NZ_AP017422.1\|WP_076377461.1\|4134167_4134587_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378192
NZ_AP017422.1\|WP_076378409.1\|4137772_4138354_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_AP017422.1\|WP_076381570.1\|4147727_4151285_-\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|378996
NZ_AP017422.1\|WP_076381569.1\|4151288_4154555_-\|helicase	unknown	unknown	gnl\|CDD\|197275
NZ_AP017422.1\|WP_076377457.1\|4136187_4136514_+\|TM2-domain-containing-protein	unknown	unknown	gnl\|CDD\|377473
NZ_AP017422.1\|WP_076383021.1\|4141772_4143317_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_AP017422.1\|WP_076381597.1\|4144582_4145479_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378964
NZ_AP017422.1\|WP_076377453.1\|4136964_4137714_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187620
NZ_AP017422.1\|WP_084206456.1\|4154989_4155409_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_AP017422.1\|WP_076381568.1\|4154559_4154862_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_AP017422.1\|WP_076377455.1\|4136482_4136797_+\|DUF2752-domain-containing-protein	unknown	unknown	gnl\|CDD\|378499
NZ_AP017422.1\|WP_076383023.1\|4143335_4144076_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_AP017422.1\|WP_170022679.1\|4132752_4133649_-\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_AP017422.1\|WP_144263987.1\|4134644_4135889_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP017422.1\|WP_076377447.1\|4140172_4141336_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	5.395e-165
NZ_AP017422.1\|WP_076381572.1\|4144112_4144544_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	6.1508e-07
NZ_AP017422.1\|WP_076381571.1\|4145726_4147724_-\|AAA-family-ATPase	gnl\|CDD\|227038	COG4694, COG4694, Uncharacterized protein conserved in bacteria [Function unknown].	0.000107836
NZ_AP017422.1\|WP_076377451.1\|4138430_4139525_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	9.44104e-21
NZ_AP017422.1\|WP_076377449.1\|4139619_4140042_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|334619	pfam01638, HxlR, HxlR-like helix-turn-helix. HxlR, a member of this family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis.	1.23723e-28
NZ_AP017422.1\|WP_076377461.1\|4134167_4134587_-\|hypothetical-protein	gnl\|CDD\|378192	pfam09490, CbtA, Probable cobalt transporter subunit (CbtA). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of five transmembrane segments, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a small protein (CbtB) having a single additional transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site.	0.00221971
NZ_AP017422.1\|WP_076378409.1\|4137772_4138354_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.65881e-10
NZ_AP017422.1\|WP_076381570.1\|4147727_4151285_-\|N-6-DNA-methylase	gnl\|CDD\|378996	pfam12950, TaqI_C, TaqI-like C-terminal specificity domain. This domain is found at the C-terminus of the TaqI protein and is involved in DNA-binding and substrate recognition.	4.97807e-16
NZ_AP017422.1\|WP_076381569.1\|4151288_4154555_-\|helicase	gnl\|CDD\|197275	cd09178, PLDc_N_Snf2_like, N-terminal putative catalytic domain of uncharacterized HKD family nucleases fused to putative helicases from the Snf2-like family. N-terminal putative catalytic domain of uncharacterized archaeal and prokaryotic HKD family nucleases fused to putative helicases from the Snf2-like family, which belong to the DNA/RNA helicase superfamily II (SF2). Although Snf2-like family enzymes do not possess helicase activity, they contain a helicase-like region, where seven helicase-related sequence motifs are found, similar to those in DEAD/DEAH box helicases, which represent the biggest family within the SF2 superfamily. In addition to the helicase-like region, members of this family also contain an N-terminal putative catalytic domain with one copy of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue), and have been classified as members of the phospholipase D (PLD, EC 3.1.4.4) superfamily.	7.34502e-41
NZ_AP017422.1\|WP_076377457.1\|4136187_4136514_+\|TM2-domain-containing-protein	gnl\|CDD\|377473	pfam05154, TM2, TM2 domain. This family is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts.	4.79965e-15
NZ_AP017422.1\|WP_076383021.1\|4141772_4143317_+\|IS21-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.9582e-11
NZ_AP017422.1\|WP_076381597.1\|4144582_4145479_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378964	pfam12833, HTH_18, Helix-turn-helix domain.	3.81115e-22
NZ_AP017422.1\|WP_076377453.1\|4136964_4137714_+\|glucose-1-dehydrogenase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.53429e-82
NZ_AP017422.1\|WP_084206456.1\|4154989_4155409_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.00337e-06
NZ_AP017422.1\|WP_076381568.1\|4154559_4154862_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	3.37757e-06
NZ_AP017422.1\|WP_076377455.1\|4136482_4136797_+\|DUF2752-domain-containing-protein	gnl\|CDD\|378499	pfam10825, DUF2752, Protein of unknown function (DUF2752). This family is conserved in bacteria. Many members are annotated as being putative membrane proteins.	8.7936e-10
NZ_AP017422.1\|WP_076383023.1\|4143335_4144076_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	8.86259e-59
NZ_AP017422.1\|WP_076381566.1\|4155683_4156421_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.59306e-31
NZ_AP017422.1\|WP_170022679.1\|4132752_4133649_-\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0

>NZ_AP017422.1|WP_076377447.1|4140172_4141336_+|alkene-reductase
MKKTTQPLLEEYQLGDLTLKNRVVMASLTRGRATNAGIVPTALMAQYYAQRASAGLILSEGTWLSPRAIGFINVPGIFTREQIEGWKLVTKAVHDKGGLIFSQLGHIGSASHPDFFDGELPAGPSAINPQTHSYTPEGFKATLTPRELTVAEIKETIQDYRQAAKNAREAGFDGVEIHAQAGMFIPQFLSLATNQRKDEYGGSIENRARIVFEILDAIIEVWHSTRIAIKFTPVALSHVGIVIPDVETIPMFQYILKKLNDYHLAYLHITGPAEDLTGTPVEALQNNYFSHFRHHYNGRLMANLGFTQESGNAILQEGTADLVSFGTPFIANPDLAERFKYHLPLSESNRDTYYSGGENGYTDYPAAVYDETIAQLDKADAEQRLDC
>NZ_AP017422.1|WP_076377449.1|4139619_4140042_-|helix-turn-helix-transcriptional-regulator
MYERKTPLTIDCGLHLTREVLSGKWKPALLNAISMDIKRPSEMLRLLPGATRRVLNVQLRELEGHGLVEKKTYPQLPPKVEYSLTEVGWSLMPVIDAMNQWGDANRSHLETVITQDPKINETSKSACKIYRQMAADRKIG
>NZ_AP017422.1|WP_076377451.1|4138430_4139525_-|TlpA-family-protein-disulfide-reductase
MIKKNLFLLCLLAVSHLFAQSGKPLLQIGDPAPPLQIATWLKGTPLKETFTAGEVTVVEFWATWCGPCLANIPHLSEVAHTYAGKKVNVIGVNVRERSDVGADSLQRFMKGQKGQEMHYTVGADDTTAYMANHWLAAVGQRGIPFAMVVNQAGQIAWIGHPASIDAPLAKIAAGNWDVNKARMDREESLRLDKVDMSVIDRLNPLMVSRNYKEAMVVLDSILKQEPGLKYRHSTGHFLFFSLLNTDVNQAVVFARELWENSDFPDWKTVSDGVMWANFKKISLNAAAYALGAEALDAQIVHYPWSMDIPATYDEIAGLYAQANQHDKAIDAEKKAIAAAEQTPKVKSETIKKYRKALEQYRAAK
>NZ_AP017422.1|WP_076378409.1|4137772_4138354_+|TetR/AcrR-family-transcriptional-regulator
MRSKDFDETEVLKKAITIFWKNGYNGTSLHDLIDGLGIARSSIYHAFGDKHGLYIKALELYQQEGTRRILAVLDNTTSVKEGIKALLDLVIGDVVARGRPKGCFKVNAEVEVASQDKPSHKLLCEDNRVIEDALYAYIQKGQHNGDINPSKDARALARFLCNTITGMRVYAKVTNDKQFFEDIAATALSLFDN
>NZ_AP017422.1|WP_076377453.1|4136964_4137714_+|glucose-1-dehydrogenase
MKRLENKVAVVTGASKGIGAGIAEKLAAEGAAVVVNYASSKEDAEKVVAKIISNGGKAIAVKGDVSKAADVDHLFAEALGQYGAVDILVNNAGVYQWGALADFTEESYHFQFNINVLGVLLASKAAVKSFSEKGGSIINIGSAVSSATPAGSAIYTATKSAVDSITRVLSKELGPKNIRVNSVNPGMVVTEGATSAGFIGSEIETAMVSNTPLRRVGQPEDIALATAFLASDDARWVTGEVILASGGLR
>NZ_AP017422.1|WP_076377455.1|4136482_4136797_+|DUF2752-domain-containing-protein
MAKADSSLGNKLLFTVWLLVPLLIFQINYHSGNGHFTVCLFKNITGKDCYGCGVLRGISACLHLNFPAAYQLNRLNVLTIPLLTFLYCKELWLTRPPFLRSATR
>NZ_AP017422.1|WP_076377457.1|4136187_4136514_+|TM2-domain-containing-protein
MFCTNCGAQIDDKAVVCVKCGVPTNQFAAHANPASPAANAEGYDWLTTLLLCFFVGAFGVHSFYTKKTTIGIIQLLTLGGCGIWALIDLILIVVGTFKDGEGRFLVRK
>NZ_AP017422.1|WP_144263987.1|4134644_4135889_-|hypothetical-protein
MQKNGELAGVHPVKLVKDDLFNRYVAVYDKWTHLLEKKQQVVKWMYAKEDRFDVEKYANGVLPAGGPLLDKWEPDANYKYGLDSGGRPCYMQYEANGGEIVYAGIFKCSNSCVEYVEYNMRDRKPVVIVRLLQENGRKTAYQALHINGKKLGRDYENLTGREVADKLQQMEHDIFCMVKHFQYGHDRIEKADCWESLAGVKATYYEERYQYTGTGALDEIKSVYPDGTSQLLYVKMPDNTTIEQLSDQLALQIAQSVTERLVRKKWNAPLSILQLGIHEVDDYHPHLSMLTVKEKVDILNTYDELRFEKLFILVSDDKHFRADTSYERLYTAFMGKVQEGDEWWLPANEMIYKAARLLTVNKLWNKVPVDKDFVAYAVDWSMGPNEEGEMGKLLLTCGLPAETLRKWEREGYFK
>NZ_AP017422.1|WP_076377461.1|4134167_4134587_-|hypothetical-protein
MKSKRQLVLMTVAAAGMWVMTSCKTNDYKEFPKEEETEAHGHDHSEAKHEHQEEAAAQDTTKKAAFTVAGVVGDVANGKDGFMATITNDKGVVYSSVFSIRNLEKSYKQLKAGDHVEVTGDTMQLGDKTHIVVKQFTQQ
>NZ_AP017422.1|WP_170022679.1|4132752_4133649_-|methylisocitrate-lyase
MNPVLPSPGLAFRDALKKEFPLQIVGAINANHALLAQQAGFQAIYLSGGGVAAGSLGIPDLGITQLEDVLIDIRRITDVCSLPLLVDVDTGFGPSAFNVARTVKSLIRAGAAALHIEDQVGAKRCGHRPGKEVVSKEEMVDRLKAAVDARTDAQFVIGARTDAFAAEGLEKTLERAVAYKEAGADFIFAEAVPELALYRQFADATGLPVLANITEFGMIPMYTTEQLHDAGVAMALYPLSAFRAANKAAENVYQHIRKDGTQQQVLNTMQTREELYRSIGYYSYEQKLDELFKKNKNV
>NZ_AP017422.1|WP_076383021.1|4141772_4143317_+|IS21-family-transposase
MAQKPIAMEQLKQIIQLQKDGVGIREIARRIGISRNSVRKYIALLAADTPVEESDNKTLADRAYGNDSVVHDANRLQQLITHFQYAQVELNKTGVTRQLLWQEYMVQHPDGYVYSHYCHHLNQYLKNRDLSMHLEYQVADMIMIDFAGKKQSYIDLSTGELVPCQVFVAILPFSGLIFCLAVHSQQTADFTTCINAMLMFYTGVPATILCDNLKTAVTHPSRYEPVFTDICHQLSEHYNTTFSATRPYSPRDKAMAERAVNIVYTHVYAPLRNREFTSLQALNVAMQEQLLLLNNKPYKNTPYSRWYYFEQQERSALKPLPTEPFSPKKVVTLTVQRNYHIQLSEDHHYYSVPYVHVGKKVKVLYDHRTVEVYLDHQRIALHIRKSHQKSYTTLAEHMPPHHQQMQQIKGWNREDLLAQATRIGPSTYQAAALMLENSIYIEQNYKACFGMLMLSKKYGSGRLEAACARILQGTRVNYTMIRNVLERALDKQLPLEEAPPPLTHDNIRGKEHYQ
>NZ_AP017422.1|WP_076383023.1|4143335_4144076_+|ATP-binding-protein
MNTTQTLQQMQQLRLPGMYQAYRSQLELSMDQQLDGHELIAHLLQSEEQNRSNEKTALCLKLAKLRLPVTIEQVECSQARNITKQQLAMLAEGRYLLQGENILITGATGCGKSHLACALGHQACLHGYKTIYLNMNRLAEKITLARLDGSYIKLLNQLERQSLIILDDFGLAPMTQDMRLTLLQLLEDRYGKKSVIVTSQLPVAKWHEYLNDPTLADATLDRLTANAHRVELKGESLRRKKEKANQ
>NZ_AP017422.1|WP_076381572.1|4144112_4144544_-|carboxymuconolactone-decarboxylase-family-protein
MAVIEDRKAKGIQDIEGKAASPVNDSNKYQTGKKTLQVLTNIEEKAPAGANAFAPAIDTFLKEHLFADIFSRDVLTYQQRELVTVSALASMSGVVLQLQAHIGLAINTGLTGPQLSEAFAIIVYILMMLTQCSGMFTHLRSRQ
>NZ_AP017422.1|WP_076381597.1|4144582_4145479_+|helix-turn-helix-domain-containing-protein
MEKILRIDTVSEHDKFYHQENLHPLVSVIDFTGTAPEVYASKMNFGFYAVYLKDVQCGDMKYGRHTYDYQDRTLVFVAPGQVIHVDINEEYKPSGFALLFHPDLIRGTPLGKNIDNYTFFSYESREALHLSEKERKMVLDCFEKIKYELEQGTDKHSKTLIAANIELFLNYCIRFYDRQFITRNEANLNSLEKFEKLLKNYFHSDKPQTVGLPAVSYFAEQLHLSPNYFGDMVKKETGKTPFEYIHLKIVDMAKERLLDTSRSISEIAYDLGFKYPHHFTRAFKKSTGYTPNEYRGLN
>NZ_AP017422.1|WP_076381571.1|4145726_4147724_-|AAA-family-ATPase
MAASFIEDIYIQNFKFFPKLNEPIKLEGKHWLLFGENGSGKSSIYWALYTLLECSNKENIEQIKKYFSHDELEKERLINIHLKHGTPNWVDSYVKIKLKDGTEFNVSFTDTTINTNQNAKESNYASDFINYRNLLSLYNFAHSDEIDVFGFFEYAVLPYVKFTPATYWHNDVTNAIISLTTDSATEIWEFVKNGPQKNVPNRTGHTRYPKRGEIQYTEYKNLVDRFKTDLNTLITFINTEGNPILKDQLGYDLTFKLELEEEPVYKGKRLSRESFTLSEQKFIRPKFYIKLSIPEYEGERDVVYRPHSFLNEAKLTAIGLALRLAVLKKSLETGNPKLKILVLDDLLISLDMSNREKVLALIFDDYLSTHQLLILTHDKVFFEFVKLFIKQKSNLSDWKISEMYRGIDPAGVPYPVIIPGEFGYYDKAKRYFEAHDYTASALYIRKSLEKIVYDRIQEEITRVIDGKPNNLQFLWERLLERYQSLGHKISDNIIKSFEQTKLMLLNPQAHHDLSTPVYKLELEKAIKLINDIENTCPIPTTMILLSKGMTMQYKHPDIAHNYSIDFELLTDFRTDGLLGNTTTVFPRCRIISWQYNGTAFWDFRRSIAAKPGKPIEHRLDQIKGTLTDMAMVPLGITDDMFLDNTILTNGIWSLREIINKSGAVI
>NZ_AP017422.1|WP_076381570.1|4147727_4151285_-|N-6-DNA-methylase
MNERQIKDIFKNGGSVTVWKPILDFVFGNVEYFSTPSNPFREDKNVISGKQVGRIRLDQDKFISIFEVEVNDHINIERNRQGLREIAVKYIDQNITHGALVFYHSRNQALYRLTFIAKWSEIDLKTGEFKKGETQKRRYTYLLGENQSGSTAAKRLLEIAAKKPVISIDSIIQAFSVEALTKEFFKKYKEHYERFWRFIDDTPAYKKLLIDTSPEKTQDEQRKPLRDFSKKLLGRIVFLHFLQKKGWMGCPVLSTSKKNKEIWKDGNPSFLHDLFKQFNEQDHFYSKCLSKLFFNTLNQPDRPNNIFPITNSRVPYLNGGLFDNDQPNTDHIDFPAVYFKDLLEFFEQYNFTIDENSPDEQEIGIDPEMLGHIFENLLEENREKGAFYTPKEIVNYMCQESLIEYLRVYMPKEAEIEQFIRKQYISEYLRDRANAIKINNLLDQVKVCDPAIGSGAFPIGILQEIYKAKIHIYPYLNPVTPFDPVQAKKKIIEGSIYGVDLEHGAVEIARLRFWLALVVDEEVPQPLPNLDYKIMQGNSLLERFEDIDLSLIGSSKKNLTVYEAEKDLFGNILESQMKITFAQTGTIKEIQQLMKQYFNEKEPAEKADLKHEINQKVHKHIDYNLELREAQLSRVIEEAGDEEKLNNKARAKLKDLKQDLVSFSVKRARLHDIQNTEEKPYFLWHVFFKDVFDNGGFDIVIGNPPYIQLQKMIKEANELEHAGYLTFTRTGDLYCLFYEQGNNLLKNNGVLAYITSNSWLKTQYGSLLRKYLTQYTNPLKLLNFEDTKIFHSATVETNILLFKKGHWEQKLKAVVFRSDYSSGDSIVNYYSSNSIELSDLSDEGWIILSRKEYDTKNEIEKKSILLKDLNMTINFGIKTGLNEAFIIDKKTYDELIELNPDNAKIIKPIIRGRNVKSYSYKFEEQYIIFTRRGINIDEFPEIRDHLYKSYDRLKPRQPGDKVGRKPGPYKWYEIQDNVAYYTEFEKPKLVWGELSDKPKFAYDDKGMYPEATLFFMTGDNLKYLLSILNSRLASWYFNQITTTSGMGTNRWKKYKIEQLPIAFINSNSKKIEVASDYMLFLNDTTTPAVNSYTENENIAQVFEDTLNMMIYELYFEEHMKELEVDVLQFITEDTFPPLTKNPLENAQTVGRIYKWLQERDNPIRNRIISANINSNYIRGINSTTH
>NZ_AP017422.1|WP_076381569.1|4151288_4154555_-|helicase
MSTKFFTNENENTLLNKIEGIFKYRNIYFFDALVGYFHASGYFRIRKFIEKSDEIRILVGINIDKMIHQAYQQGLLFDGDIERAQEDFFNQIKKNIQTAEYDQDVERGMTQLIHDIVTKKVLIRIHPKQNIHAKIYIFREKEKHSHGYGAVITGSSNLTEAGLSHNFEFNVELRDNSDIEFAKETFEKLWKESTPVAEEYIERLTKETFLNATFTPYEVYLKFLVEYFGKSIDFDPNSITDLPKGFKRLTYQIDAVNDGYSKMIKHNGFFLADVVGLGKTIVSTLIAKKYFYSNGFPTYRSRTLIIVPPALKENWVETIDKFHLDNVEIITNGSLHRINNPDKYDLVIVDEAHKFRSDTSGMYNDLQKICKSRTKKILPDGSRELKRIILVSATPLNNRPEDIANQVYLFQDSKNSTLEVGNLQQFFRQQIDAYRKLRDEKNLEKVKEGVKHIYDKIRIKIIEPLTVRRTRTDLTIHKQYAQDLIDQGISFPHVQKPEKIFYELEPRLDLLYDKTIRCLSHPTDGLTYNRYRAIGFLKPHRKNKYQKADMISSQLAKIMKTLLVKRIDSSFHAFKQSLERFLNATKAMVRMFDNGKIYIAPNLPVSDYINEGKEEELLDLLLNKSLEDPTIEICEPDDFEPEFIVGLKRDYAILMELNMDWRGVDEDPKLAQFVIYLKEKLFNKKINKEQKLVVFSESKETTAYLELKLKAEIDKRVITVDSKSRKERMPVIRANFDANYPLMEQKNDYDIILSTEVLAEGVNLHRANIIINYDTPWNSTRLMQRIGRVNRIGSKASEIHIFNFFPTTKVNSDIELEKKAIMKLQAFHAALGEDSQIYSPDEETQTFGIFDHAIEEDRDEKLIYLMLLRELREKEPEIFKKVKNMPLRARVGRKSKIIRDSTISFIRDSRRDSFLYVKSNNEIEELTFLETAKQFEAKRDEMAFNLHSLHHKQVQKAVEHFSNTIEEEKARDKKVDITQGPNEKKALAYLDAFLNLSFANSFEKELILEAKEAIRKGKFQNLQRDLNKLQKAVKKTPLNPVLLLEQVMGILRSYPLERTQEDIIPEVAPSILIKNLNPDIIITESFTV
>NZ_AP017422.1|WP_076381568.1|4154559_4154862_-|helix-turn-helix-transcriptional-regulator
MESFGSYIRLYRDAKRLPLRKVAAYLDIDTSTLSKIERNERSALPEYLKPLSEILQINLKDIQARFIADKINKDFGEMEYLPEGLKMAEKYIKIPAKEMK
>NZ_AP017422.1|WP_084206456.1|4154989_4155409_-|helix-turn-helix-transcriptional-regulator
MPEKVHQGRAVKRLREILHVKQDVLADALNISQQSVSLLETKETIEPEQLELIAKTLKVPVDAIKNFNEEAAIYNIQHNYEGATANSTHFGRDYFNCTFNPMDKYIEAIEENKKLYEALLKSERDKIILLEKLLGEKKK
>NZ_AP017422.1|WP_076381566.1|4155683_4156421_+|HAMP-domain-containing-histidine-kinase
MPISFENNTIATFSTAAPAPKSAPQTIELFLGIFAHELRTQVAGTVQVCRYIREGSKSEAFFQALETTTLDTLHILDNMLATVKFHNGKLDITPAYCQIDFRSWITPVIRQQERTAALQQKDVCLILNPSLENIQVTTDPVKLGQILQNLLSNALKYSHPGTVITVKCSLESNIITLQVINQGMEIPPDKASRLFMPYERLDNGLAGTGLGLFLSAQYAQALGGVLAVQSERGNTVFTLTLPVYR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_AP017422.1	3284380-3284410	0	1.0
NZ_AP017422_2	2.2\|4141663\|30\|NZ_AP017422\|PILER-CR	4141663-4141692	30	NZ_AP017422.1	3284324-3284353	0	1.0

1. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to position: 3284380-3284410, mismatch: 0, identity: 1.0

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
tttagaaggtttttctgggattcgtttttta	Protospacer
*******************************

2. spacer 2.2|4141663|30|NZ_AP017422|PILER-CR matches to position: 3284324-3284353, mismatch: 0, identity: 1.0

caaccgtaattctggttacgaaacaccatt	CRISPR spacer
caaccgtaattctggttacgaaacaccatt	Protospacer
******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	683296-683322	4	0.852
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	476229-476255	6	0.778
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_CP036488	Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence	93053-93079	6	0.778
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	158385-158411	6	0.778
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	158385-158411	6	0.778
NZ_AP017422_1	1.1\|1324800\|27\|NZ_AP017422\|PILER-CR	1324800-1324826	27	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	118710-118736	6	0.778
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	187983-188013	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	103424-103454	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP009595	Bacillus cereus strain 3a plasmid pBFC_3, complete sequence	270657-270687	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP009606	Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence	136892-136922	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP053994	Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence	210663-210693	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	CP016196	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-2, complete sequence	106290-106320	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP053992	Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence	193679-193709	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	233590-233620	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	88584-88614	6	0.806
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	457387-457417	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP043831	Bacillus sp. BS98 plasmid unnamed1	217232-217262	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	356234-356264	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NC_018689	Bacillus thuringiensis MC28 plasmid pMC429, complete sequence	293351-293381	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP009368	Bacillus cereus strain FM1 plasmid unnamed, complete sequence	6252-6282	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	108396-108426	7	0.774
NZ_AP017422_2	2.1\|4141606\|31\|NZ_AP017422\|PILER-CR	4141606-4141636	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	358418-358448	7	0.774

1. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 4, identity: 0.852

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
cggtggatatctcggtggcgacggtac	Protospacer
*********** *********.***.

2. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 6, identity: 0.778

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
gtttttatatcgcgatggcgatggtgg	Protospacer
   *  ********.************

3. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_CP036488 (Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence) position: , mismatch: 6, identity: 0.778

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
gtttttatatcgcgatggcgatggtgg	Protospacer
   *  ********.************

4. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 6, identity: 0.778

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
gtttttatatcgcgatggcgatggtgg	Protospacer
   *  ********.************

5. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 6, identity: 0.778

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
gtttttatatcgcgatggcgatggtgg	Protospacer
   *  ********.************

6. spacer 1.1|1324800|27|NZ_AP017422|PILER-CR matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 6, identity: 0.778

cggtggatatcgcggtggcgatggtgg	CRISPR spacer
gtttttatatcgcgatggcgatggtgg	Protospacer
   *  ********.************

7. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

8. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

9. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP009595 (Bacillus cereus strain 3a plasmid pBFC_3, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

10. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP009606 (Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

11. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP053994 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

12. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to CP016196 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-2, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

13. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP053992 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggggtttttctgggatttctttttta	Protospacer
***  ..***************. *******

14. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcagagtttttctgggatttctttttta	Protospacer
***  *..**************. *******

15. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.806

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcagagtttttctgggatttctttttta	Protospacer
***  *..**************. *******

16. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggagtttttctgggatttctttttta	Protospacer
***  ...**************. *******

17. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP043831 (Bacillus sp. BS98 plasmid unnamed1) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggcgtttttctgggatttttttttta	Protospacer
***  .. **************. *******

18. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggagtttttctgggatttctttttta	Protospacer
***  ...**************. *******

19. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NC_018689 (Bacillus thuringiensis MC28 plasmid pMC429, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggcgtttttctgggatttctttttta	Protospacer
***  .. **************. *******

20. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP009368 (Bacillus cereus strain FM1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggagtttttctgggatttctttttta	Protospacer
***  ...**************. *******

21. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggagtttttctgggatttctttttta	Protospacer
***  ...**************. *******

22. spacer 2.1|4141606|31|NZ_AP017422|PILER-CR matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

tttagaaggtttttctgggattcgtttttta	CRISPR spacer
ttttcggagtttttctgggatttctttttta	Protospacer
***  ...**************. *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1638982 : 1690490

Yellowstone_lake_phycodnavirus(50.0%)

transposase,protease,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159445124.1\|1638982_1640251_+\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_076380047.1\|1640348_1641254_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_076380046.1\|1641390_1642704_+	acetylxylan esterase	NA	NA	NA	NA
WP_076380045.1\|1642723_1643452_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_076380044.1\|1643816_1646243_+	TonB-dependent receptor	NA	NA	NA	NA
WP_076380043.1\|1646667_1649163_+	hypothetical protein	NA	NA	NA	NA
WP_076380216.1\|1649176_1651138_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_076380042.1\|1651336_1651558_+	2TM domain-containing protein	NA	NA	NA	NA
WP_076380041.1\|1651568_1652150_+	cupin domain-containing protein	NA	NA	NA	NA
WP_076380040.1\|1652153_1652741_+	hypothetical protein	NA	NA	NA	NA
WP_076380039.1\|1652779_1653592_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_159445123.1\|1653640_1654363_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_084206308.1\|1654395_1655211_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.5e-23	35.7
WP_076380037.1\|1655215_1655941_-	hypothetical protein	NA	NA	NA	NA
WP_076380036.1\|1655964_1657227_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_076380035.1\|1657223_1657901_-	response regulator transcription factor	NA	NA	NA	NA
WP_076380034.1\|1657914_1658328_-	EamA family transporter	NA	NA	NA	NA
WP_076380033.1\|1658416_1659421_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_076380032.1\|1659542_1660334_-	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_076380031.1\|1660462_1660912_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_076380030.1\|1661122_1661338_-	hypothetical protein	NA	NA	NA	NA
WP_076380029.1\|1661543_1662416_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_076380028.1\|1662528_1663878_-	type VI secretion system contractile sheath protein TssC	NA	NA	NA	NA
WP_144264071.1\|1663916_1664360_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_076380027.1\|1664556_1665693_-	hypothetical protein	NA	NA	NA	NA
WP_076380026.1\|1665732_1666632_-	hypothetical protein	NA	NA	NA	NA
WP_076380025.1\|1666635_1667568_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_076380024.1\|1667571_1669455_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_076380023.1\|1669483_1669924_-	GPW/gp25 family protein	NA	NA	NA	NA
WP_076380022.1\|1669933_1670791_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_076380021.1\|1670801_1673279_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2I7SAX5	Vibrio_phage	7.4e-95	30.0
WP_076380020.1\|1673306_1675718_-	hypothetical protein	NA	NA	NA	NA
WP_076380019.1\|1675743_1676649_-	PKD domain-containing protein	NA	NA	NA	NA
WP_076380018.1\|1676706_1677231_-	hypothetical protein	NA	NA	NA	NA
WP_076380017.1\|1677257_1677767_-	hypothetical protein	NA	NA	NA	NA
WP_076380016.1\|1677963_1678704_+	response regulator transcription factor	NA	NA	NA	NA
WP_076380015.1\|1678797_1679193_+	hypothetical protein	NA	NA	NA	NA
WP_076380014.1\|1679311_1679701_+	hypothetical protein	NA	NA	NA	NA
WP_076380013.1\|1679771_1680458_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_076380012.1\|1680507_1681743_+	FecR family protein	NA	NA	NA	NA
WP_076380213.1\|1681926_1685553_+	SusC/RagA family TonB-linked outer membrane protein	NA	NA	NA	NA
WP_076380011.1\|1685564_1687055_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_076380010.1\|1687084_1688029_+	hypothetical protein	NA	NA	NA	NA
WP_076380009.1\|1688054_1690490_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

4307030 : 4313822

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076381449.1\|4307030_4308137_-	DNA topoisomerase IB	A0A0G2Y4T8	Acanthamoeba_polyphaga_mimivirus	2.2e-38	33.4
WP_084206445.1\|4308192_4308639_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.3e-21	60.9
WP_076381447.1\|4309060_4309720_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.4e-29	43.7
WP_076381446.1\|4310070_4311249_+	glycosyltransferase	A0A0P0YN12	Yellowstone_lake_phycodnavirus	4.3e-08	33.0
WP_076381445.1\|4311232_4312174_+	glycosyl transferase	A0A1B1ISM5	uncultured_Mediterranean_phage	4.7e-26	31.5
WP_076381444.1\|4312148_4313822_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.9e-20	25.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP017422

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection