CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_AP017657	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_3, complete sequence	0 crisprs	NA	0	1
NZ_AP017659	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_5, complete sequence	0 crisprs	NA	0	6
NZ_AP017661	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_7, complete sequence	0 crisprs	NA	0	0
NZ_AP017660	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_6	0 crisprs	NA	0	0
NZ_AP017658	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence	1 crisprs	csa3	1	2
NZ_AP017655	Sphingobium cloacae strain JCM 10874 chromosome SCLO_1	1 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	10
NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	0 crisprs	RT	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7657 : 59043

Escherichia_phage(33.33%)

transposase,integrase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020819377.1\|7657_8785_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037487321.1\|9021_10218_+	NnrS family protein	NA	NA	NA	NA
WP_164975689.1\|10359_10650_-	hypothetical protein	NA	NA	NA	NA
WP_066521301.1\|10964_11360_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_037487485.1\|11512_11866_+	hypothetical protein	NA	NA	NA	NA
WP_013054031.1\|11950_12715_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_096362250.1\|12828_13359_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_066522310.1\|14002_14284_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_066522313.1\|14280_14706_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_066522316.1\|15758_16412_+	ParA family protein	A0A0M3ULE3	Mycobacterium_phage	3.0e-11	31.8
WP_066522319.1\|16411_16747_+	hypothetical protein	NA	NA	NA	NA
WP_066522322.1\|16743_17703_+	replication initiator protein A	NA	NA	NA	NA
WP_006961816.1\|18625_19492_-	recombinase family protein	E5FFF9	Burkholderia_phage	4.8e-25	40.0
WP_006961814.1\|19634_22544_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_157080356.1\|23436_23601_-	hypothetical protein	NA	NA	NA	NA
WP_066522250.1\|23597_23816_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_066522247.1\|23886_24159_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_066522244.1\|24334_27262_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	2.7e-11	25.4
WP_174521996.1\|27324_27570_+	hypothetical protein	NA	NA	NA	NA
WP_066522240.1\|27573_28008_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_013054031.1\|28746_29511_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_031293519.1\|30049_31423_+	hypothetical protein	NA	NA	NA	NA
WP_066520910.1\|31696_32947_+	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_066520914.1\|33007_33685_+	conjugal transfer protein	NA	NA	NA	NA
WP_169925567.1\|33795_34695_+	P-type conjugative transfer protein TrbG	NA	NA	NA	NA
WP_123905549.1\|34691_35141_+	hypothetical protein	NA	NA	NA	NA
WP_123905550.1\|35152_36448_+	conjugal transfer protein TrbI	NA	NA	NA	NA
WP_066520933.1\|37021_38203_-	hypothetical protein	NA	NA	NA	NA
WP_066520935.1\|38193_38571_-	hypothetical protein	NA	NA	NA	NA
WP_066520937.1\|38557_39247_-	recombinase family protein	NA	NA	NA	NA
WP_066520939.1\|39386_40370_+	arsenic resistance protein	NA	NA	NA	NA
WP_174521987.1\|40385_40712_-	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_066520945.1\|40899_41649_+	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_066520949.1\|41685_42036_+	DUF3147 family protein	NA	NA	NA	NA
WP_066520951.1\|42082_42331_+	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_066520955.1\|42317_42737_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_066520958.1\|42908_43319_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_066520979.1\|43395_44046_+	cation transporter	NA	NA	NA	NA
WP_066520962.1\|44186_44522_+	hypothetical protein	NA	NA	NA	NA
WP_066520965.1\|44580_45945_+	TolC family protein	NA	NA	NA	NA
WP_066520967.1\|45941_47120_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_123905551.1\|47123_50381_+	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_066520969.1\|50380_50728_+	DUF190 domain-containing protein	NA	NA	NA	NA
WP_066520973.1\|50875_51376_+	SRPBCC family protein	NA	NA	NA	NA
WP_066520976.1\|54165_54768_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	9.4e-28	40.6
WP_066520988.1\|54799_55156_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_066520978.1\|55148_55433_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_083949185.1\|55558_56197_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_096362251.1\|56196_56634_+\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_013039223.1\|56691_58062_+\|transposase	IS1380-like element ISSp1 family transposase	NA	NA	NA	NA
WP_083949234.1\|58455_59043_+\|protease	aspartyl protease family protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_AP017658

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP017658_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP017658_1

34749-34838

Orphan

Consensus_repeat	Method
GACTCGACCCCAACACTCACTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP017658_1

>merge|NZ_AP017658|1|34749-34838|CRISPRCasFinder
GACTCGACCCCAACACTCACTTTTACCGACCCCAAAACTCACCGAAGGCTACCCCAAAACTCACGCGACTCGACCCCAACACTCACTTTT

>NZ_AP017658|1|1|34749-34838|CRISPRCasFinder
GACTCGACCCCAACACTCACTTTT	ACCGACCCCAAAACTCACCGAAGGCTACCCCAAAACTCACGC
GACTCGACCCCAACACTCACTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP017658.1\|WP_006961814.1\|30457_33367_+\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_AP017658.1\|WP_066522435.1\|25378_26872_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_AP017658.1\|WP_066522435.1\|28282_29776_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_AP017658.1\|WP_082734689.1\|24296_24716_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NZ_AP017658.1\|WP_007686150.1\|47377_47908_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_AP017658.1\|WP_066522399.1\|43019_43313_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_AP017658.1\|WP_066522521.1\|39454_40219_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_AP017658.1\|WP_066522401.1\|43300_43579_-\|CopG-family-ribbon-helix-helix-protein	unknown	unknown	gnl\|CDD\|226420
NZ_AP017658.1\|WP_096362261.1\|21982_23578_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235727
NZ_AP017658.1\|WP_096362260.1\|19913_21446_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176240
NZ_AP017658.1\|WP_006961816.1\|33509_34376_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_AP017658.1\|WP_011950653.1\|36585_37146_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_AP017658.1\|WP_062346440.1\|27616_27988_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_AP017658.1\|WP_066522521.1\|37213_37978_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_AP017658.1\|WP_083949265.1\|42705_42972_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|372700
NZ_AP017658.1\|WP_062346440.1\|24712_25084_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_AP017658.1\|WP_008832583.1\|46760_47381_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_AP017658.1\|WP_016746447.1\|43743_46635_-\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_AP017658.1\|WP_123905556.1\|38166_39159_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277344
NZ_AP017658.1\|WP_082734689.1\|27200_27620_+\|transposase	unknown	unknown	gnl\|CDD\|225511

Protein	Function_ID	Function_description	E-value
NZ_AP017658.1\|WP_006961814.1\|30457_33367_+\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	3.82862e-173
NZ_AP017658.1\|WP_066522435.1\|25378_26872_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	9.75375e-114
NZ_AP017658.1\|WP_066522435.1\|28282_29776_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	9.75375e-114
NZ_AP017658.1\|WP_082734689.1\|24296_24716_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.93299e-07
NZ_AP017658.1\|WP_007686150.1\|47377_47908_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.4341e-12
NZ_AP017658.1\|WP_066522399.1\|43019_43313_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	4.17175e-12
NZ_AP017658.1\|WP_066522521.1\|39454_40219_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.46416e-66
NZ_AP017658.1\|WP_066522401.1\|43300_43579_-\|CopG-family-ribbon-helix-helix-protein	gnl\|CDD\|226420	COG3905, COG3905, Predicted transcriptional regulator [Transcription].	6.4287e-17
NZ_AP017658.1\|WP_096362261.1\|21982_23578_+\|FAD-dependent-monooxygenase	gnl\|CDD\|235727	PRK06183, mhpA, bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase.	6.99093e-124
NZ_AP017658.1\|WP_096362260.1\|19913_21446_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176240	cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	3.27336e-67
NZ_AP017658.1\|WP_006961816.1\|33509_34376_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.26226e-44
NZ_AP017658.1\|WP_011950653.1\|36585_37146_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	7.22398e-50
NZ_AP017658.1\|WP_062346440.1\|27616_27988_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	3.66538e-40
NZ_AP017658.1\|WP_066522521.1\|37213_37978_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.46416e-66
NZ_AP017658.1\|WP_083949265.1\|42705_42972_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|372700	pfam13744, HTH_37, Helix-turn-helix domain. Members of this family contains a DNA-binding helix-turn-helix domain.	1.1435e-09
NZ_AP017658.1\|WP_062346440.1\|24712_25084_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	3.66538e-40
NZ_AP017658.1\|WP_008832583.1\|46760_47381_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	6.52056e-53
NZ_AP017658.1\|WP_016746447.1\|43743_46635_-\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	8.61643e-167
NZ_AP017658.1\|WP_123905556.1\|38166_39159_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|277344	cd07399, MPP_YvnB, Bacillus subtilis YvnB and related proteins, metallophosphatase domain. YvnB (BSU35040) is an uncharacterized Bacillus subtilis protein with a metallophosphatase domain. This family includes bacterial and eukaryotic proteins similar to YvnB. YvnB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	4.90678e-20
NZ_AP017658.1\|WP_082734689.1\|27200_27620_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.93299e-07

>NZ_AP017658.1|WP_006961816.1|33509_34376_+|recombinase-family-protein
MTRVGYARVSTIDQDLDIQVARLKAAGCEILRSETGSGASRTGRTELETIMQFLRADDELVVLRLDRLGRSTRDVLNLVHELDQKGASLRVLEPEVTTAGSMGRMVITILGMVADMELTFIKDRQRAGIEAARAEGVYKGRKKNIDDDEIRRRITAGASKASVARDLKISRMTVYRALDVIPSRIGLPEKPPSVTIALHLTIENFNKHGRGRKPARERIEAMLERDYQMQKTGNCDYTLTVAYDQGADGVSLDDEIASLQTEMFNIAESYRCSIETDVYEIGGQERAW
>NZ_AP017658.1|WP_006961814.1|30457_33367_+|Tn3-family-transposase
MSLGVSSGDLIGSWSLSFSDIAFVTGKAETARLGLAVQLRFFAGHGFFVPDHASIPSDGVLYLAEQLGLDAKSVNHYDFSGRTARRHCAEILRHLGFRRMTQTDRRALSRWISDDLCAGGQPINAMLEHVFLWCRDRRIYGPSRKELERLVRSQRHLYLEALLARVRDRLAPDAVALLEASLADPDGPTGFNTMKGDAGQATLENILGVTAKLAFIQRLALPRDFLSVTGKAWVDQIVRRVAGEKASEMRRHVPARQLGLYAVYLMAREAQLTDAMVDLLIETVHKIGSRSKRKVVGDIAKDIERVYGKERLLVEIASASIDDPSGRICDVIFPIAGKDKLAAIIKESQAKGALDRRIYKVMRRSWANHYRRMLPSLLSALEFRSNNAVWRPVLAALDWIRSKVDDGCRYVPPHAVPVDEVIPARWRSSVIDEEGRVNRISYELCVLAQLRDRIRSKEIWVVGADRYRNPDDDLPKDFDARREAYYTGLNLTADARAFSSAIREELAQELLLLNANIPRNDKVRLLWRGENRISLTPFKPLPEPRGLASIKTEIGQRWPMTGLLDVLKEAALDTGLLEAFETSASRVALPKTALDQRLLLCLYGLGTNAGLKRIAGATPDVSYEELLHVHRRFVHAAALKEACARVANATLAIRNAAVWGDAGTACASDSTKFGAWDRNLMTEWHARYGGRGVMIYWHVERRATCVYSQLKRCSSSEVASMIEGVLRHCTDMEIQRQYVDSHGQSAVGFAFCRLLGFELAPRLKAIARQKLALPDVGMRTRLPHLQPILSSPINWDEIEQQYDEMVKYAAAMQTKTADPEAILRRFSRSEVMHPTYKALSELGRAVKTIFLCRYLREESFRREIHEGLNVVENWNSANGFVFFGKGGEIATNRIDEQQLSVLALHLLQASLVYVNTRMLQSVLVEPKWTGRMTPDDYRGLTPLIYSHVNPYGRFDLDLNSRIDFGRLAA
>NZ_AP017658.1|WP_066522435.1|28282_29776_+|IS66-family-transposase
MEDALAAARDEVKRLNDILDQFKRHRFGQSAERLDPDQYQLVLEELEAALSRAEAGLEALIDQADATGETKRRRRNNRGALPAHLERIEQVVDIEDKQCACCGNDLHVIGEDVTERLDVVPTIFRVLVTRRPRYGCRGCDEGGVTQAPAPSFIVDQGLPTDALVAQVIVARYADHLPLYRQAQIYARQGIDLDRATLADWVGRVGWWLTPLRQHLLAELRSSVKLFADETRMPVLAPGTGKTKSGQLWAYARDDRPWGGLAPPAVVYMYAAGRGGMHPIDHLGDFAGVLQVDGYAGYNEIKRRNGVTLAFCLLHARRKFYDFREKEPVADEVLRRFSAIYKIEATLRDTSPEARFEGRQLILKPLFDNLRDYLSKNLGRFSAKGKMAEAINYMLNHWQQLTYCLLDGRVELDTNTVERSIRPIALSRRNSLFAGSDAGADNWAVLASLLETCKLSDVDPLAWLTATLTKLANGHSNKDLDSLMPWHFPKIAGRNAPS
>NZ_AP017658.1|WP_062346440.1|27616_27988_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MIGPGSDAKVLIYTKPIDFRCGIDTLVAKVQHELSQDPWRGVAYIFRSKRKDRLKILWFDGTGIWLMTKRAEAAEGFAWPPAVDGSFSITAAQMAALTSGMDWRRHRAPRRVNPPKIEGFADA
>NZ_AP017658.1|WP_082734689.1|27200_27620_+|transposase
MTVEQEIDGSGGVENGRRRRWTLEEKRAVVELSLDPACSMAEVAACFDVLPAQIYAWRRELREMAEDAAREDRAMFLPAVIEPTSVPAVLLEPEAANARLLPDAVVQVAMEVRGVPVMVAHGASSTLVASVIAALLRAR
>NZ_AP017658.1|WP_066522435.1|25378_26872_+|IS66-family-transposase
MEDALAAARDEVKRLNDILDQFKRHRFGQSAERLDPDQYQLVLEELEAALSRAEAGLEALIDQADATGETKRRRRNNRGALPAHLERIEQVVDIEDKQCACCGNDLHVIGEDVTERLDVVPTIFRVLVTRRPRYGCRGCDEGGVTQAPAPSFIVDQGLPTDALVAQVIVARYADHLPLYRQAQIYARQGIDLDRATLADWVGRVGWWLTPLRQHLLAELRSSVKLFADETRMPVLAPGTGKTKSGQLWAYARDDRPWGGLAPPAVVYMYAAGRGGMHPIDHLGDFAGVLQVDGYAGYNEIKRRNGVTLAFCLLHARRKFYDFREKEPVADEVLRRFSAIYKIEATLRDTSPEARFEGRQLILKPLFDNLRDYLSKNLGRFSAKGKMAEAINYMLNHWQQLTYCLLDGRVELDTNTVERSIRPIALSRRNSLFAGSDAGADNWAVLASLLETCKLSDVDPLAWLTATLTKLANGHSNKDLDSLMPWHFPKIAGRNAPS
>NZ_AP017658.1|WP_062346440.1|24712_25084_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MIGPGSDAKVLIYTKPIDFRCGIDTLVAKVQHELSQDPWRGVAYIFRSKRKDRLKILWFDGTGIWLMTKRAEAAEGFAWPPAVDGSFSITAAQMAALTSGMDWRRHRAPRRVNPPKIEGFADA
>NZ_AP017658.1|WP_082734689.1|24296_24716_+|transposase
MTVEQEIDGSGGVENGRRRRWTLEEKRAVVELSLDPACSMAEVAACFDVLPAQIYAWRRELREMAEDAAREDRAMFLPAVIEPTSVPAVLLEPEAANARLLPDAVVQVAMEVRGVPVMVAHGASSTLVASVIAALLRAR
>NZ_AP017658.1|WP_096362261.1|21982_23578_+|FAD-dependent-monooxygenase
MTAELTNQAAQFDVAIVGCGPVGALLANFLKQYGHKVAILDRELDVFYAPRGMGFDDESTRIMQSVGILDRLKAEGHIYQADLELIDRNGKRLGGFDRRSVGEDLLSGLHGHRHLTLFHQPSLEAILREEFSVGENAASSFFYHEVTEINDLGEQVELRCKNRATNEDFTISASYVVGCDGARSIVRKTMSVPRVDLKYTERYLVVDAIVDDPVYFRTRIPQGGYILHDGKEAGVLAKGLHGHVRFDFLQHSEIVGAELKNEKDYQDAARALIESRGFEPENFRVIRSVSYTFYAGMPSRWRVGRLLVAGDAAHLTPPWSGQGLNMGIRDAANLSFKLSLVLNKKTSDRILDTYDDERRPQSLETIQAAVDMGIRMQSTSPLQIGLRNFVYALSRSSKFVNRLLFRNWIRKPGFKSGLIGLQHRLSGTPMFQPWVQTPDGERRRMDDLIGLRFALISTDSPTGPEVTDFVRSLGGVVLKLDCDFFDPGETVCKWYDKNRINAVLLRPDRVIYDAGRDGRALCRSLLSELRK
>NZ_AP017658.1|WP_096362260.1|19913_21446_+|alcohol-dehydrogenase-catalytic-domain-containing-protein
MSSYRRTTIRAVGKARLGGTVLEHQCKQDGHSHGEASAGEQQGVPRRAALKAGAALATGGADGLLAGAAVAEQRAPAVLTGKQAGRKFRAWVQEGLWVGGKAGVEELRLKELQSRQVVVRTEASAPCYSLVQRGIGGRPAVKPAPKYAPDTVPQISNHTAVGIVEAVATDVRRVKPGDRVIIGVVSQCGNCYMCLRGRADHCQWAFAVPAGFPPEIATRADGSGLIAQIGIGGLAELNVCYEEYLCPIFTDLPADQLSLLGDTAATGFGGAMGVMKVEMGSNVVVLGAGPVGLSAVMAARVAGAAQIIVSEPVKHRREAAKRFGATTVLDPNAEGEGLVETIRELCKGPTGRITSGGRGWVSQADSDFVNATFGAVRDNRGPDFTIEAAGPTGDVPKVETPPDPTGILPMQQAWEMTRRGGEIVYLGFGQIGDVSYPAAAFANAGRTVHAGQQGGLNFMRDIPKIVSLMEQGKYDLRPMVTSRWRLEETNKAFQVASDRTELAPVVVFDS
>NZ_AP017658.1|WP_011950653.1|36585_37146_-|recombinase-family-protein
MKLGYARVSTEDQNLEIQRGRLSEAGCEMMFEEKISGAARGRPELEKLMGHLRKDDVLVVARLDRLARSTIELLHIAERIKEKQAGLQSLDEPWADTTSPSGVMIMTVFAGIAQFERTLILSRTEEGRKAAMARGVSFGRPKKMRPDQAELARQLVLEGKSISAVARTFNVHPATIYRCIEPNSAL
>NZ_AP017658.1|WP_066522521.1|37213_37978_+|IS6-family-transposase
MDDFKGRHFTGEVILWAVRWYCRYGISYRDLEEMLADRGIDVDHTTIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVRVRGKWTYLYRAVDKRGDTIDFFLSSTRSAKAAKRFLGKALRGLKDWEKPTKLNTDKAPSYGAAIAELKREGKLAEETEHRQVKYLNNVIEADHGKLKMLIKPVRGFKSMPTAYATIKGFEVMRALRKGQARAWCLQPGIRGEVRLIERSFGIGPSVMTEAMDVLNQHFANAA
>NZ_AP017658.1|WP_123905556.1|38166_39159_-|serine/threonine-protein-phosphatase
MRAIGNPVIEDLLPASPEQLLSIEMPAARAAWNIIADRLPFCVIPGNHDYDHLWTDHEFPAEIGGGIKGNKVEGIGGLQVSGLANWTNIFGASSPFFDGKAWYVSFHDEGCSSAQIFSAGGYRFLHLGLEMCPNEETLAWADGVINAYPGLPTIVSIHEFLNEEGERASIVYLDMTLRDSRRFGPARLWERFISRHDQILMTLNGHFHGVRHRIDLNQHGHKVYQFLVNYQGRKQSLKDTGSSARVIDGIGDGWLRLLRFDLAAAMPTLYLRAYSTHYKGFAPDLPRYAEWYGKEHPGMPAEEFLRLDDIAFDLEDFRQRFGPPGAAADP
>NZ_AP017658.1|WP_066522521.1|39454_40219_+|IS6-family-transposase
MDDFKGRHFTGEVILWAVRWYCRYGISYRDLEEMLADRGIDVDHTTIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVRVRGKWTYLYRAVDKRGDTIDFFLSSTRSAKAAKRFLGKALRGLKDWEKPTKLNTDKAPSYGAAIAELKREGKLAEETEHRQVKYLNNVIEADHGKLKMLIKPVRGFKSMPTAYATIKGFEVMRALRKGQARAWCLQPGIRGEVRLIERSFGIGPSVMTEAMDVLNQHFANAA
>NZ_AP017658.1|WP_083949265.1|42705_42972_-|XRE-family-transcriptional-regulator
MAATAFVRARITARVKSWDVPQGQVAKRLGLTRLRLNDLLRGKFNGFSLDDLMTIATAAGVEPPAARKSSWDDLRGMGSVLAEGGMTP
>NZ_AP017658.1|WP_066522399.1|43019_43313_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MPRLIWTPEALADVDRLHRWLKPKDADAASRAVAAIRAGVKILAQSPRVGRPAEDMDPEYREKLIDFGDSGYVVLYRLDGETVALLAVRHQKEAGYS
>NZ_AP017658.1|WP_066522401.1|43300_43579_-|CopG-family-ribbon-helix-helix-protein
MAAATSIKLDDTLKGRVQHLADARRRSSHWIMREAIAQYVEREEKREAFKQDAIRAWEEYQRTGLHLTLEEADAWLAKLEAGEDAELPKCHV
>NZ_AP017658.1|WP_016746447.1|43743_46635_-|Tn3-family-transposase
MPRRVTLTDRQREALLHLPVDQGELLRHYTLSDEDLGHIRQRRRAHNRFGFALQLCVLRYPGRVLAPGELIPAQVSDFIAAQLGLTSDDLLLYAAREETRHEHLADLRRIYGYRSFSGRGARDLREWIAREAEAATSNEDLARRFVAECRRTRTILPGSSTIERLCADALVEAERRIEDLIAHRITPTLSENLAHLLEDTVDGRVTRFVWLRQFEVGANSAAANRLMDRLEYLQRFDLPADLLDGVPAHRVTRLRRQGERYYADGMRDLPEDRRLAILAVCTLEWRSSLADVIVETHDRIVGRLYRASERLCNTRIADEKAAVRDTLKSFAEIGGALLGAQDDGTALDGIIATGPGWERFRTLVATASALTNVLAADPLSRVLDGYHRFRLYAPRMLRLLDMQAAPIATPLLAAVAMLRNGIKVDPPVDFLRPNSKWHRHLRAEPSGDHRLWEIAVLFHIRDAFRSGDIWLAGSRRYGDLKQLLVPPQAIEQTARLAVPLRPGEWLAERRARLDTRLKEFGRAARTGTIPGGIIENGKLHIDKLRADTPEGAEDLVLDLYQQLPPARITDLLLEVDERTGFSEAFTHLRTGAPCSDRIGLMNVLLAEGVNLGLRKMAAATNTHSFWELLRIARWHVEGSAYDRALAMIVEAHAALPMAAFWGQGQSASSDGQFFLATEQGEAMNLINAKYGNVPGLKGYSHVSDQYAPFATQVIPATVSEAPYILDGLLMNDAGRRVRQHFADTGGFTDHVFAACALLGYRFAPRIRDLPQKRLYAFTPNATPANVRALVGGKINEPLIERNWPDILRIMATIAAGIVAPSQILRKLASYPRQNELALALREVGRIERTLFMIDWILDAGLQRQAQIGLNKGEAHHALKRAISFHRRGEIRDRSGEGQHYRIAGMNLLAAIIIFWNTMKLGEVVNTRAASGTHIAPDLLAHVSPLGWEHINLTGEYRWPKSLA
>NZ_AP017658.1|WP_008832583.1|46760_47381_+|recombinase-family-protein
MLIGYARVSKADGSQSLDLQHDALRAAGVEPGNIYDDRASGSRDDRPGLAACLKSLRDGDVLIVWKLDRLGRTLTHLVSTVQNLSDRGIGLRVLTGKGAQIDTTTPSGRMVFGIFATLAEFERDMIRERTMAGLAAARARGRKGGRKFALSKAQVRLAQAAMAQRDTSVSDLCKELGIERVTLYRYVGPNGELRDYGQRVLAAKTR
>NZ_AP017658.1|WP_007686150.1|47377_47908_+|GNAT-family-N-acetyltransferase
MMMTGAPIKLTQADAADVADLYNRCSDYFLLQDGAAPTLDDARELFSDVPPEKSAHNQAVLGWKGPGGLYAIAAILRDYPRDGTWYLGFMIVDAAQRGRGVGRSIYSTVESWAAARGATEIRLAVLEANEAAERFWRSLGFIEYRRVGPDTFKMRSHRRIELSRRLSGATVEGSNK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_AP017658	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence	34773-34814	0	1.0
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP005192	Sphingobium sp. MI1205 plasmid pMI3, complete sequence	31147-31188	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	20315-20356	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NC_020562	Sphingomonas sp. MM-1 plasmid pISP1, complete sequence	159529-159570	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	56938-56979	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP005193	Sphingobium sp. MI1205 plasmid pMI4, complete sequence	18238-18279	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NC_020563	Sphingomonas sp. MM-1 plasmid pISP4, complete sequence	33102-33143	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP005088	Sphingobium sp. TKS plasmid pTK4, complete sequence	56281-56322	1	0.976
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP053024	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-C-Sy, complete sequence	10482-10523	2	0.952
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NC_019376	Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence	34847-34888	2	0.952
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP041020	Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence	43053-43094	2	0.952
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	5424-5465	2	0.952
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	24899-24940	2	0.952
NZ_AP017658_1	1.1\|34773\|42\|NZ_AP017658\|CRISPRCasFinder	34773-34814	42	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	169570-169611	2	0.952

1. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_AP017658 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence) position: , mismatch: 0, identity: 1.0

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaaaactcacgc	Protospacer
******************************************

2. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP005192 (Sphingobium sp. MI1205 plasmid pMI3, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

3. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

4. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NC_020562 (Sphingomonas sp. MM-1 plasmid pISP1, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

5. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP047220 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccctaaaactcacgc	Protospacer
******************************.***********

6. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP005193 (Sphingobium sp. MI1205 plasmid pMI4, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

7. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NC_020563 (Sphingomonas sp. MM-1 plasmid pISP4, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

8. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP005088 (Sphingobium sp. TKS plasmid pTK4, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
********************************* ********

9. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP053024 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-C-Sy, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccaaaggctaccctaaaactcacgc	Protospacer
*******************.**********.***********

10. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NC_019376 (Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

11. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP041020 (Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

12. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

13. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

14. spacer 1.1|34773|42|NZ_AP017658|CRISPRCasFinder matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccccaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5280 : 70246

Escherichia_phage(17.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001389365.1\|5280_6045_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_061939919.1\|8139_9093_-	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.9e-30	33.0
WP_061939951.1\|9089_9413_-	hypothetical protein	NA	NA	NA	NA
WP_061939917.1\|9412_10066_-	ParA family protein	M4HZI5	Mycobacterium_phage	3.9e-11	33.3
WP_066522052.1\|10138_10771_-	SprT-like domain-containing protein	A0A1V0DYF5	Dinoroseobacter_phage	9.5e-39	47.3
WP_174521995.1\|11174_14102_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-225	43.6
WP_066522055.1\|14270_14864_+	recombinase family protein	A0A1S6L009	Salmonella_phage	3.4e-46	56.6
WP_007683408.1\|15853_16552_+	conjugal transfer protein TraJ	NA	NA	NA	NA
WP_001389365.1\|17366_18131_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_096362260.1\|19913_21446_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_096362261.1\|21982_23578_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_082734689.1\|24296_24716_+\|transposase	transposase	NA	NA	NA	NA
WP_062346440.1\|24712_25084_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-07	30.4
WP_066522435.1\|25378_26872_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	7.9e-92	38.5
WP_082734689.1\|27200_27620_+\|transposase	transposase	NA	NA	NA	NA
WP_062346440.1\|27616_27988_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-07	30.4
WP_066522435.1\|28282_29776_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	7.9e-92	38.5
WP_006961814.1\|30457_33367_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_006961816.1\|33509_34376_+	recombinase family protein	E5FFF9	Burkholderia_phage	4.8e-25	40.0
WP_011950653.1\|36585_37146_-	recombinase family protein	A0A1W5LU24	Ralstonia_phage	3.5e-29	45.4
WP_066522521.1\|37213_37978_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.2e-88	66.5
WP_123905556.1\|38166_39159_-	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_066522521.1\|39454_40219_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.2e-88	66.5
WP_083949265.1\|42705_42972_-	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	4.4e-06	51.0
WP_066522399.1\|43019_43313_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_066522401.1\|43300_43579_-	CopG family ribbon-helix-helix protein	NA	NA	NA	NA
WP_016746447.1\|43743_46635_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.4e-190	38.8
WP_008832583.1\|46760_47381_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.6e-38	49.7
WP_007686150.1\|47377_47908_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061939936.1\|48455_48899_+	hypothetical protein	NA	NA	NA	NA
WP_061939934.1\|49699_49978_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A0M3LQB1	Mannheimia_phage	1.3e-19	45.7
WP_061939959.1\|49988_50273_+	HigA family addiction module antidote protein	A0A2I7RTP8	Vibrio_phage	1.2e-06	44.3
WP_061939932.1\|50584_51958_-	hypothetical protein	NA	NA	NA	NA
WP_061939957.1\|51958_52528_-	recombinase family protein	A0A219Y912	Aeromonas_phage	9.2e-33	46.6
WP_048575129.1\|52668_55638_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-198	39.8
WP_061939930.1\|55863_58779_-	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	3.9e-10	25.5
WP_061939928.1\|58948_59272_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_061939955.1\|59291_59534_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_061939926.1\|59514_59799_+	hypothetical protein	NA	NA	NA	NA
WP_061939953.1\|60506_63440_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.9e-150	34.4
WP_061939924.1\|63586_64192_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.5e-33	45.5
WP_061939921.1\|64188_65550_+	hypothetical protein	NA	NA	NA	NA
WP_066522435.1\|65873_67367_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	7.9e-92	38.5
WP_062346440.1\|67661_68033_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-07	30.4
WP_082734689.1\|68029_68449_-\|transposase	transposase	NA	NA	NA	NA
WP_001389365.1\|69481_70246_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7

DBSCAN-SWA_2

84856 : 105639

uncultured_Caudovirales_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096362064.1\|84856_86119_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.3e-39	32.7
WP_066522470.1\|86115_86976_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.0e-56	47.0
WP_096362263.1\|87002_87911_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	4.4e-13	35.8
WP_007688046.1\|87910_88675_-	ParA family protein	B0ZSI1	Halomonas_phage	8.9e-07	28.9
WP_007688055.1\|88687_88864_-	hypothetical protein	NA	NA	NA	NA
WP_007688057.1\|89055_89448_-	DUF3768 domain-containing protein	L7TKV8	Rhizobium_phage	5.0e-14	44.0
WP_066564291.1\|89707_90058_+	hypothetical protein	NA	NA	NA	NA
WP_031295760.1\|90196_90718_-	hypothetical protein	NA	NA	NA	NA
WP_007688065.1\|90825_90990_-	hypothetical protein	NA	NA	NA	NA
WP_007688066.1\|91295_91730_+	hypothetical protein	NA	NA	NA	NA
WP_007688067.1\|91805_92213_-	single-stranded DNA-binding protein	A0A0M3LP44	Mannheimia_phage	1.2e-13	35.9
WP_007688068.1\|92620_93289_-	hypothetical protein	NA	NA	NA	NA
WP_007688069.1\|93401_94343_-	DUF2493 domain-containing protein	A0A0D4DBJ6	Vibrio_phage	6.0e-05	35.3
WP_007688070.1\|94690_95431_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.7e-74	71.6
WP_007688071.1\|95430_95862_-	GNAT family N-acetyltransferase	A0A2H4J155	uncultured_Caudovirales_phage	1.8e-20	44.7
WP_007688072.1\|95858_96926_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_007688073.1\|96922_97363_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	7.0e-49	69.3
WP_007688074.1\|97359_97896_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.6e-21	36.9
WP_013849891.1\|97908_98247_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_007688077.1\|98299_99223_-	DUF1738 domain-containing protein	K4JTS1	Caulobacter_virus	8.1e-47	40.2
WP_007688079.1\|99315_101328_-	ParB N-terminal domain-containing protein	G8DH78	Emiliania_huxleyi_virus	4.5e-34	27.5
WP_013041753.1\|101439_105639_-	strawberry notch family protein	A0A076FMQ0	Aureococcus_anophage	1.2e-25	25.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_AP017655

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP017655_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP017655_1

2192622-2192726

Orphan

Consensus_repeat	Method
CCGGGCGACGACAGTCGGCAAGGGGGACGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP017655_1

>merge|NZ_AP017655|1|2192622-2192726|CRISPRCasFinder
CCGGGCGACGACAGTCGGCAAGGGGGACGGCATGACGCCTGACGGGCGCGCGCTTTTCCTGTCCCACGACCGTTCCGGGCGACGACAGTCGGCAAGGGGGGCGGC

>NZ_AP017655|1|1|2192622-2192726|CRISPRCasFinder
CCGGGCGACGACAGTCGGCAAGGGGGACGGC	ATGACGCCTGACGGGCGCGCGCTTTTCCTGTCCCACGACCGTT
CCGGGCGACGACAGTCGGCAAGGGGGGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP017655.1\|WP_066518003.1\|2201341_2202211_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_AP017655.1\|WP_096362221.1\|2198785_2199400_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NZ_AP017655.1\|WP_066517989.1\|2189868_2191308_-\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_AP017655.1\|WP_066517994.1\|2194190_2195624_+\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_AP017655.1\|WP_066518062.1\|2187084_2188059_-\|GDP-mannose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|187562
NZ_AP017655.1\|WP_066517988.1\|2188771_2189869_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|335855
NZ_AP017655.1\|WP_066517979.1\|2182915_2183731_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_AP017655.1\|WP_066517975.1\|2180542_2181709_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_AP017655.1\|WP_066517981.1\|2183762_2185397_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225747
NZ_AP017655.1\|WP_066517995.1\|2195620_2196733_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_AP017655.1\|WP_066518067.1\|2200457_2201345_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_AP017655.1\|WP_066517983.1\|2185389_2186124_-\|polysaccharide-biosynthesis/export-family-protein	unknown	unknown	gnl\|CDD\|132072
NZ_AP017655.1\|WP_083949104.1\|2197706_2198765_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187541
NZ_AP017655.1\|WP_169800561.1\|2186120_2187029_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|132997
NZ_AP017655.1\|WP_066517987.1\|2188055_2188775_-\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133015
NZ_AP017655.1\|WP_066518005.1\|2202325_2205961_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|226973
NZ_AP017655.1\|WP_066517977.1\|2181705_2182923_-\|DUF1972-domain-containing-protein	unknown	unknown	gnl\|CDD\|340858
NZ_AP017655.1\|WP_169800562.1\|2206472_2206631_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP017655.1\|WP_066518002.1\|2199384_2200437_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NZ_AP017655.1\|WP_066518000.1\|2196729_2197710_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|224137

Protein	Function_ID	Function_description	E-value
NZ_AP017655.1\|WP_066518003.1\|2201341_2202211_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.67978e-174
NZ_AP017655.1\|WP_096362221.1\|2198785_2199400_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	5.35256e-98
NZ_AP017655.1\|WP_066517989.1\|2189868_2191308_-\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	7.61759e-169
NZ_AP017655.1\|WP_066517994.1\|2194190_2195624_+\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	7.30317e-30
NZ_AP017655.1\|WP_066518062.1\|2187084_2188059_-\|GDP-mannose-4,6-dehydratase	gnl\|CDD\|187562	cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs. This subgroup contains CDP-D-glucose 4,6-dehydratase, an extended SDR, which catalyzes the conversion of CDP-D-glucose to CDP-4-keto-6-deoxy-D-glucose. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.65319e-95
NZ_AP017655.1\|WP_066517988.1\|2188771_2189869_-\|hypothetical-protein	gnl\|CDD\|335855	pfam04616, Glyco_hydro_43, Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.77149e-07
NZ_AP017655.1\|WP_066517979.1\|2182915_2183731_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.9205e-22
NZ_AP017655.1\|WP_066517975.1\|2180542_2181709_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.60887e-47
NZ_AP017655.1\|WP_066517981.1\|2183762_2185397_-\|hypothetical-protein	gnl\|CDD\|225747	COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane].	1.5445e-25
NZ_AP017655.1\|WP_066517995.1\|2195620_2196733_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.56722e-23
NZ_AP017655.1\|WP_066518067.1\|2200457_2201345_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.37913e-113
NZ_AP017655.1\|WP_066517983.1\|2185389_2186124_-\|polysaccharide-biosynthesis/export-family-protein	gnl\|CDD\|132072	TIGR03027, pepcterm_export, putative polysaccharide export protein, PEP-CTERM sytem-associated. This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.34275e-28
NZ_AP017655.1\|WP_083949104.1\|2197706_2198765_+\|SDR-family-oxidoreductase	gnl\|CDD\|187541	cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs. UGD catalyzes the formation of UDP-xylose from UDP-glucuronate; it is an extended-SDR, and has the characteristic glycine-rich NAD-binding pattern, TGXXGXXG, and active site tetrad. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_AP017655.1\|WP_169800561.1\|2186120_2187029_-\|glycosyltransferase	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	1.32937e-10
NZ_AP017655.1\|WP_066517987.1\|2188055_2188775_-\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133015	cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose. Alpha-D-Glucose-1-phosphate Cytidylyltransferase catalyzes the production of CDP-D-Glucose from alpha-D-Glucose-1-phosphate and MgCTP as substrate. CDP-D-Glucose is the precursor for synthesizing four of the five naturally occurring 3,6-dideoxy sugars-abequose (3,6-dideoxy-D-Xylo-hexose), ascarylose (3,6-dideoxy-L-arabino-hexose), paratose (3,6-dideoxy-D-ribohexose), and tyvelose (3,6-dideoxy-D-arabino-hexose. Deoxysugars are ubiquitous in nature where they function in a variety of biological processes, including cell adhesion, immune response, determination of ABO blood groups, fertilization, antibiotic function, and microbial pathogenicity.	3.6497e-65
NZ_AP017655.1\|WP_066518005.1\|2202325_2205961_-\|autotransporter-domain-containing-protein	gnl\|CDD\|226973	COG4625, COG4625, Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown].	9.49545e-42
NZ_AP017655.1\|WP_066517977.1\|2181705_2182923_-\|DUF1972-domain-containing-protein	gnl\|CDD\|340858	cd04955, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.	2.5793e-79
NZ_AP017655.1\|WP_066518002.1\|2199384_2200437_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_AP017655.1\|WP_066518000.1\|2196729_2197710_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|224137	COG1216, COG1216, Predicted glycosyltransferases [General function prediction only].	3.86107e-45

>NZ_AP017655.1|WP_066517989.1|2189868_2191308_-|undecaprenyl-phosphate-glucose-phosphotransferase
MPIQGSDADFRTSGIFQQYGAILVRLCRIVDTLLIVLAMLLCVRAVWPSPREAVVDALLCVAVLEFTASFFHLSRSWRVVRLRHEIADLGSYWTISFLALLGLFWLLGDLPFARISEWLPVMTAWYAAALAAIILFHLAVRMGLRYYRAFGHDHRNAAFIGATETAERLQAVFARQRWMGIRSLGVFDDRQPGDDRTAAIPADQMRGSVDALYDLARQGAVSRIYVTLPMAAEQRIKAIIDRFGDTTASIYYCPPLFRLDLVGARWDDVYGQPVVSVVESPFEGYSRIVKRIEDIALTLLALPFLLTVTAIVAVAIKLDSPGPVFYRQLRYGLDGKPFRIWKFRSMHVSDSDHFVQARRGDNRITRVGGFLRRTSIDELPQFLNVLRGNMSVIGPRPHPIALDESFRPVIRRYSVRHKIKPGITGLAQINGWRGETETLDKMEQRVVHDIEYLRRWSLWLDLKILARTVLVPFADRNAF
>NZ_AP017655.1|WP_066517988.1|2188771_2189869_-|hypothetical-protein
MRGRVSLALAALLAGCGAADPAPEPPPAAAGWTVSRHAPVIPAGSLRPQALWNDPSLLRTDEGYVLYMTSSTGEPFKPPVLPFRATSPDGRRWTLSPATPLLSPEGGPYASIETPSVARFRGRYWMAFTGIYPDPDPSPMAIGLAISPDGIDWRIAQWTLLRASGGATDWNGYLVGEPGLAVLGDRLFLYFSAVGGREGGGPPLQSIGLVTSTDGVRFSAPRQVLRQGPLYPAAQGYAGYSSPAALARDGGIDLFYSVAHVRKGADPEWQQAAIHHARSADGDAPFVEDKAPVLTRRSTDWTDGEILAPAPLVDGTDLQLWFAGHVANAKLAPLIRRGFSGPEFGIGIATLPLEQFDRTMKGTAR
>NZ_AP017655.1|WP_066517987.1|2188055_2188775_-|NTP-transferase-domain-containing-protein
MKVVILCGGQGIRAFPFTTYLPKPMLPLGGTPVLVHVIKNFIRQGFHEFILAAGYRQDVLHDYFEGKDIGAHIEIVDTGEEADTGRRIYNCRHLIDGPFIATYGDGLSDVSLHDVIAFHRGHGARLTITSVPMYSQYGVLSVAEDGAIDRFVEKPLIQDYWINAGFMVMEPAIFDDWNGENLERDIIPPMIARREAFTYRHDGFFKSFDFYKDVVEMDEVIAEGQPLPWIAAPMQERAA
>NZ_AP017655.1|WP_066518062.1|2187084_2188059_-|GDP-mannose-4,6-dehydratase
MSFWKGKTCLVTGATGFLGGSLVAELLAQGAEVVALVRDMVPQSRFQSTDLAGRAKVVRGALEDYDVIERAINEYAVDTVFHLGAQAIVGVANRNPLSTFEANIKGTWVLLEACRRVGTVERIVVASSDKAYGDHEVLPYREDFALQGRHPYDVSKSCADLIALSYAQSYRLPVTITRCGNLFGPGDLNVNRIVPGTCLAAIDGERPVIRSDGSPVRDYVFVEDIVRAYLLLGEHMGDAGIVGRAFNFGTGEPVSVLDLTRRTLAAAGRADLEPDVRNNAHGEIQAQYLSSDLAAEKLGWAPAARLDERLRQTFLWYRDHRHFF
>NZ_AP017655.1|WP_169800561.1|2186120_2187029_-|glycosyltransferase
MESLRIQSFAWFRAVVSDNCSPGGAGEEVRAFVEGLGDPRFRFVQQPENRGEYGQGRYLLAAAGNAEYFCILHDDDLLAPYYLQRAVAALDASPGCALFVANPWLLDETGRASQPQTMDYHRRHGRCRREAGPFPVLDTHMESGFTPISGTLFRTAALHASGFVDADCHGNFPFELNIFTRLGDVGATGWFDPDLLVGFRFHAGSLRNTLGLMHNPAVVGTMLRILERRRYRGAPERRRRAIVARLHRAWAQMRLEEGDVRAARQAVRHACAVNPLSPRAWWMRARLSLRPPRAFPTEGTSS
>NZ_AP017655.1|WP_066517983.1|2185389_2186124_-|polysaccharide-biosynthesis/export-family-protein
MKHLVLAAPLMLLCACAGSLKEARTVAAAPDVIRSTARYERAYLLAPGDMVEVLVDRMPELSRTATIRPDGMVTLPKTGDIRLAGLAPMDAARSVRQALLPRVIDPQVTVAVTNPREARVFVAGEVNRPGAVPLRDAPTAAQAIVLAGDLGKAAAHGNVALIRLDDAGHLTAHILHTQAKGHAGLLFTLQNLPLQPDDVIVVQESGAARFGRFIQNYVNAPLGGLTQLIAPYVQLRLLQEINRD
>NZ_AP017655.1|WP_066517981.1|2183762_2185397_-|hypothetical-protein
MTDPHALPMASAPHAEAVPYRPEADSFDFRRAGRIVRLAMAGHRRLIVAVTALTLALVTLYILVWPPVYSASVTLSAVPDDDRQRESFYDSWAVFRRNALKDERVLLTSGPVLKQVISDLDLRYEDVYHPPLRYLTYLWTQSWPGQAWRATKDFLRPRQPSRYVPTQEEVDRARTLDDFRTGVAMIPVADSNIGLLTVRGPSPRVAEIADKVAATYIAQRRRRFADEAHQAYAALQAETERAHRDLRALEQRMERYYTQNDMLLMFEKDKIEVGQLLQQQQGVDDKRVAIAETQRELSVVAGQLAREGSTIVASRLVQDNPVAAALRQERAKLVAARDSMLLRYRPDSPDVRDMNDQIAAIEKQLAAEPQQGVQQTNIARNSGHDALRARKAALEAKLAADKAGLVALSAEVEARRQQIDRIPQKMKDSHDLSRAHDILEKTYLALQDKLMTAAVTAATAQSAPSAIQVVEGASLPDKPDAPRTKLLLVAAIVVGIGSGIASAVVLDLLQNRANRFRLTQPDSPFPLLAIVEQDRAHARRLFEQ
>NZ_AP017655.1|WP_066517979.1|2182915_2183731_-|class-I-SAM-dependent-methyltransferase
MKYHIISATRSLGLLPVLDRMTFLHKSAKAARGNRAFLASRPDFAVPPADLAFDAYNKVDWADYHDMGLRHAGLFARLIRERLPAHPAPAILEWGCGPGRLIRHMAALMPDRAPRIVGTDYNPATIDWCRDHLPDIEFALNGLAPPLPFPDNSFDATYNFSVFTHLSEEMHEAWARELYRVLKPGGMMIATTHGDHYRYLLTRRDEADAYDSGRIVTQRRFREGKKWFFAIHPPAYVRNTLLAGFKQVEQVPPDAAADMTQDVWLGFKPHD
>NZ_AP017655.1|WP_066517977.1|2181705_2182923_-|DUF1972-domain-containing-protein
MTDASRPLRIAIIGDRGIPARYSGFSTLVEELAVGLVRDHGMDVTVYCRNQYYEERPARFKGVRCRYLPAPGGKSFESIVHSNLAVLDASLRRFDLVFVVDPGNGPFIVPLRLRGVPVLIHTDGLGWQRRKWSPLQQRYYKWSEWVSARLASWLVTDSRAMQLYYRDEYRAGSTYIPYSGEVGDAPDLAALARFGVTPGQYYLVVARMEPENNVDHIIREYRLSGVKHPLVVVGSVPYESDYARAVAAEDDGQVRCVGGVFESAALNALYRHCAAYLHGHEVGGTNPSLLRAMHWGAPCVPIDVVFHRENVGPDNPYFSKARGHLAAILADLDARPDRRAALGRAAQARAEAAFRWDAVVDGYAGLFRRMLDLKASRTRPSSDRIGEMYRPDRFAASPDLPARTA
>NZ_AP017655.1|WP_066517975.1|2180542_2181709_-|glycosyltransferase-family-4-protein
MKILHVFNRHRGGGGSDNAWDSTIALSRRRGLSVDCFERDSRALPPGIRGRLTAFANGLYAPGALRSFAARLDRDRPDIVHTHELYPLIGPWIFELCARAGIPVVHSCYDFRITCAVATHHDGRTLCTRCTDRGAHHALLRDCRNNPLESAAFALRHALAARRDFYRRHVSRFIVLTPFSRDWLHERAHIPLDRISINECVIPAAPRPVDPAKGGYFAFAGRFVPEKGLDILLEAARMAQVPVHVAGPAGCDPAPLVRQGVPATITRDADMLAQVYRGARALVVPSLWFETFAIVAAEAMAHGVPVIASRIGALTDTVREGETGLHFRPGDAADLARQLRRMWDDPQLCRALGKAAYADVQSRFDEDAHFDRLMQVYRTVARPSRRSA
>NZ_AP017655.1|WP_066517994.1|2194190_2195624_+|oligosaccharide-flippase-family-protein
MSGASLFRNSAALVAGRIALSLLRMVAALCVARLAGAESFGAYALLLGIVALFEWLVDFGQTDIAVRDAARDPDRRDTLLAALSRAKRMQGLAGAAALPLILAVMGYDGPVILAGCAGSVAIGASALLQPARAALRLALRPDRDMAAELAGTAAMLPLLALASLMRAPLPVLIATFALARLAQAALAIHWAPPCRAAAPASARHLARSALPLGVAGLLVVLYDALAPLLLAHLLDLKAVAIYAAAARFIFPILIAVQAINTAFFPVIAHGWRRDPAGMERTQQAALLLSVAVSAPLFAGIHGGADFLMSLMGGDFRSGAPLLRLMAWVLLARAVTTAMSPLIVVAGRQGRAMLLTLASLAAQVVALFVLVPRLGVIGAGVGYLLVELLLGSLAVSWMGQAVSGARIDWRPVAALLAAAALAVRLVDATPLAGSFPGGVAAGTLSLGFILLLARLMRRRMAPVWRDLRRRRSLAGDGA
>NZ_AP017655.1|WP_066517995.1|2195620_2196733_+|glycosyltransferase-family-4-protein
MSPPALPRIAIACPGVGLVQRGFERLFRDLFDEMRGEFPMTLFKGGGDRTAEEVVLPFLARGGRAIRYLPLHRLMGRTPMHAECLTFALAMLPHIATGRHDIVHVIDPPLARVLFHLRRALRLKFRMLYTEGTAMPPADYPPCDHLHQISRATLADAVAKGHPSDHMSLVPCGYRPERFATSLDRRALRARHGIAPDRFVILSVAALNRGHKRTHHLIDEVARMKGDPLLWLDGSLDHGDPDLPDYARTRLGERVRVTHVPSGEVGALFALADVMPHAATFEAFGLALVEAAAAGLPVITHDAPHFRWLLPNPACWIDMRRPGALTALLERLAADPDERARRVMRDHAQARYRWSALRPAYADLYRSLMP
>NZ_AP017655.1|WP_066518000.1|2196729_2197710_+|glycosyltransferase-family-2-protein
MTAPRLAIVIVNWNVRDLLRDCLNAIAASEGLEPGEVETIVVDNASADGSAAMVAREFPWVRLIESGGNLGFANGCQLGYEATDAPFVMLLNPDTEADPDAIASMLATIGGDRGIGIVGSRLRNSDGSFQRASGGAFPTLRNLAWNYLFLGLMLPRRCAPPAVYLDDDPPGVRRIDWVSGASLTFRREAVGPRIFHPEFFMFGEDMELCHRVAREGWQVLYSARQTITHHHGQSFARQRSMEVLASVYKGPRFFFRRERGVAARIAYDAILFTGYASRWAIFSLLALVRPGRDYGAMARFSRRYLGAMARTILNERLDLQGKEWAR
>NZ_AP017655.1|WP_083949104.1|2197706_2198765_+|SDR-family-oxidoreductase
MNKGVKRILVTGGAGFLGSHLCDRLVADGHEVLCVDNLFTGSKSNLTGLLGRDRFEFMRHDVTIPLYVEVDEIYNLACPASPLQYSINPVQTTKTSVHGAINMLGLAKRTGAKILQASTSEVYGDPDVHPQPEEYWGHVNPIGPRACYDEGKRCAETLFFDYHREGSVRIKVARIFNTYGPRMDPADGRVVSNFIMQALAGQPITIYGDGQQTRSFCYVDDLVDGLVRLMDSGEAVTGPINIGNPGEFTILELAETILQLTGSRSPLVRKPLPMDDPRQRRPDIRRAQADLDWAPSVTLTEGLKRTIDYFAALAAAPEVRRIVAADTMPPAAMGDILLPVARPETPPAVWTR
>NZ_AP017655.1|WP_096362221.1|2198785_2199400_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MTVPSLIPAVRRSDARGWFAETYSEAAFDRLGISCRFVQDNHSFSRAAYTLRGLHFQAPPHAQAKLVRCIRGRIFDVAVDIRTGSPSYGQWLGAELSARNGHQLFVPAGFAHGFLTLEEDCEITYKVSDIYAPDCEGGIGWDDPAIAIDWPMPAGIMPYLSPRDAFLPPLSEIATPFFFDGGAPLAQNGVVHGPRQGSGPCVSL
>NZ_AP017655.1|WP_066518002.1|2199384_2200437_+|dTDP-glucose-4,6-dehydratase
MRILVTGGAGFIGSALIRHLIANSGHEVLNLDKLTYAGTLSTVAGVAANPRYRFVQADICDGAKVAEAMASFRPDIVTHLAAESHVDRSIDGPDAFIRTNIVGTFRMLAAARDYWSALKGEERDRFRFHHISTDEVYGSLGDTGLFTEDTAYDPRSPYSASKAGADHLVSAWGHTYGLPVLITNCSNNYGPYHFPEKLIPLMIVKALAGEALPVYGAGDQVRDWLYVDDHVRALQAVFERGTPGHTYNVGGDSERRNIEVVRAVCAILDRLRPGPDGSHADRIVHVADRPGHDRRYAIDAARIRRELGWEPLESFESGLEKTVRWYLAHEEWWRAIVRDRDSGRRRGLAA
>NZ_AP017655.1|WP_066518067.1|2200457_2201345_+|dTDP-4-dehydrorhamnose-reductase
MRTILVTGGAGQLGTALRALPLPQGWSIHAADRTTLDLRDSDAIGRFIARGHHAAVINAGAYTDVDGAETDVVEAWRINALAPAALAAACAEAGIPLVHVSTDYVFDGDGDRMRQPHDPVRPLGVYGASKAAGEMAVTTAGGQHAIVRTAWLVSAHGHNFVRTMLRLAAERDSIGVVSDQRGSPTSAADLARALAAIAMGLALDPEAPAGIYHFSNRGAVSWADFARVILAGSAARGGPRARIENIASSAYPMRARRPARSLLCTQAIERDYGIVPRPWEEALDEILDQLMGKKL
>NZ_AP017655.1|WP_066518003.1|2201341_2202211_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPATLAVNKQLLPVYDKPMIYYPLSVLMLAGIRDILLISSPDYLDSYRRLFGDGTTWGLHIHYAEQPRPEGLAQAFLIGADFIGDDPVALVLGDNIFFGAHLTTLLRNAMARTHGATVFSYRVDDPERYGVVELGPDGRALSIEEKPAHPKSNCAVTGLYFYDNRVVDFARRLIPSERGELEISDINRLYMETGDLHVEQMGRGYAWLDTGTHDSLIEASEFVRTVQNRQGIQIACLEEIAYQQGFIDRAQAIARGEAFAKTAYGQAIIMAAQGR
>NZ_AP017655.1|WP_066518005.1|2202325_2205961_-|autotransporter-domain-containing-protein
MAVPVGAQTIEAQAGAGPSLRFWDGSDPALHENGVVDGGSGRWNAHDPSWTDAQGAVNGPMRPVPAFVLFQGAAGTVTIDDSLTAPSITGMQFLTDGYRLTGGRLRLDGGAYTSIRPGPGVTTRIDAELTGDSGLLFNDFGTLILTGDNSYTGGTRVDAGTLIGDTRSIRGELENAGTVIFDQKEDGTFTGGIGGLFSSWGLMVKRGQGALTIGGSSLDWRIEEGRLVSPAARLGGNMAIGAAGKLTLTGGPSDTEAAYHYALSGSGALDLAGEGMVVLTGQSGGFTGQTRVAGAALRVDGALGGSLSVGSHGVLSGAGRVGAARVDSGGRLVGSAGGTLGFSSLTLGPGAVIDAVFAGTDAPPLFAVEGDLTLDGTLNIGGNLPLGQGVYRLFSYGGQLTDNGLQIGALPPGQGSGTLSVQTATPGQVNIVAATGDRALRFWDGGDATRYGNGVVDGGPGVWANGTLGWTGSDGAHNDPAGPGDFAIFAGRGGHVLIDDANGAVSTGGMQFATSGYRLSGDPLTLSGGRRTVIRVGDGSAASSGVTVEIASRITGGGVLVKRDAGTLILSGDNDRTFGIDVEAGSLVGDARSIRGDLSNAGTVIFDQRGNGTFRSDIASLDGVAGSLVKRGAGDLTLTGRSSLDWTVEEGRLLTNAGRFIGDATLHPKGSIEFASASNTRYLGRLAGSGRFVKAGAGNLALGTDSRGFTGDTLVRAGSLTVEGAIRGRLTVAADAALAGYGSMGSVRVDPGGRIAPGPSIRTLTVQGDLLIASGARYEVEVDPTGAASDRIDVLGKATLAGTVAHVGPNGAYRPRATYTILTARGGIEGRFDDVRSTFAFLTPSLGYTPHAVTLTLERNDVRFDQVAATDNQRATAAALESLSSDNGAYDAVVTADAATARQAFDSLSGEFHASLRTALIENSRLSREATLDQLRTRRTAPGLAMWGQVLDSSRHWTGHSGVSTLAGDMMGTLAGVEAQTPGGFRIGMLGGHHRDALHGRGNADIDGYHAGVYAGGASGPLGFGGGLIFGWQDVAAQRLVTFNGFQEGVQSRYRATTMQAFAEAAYRVDFDEGALEPFVGLTHVALSVGSSREAGNVAALDLARDRLRTSYTTMGVRGRTAIPLGGASLSLRASAAWQHAFGDRTGMIEAALGGRRFTITGARIAQDSLVGELSLDAALTPALRLNLGYSGALPRGARDSVARAALTWSF
>NZ_AP017655.1|WP_169800562.1|2206472_2206631_+|hypothetical-protein
MSNGQDERKARLAQALRDNLRRRKAQARAGTAASRPADRDRDGDAQRHDETD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11350 : 62737

Enterobacteria_phage(50.0%)

transposase,integrase

attL 57460:57475|attR 69564:69579

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096362064.1\|11350_12613_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.3e-39	32.7
WP_066522470.1\|12609_13470_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.0e-56	47.0
WP_096362065.1\|13720_15235_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_083949276.1\|15435_15615_-	hypothetical protein	NA	NA	NA	NA
WP_123905411.1\|16119_16938_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_083949247.1\|16934_17894_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_123905412.1\|18126_20445_+	TonB-dependent receptor	NA	NA	NA	NA
WP_066522084.1\|20521_21301_+	hypothetical protein	NA	NA	NA	NA
WP_083949245.1\|21316_22429_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_169925546.1\|22629_23760_+	cytochrome P450	NA	NA	NA	NA
WP_083949256.1\|24741_25506_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.8e-18	32.6
WP_066522187.1\|25578_25869_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_083949254.1\|27032_27833_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_066522184.1\|27877_28687_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_169800599.1\|28944_29439_-	hypothetical protein	NA	NA	NA	NA
WP_066522183.1\|29473_29947_+	HNH endonuclease	NA	NA	NA	NA
WP_066522177.1\|30084_30729_+	DUF433 domain-containing protein	NA	NA	NA	NA
WP_066522166.1\|30725_31112_+	DUF5615 family PIN-like protein	NA	NA	NA	NA
WP_096362067.1\|31264_31543_-	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_066522512.1\|31632_32469_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_096362187.1\|32489_32780_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A0M3LQB1	Mannheimia_phage	2.2e-14	46.2
WP_123905416.1\|32895_33162_-	hypothetical protein	NA	NA	NA	NA
WP_083949228.1\|33158_33437_-	DUF3325 family protein	NA	NA	NA	NA
WP_066521913.1\|33433_33736_-	iron transporter	NA	NA	NA	NA
WP_066521915.1\|33732_35364_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_066521917.1\|35433_37686_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_066521919.1\|37986_38502_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_066521924.1\|38638_39604_+	FecR domain-containing protein	NA	NA	NA	NA
WP_066521929.1\|39745_42196_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_083949230.1\|42253_43345_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_083949231.1\|43341_44145_+	energy transducer TonB	NA	NA	NA	NA
WP_096362068.1\|44291_45251_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_169800587.1\|45649_46252_-	FCD domain-containing protein	NA	NA	NA	NA
WP_066521579.1\|46339_47569_-	amidohydrolase family protein	NA	NA	NA	NA
WP_066521581.1\|47591_48791_-	MFS transporter	NA	NA	NA	NA
WP_066521583.1\|48794_50438_-	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_066521587.1\|50434_52489_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_066521589.1\|52672_54919_+	TonB-dependent receptor	NA	NA	NA	NA
WP_083949215.1\|54962_56246_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_066521598.1\|56257_56629_+	hypothetical protein	NA	NA	NA	NA
WP_066521600.1\|56640_57810_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
57460:57475	attL	NA	NA	NA	NA
WP_066521602.1\|57839_58223_+	hypothetical protein	NA	NA	NA	NA
WP_157080340.1\|58763_59009_-	hypothetical protein	NA	NA	NA	NA
WP_157080341.1\|59017_59995_-\|integrase	phage integrase SAM-like domain-containing protein	NA	NA	NA	NA
WP_066521609.1\|60641_60887_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_066521611.1\|60883_61270_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_066521616.1\|61350_61602_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_066522499.1\|61666_62737_-\|transposase	IS630 family transposase	NA	NA	NA	NA
69564:69579	attR	NA	NA	NA	NA

DBSCAN-SWA_2

67838 : 96381

Leptospira_phage(50.0%)

transposase,integrase

attL 59477:59491|attR 98826:98840

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
59477:59491	attL	NA	NA	NA	NA
WP_066521675.1\|67838_68480_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_096362069.1\|68584_69708_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-46	39.4
WP_169800589.1\|69811_70699_-\|transposase	transposase	NA	NA	NA	NA
WP_157080342.1\|70905_71349_+	hypothetical protein	NA	NA	NA	NA
WP_157080343.1\|71665_71812_-	hypothetical protein	NA	NA	NA	NA
WP_066521686.1\|71837_72101_-	DksA/TraR family C4-type zinc finger protein	A0A173GD24	Pseudomonas_phage	1.4e-07	43.7
WP_066521692.1\|72394_72685_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_066521693.1\|73172_73427_+	antitoxin	NA	NA	NA	NA
WP_157080344.1\|73852_74020_+	hypothetical protein	NA	NA	NA	NA
WP_123905417.1\|74028_75168_+\|integrase	site-specific integrase	G9L697	Escherichia_phage	9.2e-16	23.7
WP_066521696.1\|75229_75547_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066521699.1\|75543_76794_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_123905418.1\|76920_77136_+	hypothetical protein	NA	NA	NA	NA
WP_066521701.1\|77233_77629_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_066521707.1\|77600_77930_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_066521708.1\|77993_78275_-	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_066521710.1\|78378_78633_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066522499.1\|78689_79760_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_145980659.1\|80715_81363_+	amidohydrolase family protein	NA	NA	NA	NA
WP_066521539.1\|81385_82654_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_083949212.1\|82902_85389_+	TonB-dependent receptor	NA	NA	NA	NA
WP_066521544.1\|86834_87857_+	nitronate monooxygenase	NA	NA	NA	NA
WP_066521566.1\|87872_89102_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_066521546.1\|89105_90293_+	CoA transferase	NA	NA	NA	NA
WP_066521548.1\|90315_91473_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_083949214.1\|91522_91846_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_066521554.1\|92400_93447_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_066521569.1\|94092_94476_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_066521555.1\|94621_94873_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_066521556.1\|94884_95226_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066521558.1\|95472_96381_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	2.0e-26	29.6
98826:98840	attR	NA	NA	NA	NA

DBSCAN-SWA_3

762593 : 822877

Enterobacteria_phage(25.0%)

tRNA,protease,transposase,integrase

attL 807119:807166|attR 820263:820310

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066515963.1\|762593_763613_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_096362088.1\|763615_764719_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_066515974.1\|764719_766165_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_066515976.1\|766263_768519_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.0e-10	23.8
WP_066515978.1\|768508_769882_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_066516034.1\|770016_770493_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_066515981.1\|770533_771865_+	GTPase HflX	NA	NA	NA	NA
WP_066515983.1\|771877_772666_-	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_066515989.1\|772774_773785_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_066515992.1\|773973_775125_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_066515994.1\|775156_776335_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_096362200.1\|776590_777808_+	cytochrome P450	NA	NA	NA	NA
WP_066515999.1\|777820_778012_+	ferredoxin	NA	NA	NA	NA
WP_066516036.1\|778027_779503_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_066516038.1\|779513_780794_-	MFS transporter	NA	NA	NA	NA
WP_066516000.1\|781237_784237_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.6e-25	24.0
WP_066516003.1\|784503_788043_-	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	3.2e-176	35.9
WP_096362089.1\|788180_789350_+	YIP1 family protein	NA	NA	NA	NA
WP_066521221.1\|789495_790122_-	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_066521223.1\|790127_791153_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_066521226.1\|791232_793479_-	S9 family peptidase	NA	NA	NA	NA
WP_083949197.1\|793585_796177_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_066521229.1\|796169_797648_-	virulence factor family protein	NA	NA	NA	NA
WP_066521253.1\|797644_798436_-	hypothetical protein	NA	NA	NA	NA
WP_123905439.1\|798767_799457_+	anti-sigma factor	NA	NA	NA	NA
WP_083949198.1\|799453_800122_+	DedA family protein	NA	NA	NA	NA
WP_066521235.1\|800126_801218_+	glycosyltransferase	NA	NA	NA	NA
WP_066521237.1\|801171_802104_-	hypothetical protein	NA	NA	NA	NA
WP_066521242.1\|802134_802968_-	hypothetical protein	NA	NA	NA	NA
WP_066521244.1\|802964_804296_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_066521259.1\|804292_805036_-	nucleoside triphosphate hydrolase	NA	NA	NA	NA
WP_066521266.1\|805156_805894_-	hypothetical protein	NA	NA	NA	NA
WP_174521990.1\|805965_806829_-	hypothetical protein	NA	NA	NA	NA
WP_123905440.1\|806943_807141_+	hypothetical protein	NA	NA	NA	NA
807119:807166	attL	NA	NA	NA	NA
WP_083949199.1\|807407_808700_+\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	3.8e-10	27.1
WP_179948862.1\|809109_809637_+	hypothetical protein	NA	NA	NA	NA
WP_013039223.1\|809692_811063_-\|transposase	IS1380-like element ISSp1 family transposase	NA	NA	NA	NA
WP_123905441.1\|811173_812157_+	hypothetical protein	NA	NA	NA	NA
WP_123905442.1\|812205_812850_-	hypothetical protein	NA	NA	NA	NA
WP_169800604.1\|813056_813773_-	hypothetical protein	NA	NA	NA	NA
WP_066522410.1\|813940_814183_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_123905444.1\|814343_814619_-	hypothetical protein	NA	NA	NA	NA
WP_066522470.1\|814659_815520_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.0e-56	47.0
WP_096362064.1\|815516_816779_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.3e-39	32.7
WP_007684572.1\|817120_818317_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.9e-80	43.0
WP_169925550.1\|818299_819928_-	putative DNA binding domain-containing protein	NA	NA	NA	NA
WP_066513934.1\|820474_820603_+	entericidin A/B family lipoprotein	NA	NA	NA	NA
820263:820310	attR	NA	NA	NA	NA
WP_066513935.1\|820620_820812_-	hypothetical protein	NA	NA	NA	NA
WP_169800533.1\|820986_821529_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_066514278.1\|821575_822877_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	7.9e-40	29.8

DBSCAN-SWA_4

1001364 : 1050443

Bacillus_virus(13.33%)

tRNA,protease,transposase,integrase

attL 1031749:1031768|attR 1049511:1049530

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066514225.1\|1001364_1004250_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.4e-60	24.3
WP_066514228.1\|1004288_1005230_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_066514230.1\|1005276_1005777_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	5.4e-21	46.0
WP_066514231.1\|1005773_1006844_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_066514233.1\|1006845_1007340_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.9e-18	42.6
WP_066514321.1\|1007460_1008147_-	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_066514235.1\|1008302_1010186_+	signal peptide peptidase SppA	NA	NA	NA	NA
WP_066514236.1\|1010209_1010857_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_066514237.1\|1010991_1011537_-	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	3.2e-11	35.7
WP_066514239.1\|1011577_1012330_-	VIT family protein	NA	NA	NA	NA
WP_066514241.1\|1012388_1014170_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.1e-36	26.5
WP_066514243.1\|1014310_1015048_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_066514248.1\|1015386_1016655_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-127	56.7
WP_066514251.1\|1016788_1017424_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.8e-58	58.8
WP_066514324.1\|1017517_1018495_-	glycosyltransferase	NA	NA	NA	NA
WP_066514253.1\|1018867_1020481_-	trigger factor	NA	NA	NA	NA
WP_066514259.1\|1020760_1020958_+	hypothetical protein	NA	NA	NA	NA
WP_066514261.1\|1020973_1021675_-	NAD-dependent deacylase	A0A2I7S9Y2	Vibrio_phage	8.1e-23	37.2
WP_066514263.1\|1021760_1022525_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_066514264.1\|1022529_1023186_+	endonuclease III	NA	NA	NA	NA
WP_066514326.1\|1023284_1023683_+	hypothetical protein	NA	NA	NA	NA
WP_066514271.1\|1024137_1025553_-	hypothetical protein	NA	NA	NA	NA
WP_066514273.1\|1025549_1026563_-	hypothetical protein	NA	NA	NA	NA
WP_096362194.1\|1026746_1027475_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-33	38.6
WP_096362065.1\|1027461_1028976_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_066522486.1\|1029088_1030360_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PGY7	Moraxella_phage	1.2e-16	24.4
WP_157080368.1\|1030352_1030499_-	hypothetical protein	NA	NA	NA	NA
WP_096362092.1\|1030495_1032202_-	recombinase family protein	D7RWL2	Brochothrix_phage	6.2e-16	23.5
1031749:1031768	attL	NA	NA	NA	NA
WP_066521712.1\|1032218_1032527_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.9e-08	40.9
WP_066521714.1\|1032540_1032837_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	1.5e-18	47.9
WP_066521717.1\|1032918_1033137_-	hypothetical protein	NA	NA	NA	NA
WP_066521719.1\|1033145_1033358_-	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_066521722.1\|1033526_1033991_-	hypothetical protein	NA	NA	NA	NA
WP_157080345.1\|1034227_1034899_+	hypothetical protein	NA	NA	NA	NA
WP_123905447.1\|1034980_1035781_+	hypothetical protein	NA	NA	NA	NA
WP_123905448.1\|1036230_1040001_+	hypothetical protein	NA	NA	NA	NA
WP_066521730.1\|1040069_1040804_-	hypothetical protein	NA	NA	NA	NA
WP_083949221.1\|1040781_1042227_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_066521731.1\|1042226_1044686_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_066521732.1\|1044807_1045782_-	FecR family protein	NA	NA	NA	NA
WP_066521734.1\|1045890_1046406_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_066521736.1\|1047169_1047802_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WE94	Clostridium_phage	6.4e-11	30.4
WP_007014453.1\|1047919_1048210_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2L1IV28	Escherichia_phage	9.7e-15	46.2
WP_169925551.1\|1048199_1048502_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_066522499.1\|1048542_1049613_-\|transposase	IS630 family transposase	NA	NA	NA	NA
1049511:1049530	attR	NA	NA	NA	NA
WP_096362085.1\|1049682_1050443_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1168001 : 1220720

Hokovirus(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066520809.1\|1168001_1168424_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_066520807.1\|1168477_1168963_+	GAF domain-containing protein	NA	NA	NA	NA
WP_066520792.1\|1169104_1170139_+	RcnB family protein	NA	NA	NA	NA
WP_066520790.1\|1170278_1171097_-	arginyltransferase	NA	NA	NA	NA
WP_066520787.1\|1171210_1172458_-	threonine ammonia-lyase	NA	NA	NA	NA
WP_066520784.1\|1172553_1173423_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_066520781.1\|1173419_1175111_+	amidohydrolase	NA	NA	NA	NA
WP_066520778.1\|1175187_1177083_-	amidotransferase 1, exosortase A system-associated	A0A1V0SGM7	Hokovirus	1.4e-16	26.2
WP_066520775.1\|1177163_1178729_-	EpsI domain-containing exosortase	NA	NA	NA	NA
WP_066520772.1\|1178725_1179952_-	TIGR03087 family PEP-CTERM/XrtA system glycosyltransferase	NA	NA	NA	NA
WP_066520770.1\|1179948_1181019_-	FemAB family PEP-CTERM system-associated protein	NA	NA	NA	NA
WP_174521986.1\|1181015_1181864_-	DUF3473 domain-containing protein	NA	NA	NA	NA
WP_066520768.1\|1181905_1183108_-	AAA family ATPase	NA	NA	NA	NA
WP_066520765.1\|1183153_1184773_-	hypothetical protein	NA	NA	NA	NA
WP_066520762.1\|1184769_1185699_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_066520759.1\|1185712_1187233_-	chain-length determining protein	NA	NA	NA	NA
WP_066520756.1\|1187234_1187879_-	polysaccharide biosynthesis/export family protein	NA	NA	NA	NA
WP_066520754.1\|1188011_1189244_-	pyridoxal-dependent decarboxylase, exosortase A system-associated	NA	NA	NA	NA
WP_066520751.1\|1190818_1191826_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_066520750.1\|1191851_1192142_+	acyl carrier protein	NA	NA	NA	NA
WP_066521832.1\|1192310_1193273_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	8.1e-66	44.1
WP_066521835.1\|1193381_1194119_-	peptidase	NA	NA	NA	NA
WP_066521838.1\|1194144_1195017_-	transglutaminase family protein	NA	NA	NA	NA
WP_066521840.1\|1195035_1195968_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_066521843.1\|1195972_1197382_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_066521847.1\|1197595_1198444_-	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_083949226.1\|1198657_1199380_-	energy transducer TonB	NA	NA	NA	NA
WP_066521852.1\|1199475_1199784_-	hypothetical protein	NA	NA	NA	NA
WP_066521859.1\|1199780_1200071_-	DUF3325 domain-containing protein	NA	NA	NA	NA
WP_066521866.1\|1200067_1201627_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_066521868.1\|1201662_1204176_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_066521871.1\|1204315_1205272_-	FecR family protein	NA	NA	NA	NA
WP_083949225.1\|1205356_1205881_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_082734689.1\|1206119_1206539_+\|transposase	transposase	NA	NA	NA	NA
WP_062346440.1\|1206535_1206907_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-07	30.4
WP_066522435.1\|1207201_1208695_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	7.9e-92	38.5
WP_066522462.1\|1209221_1209803_-	YceI family protein	NA	NA	NA	NA
WP_066522461.1\|1209807_1210398_-	cytochrome b	NA	NA	NA	NA
WP_096362206.1\|1210501_1211023_-	YceI family protein	NA	NA	NA	NA
WP_169925553.1\|1211023_1211746_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_066522384.1\|1211993_1214018_+	relaxase/mobilization nuclease and DUF3363 domain-containing protein	NA	NA	NA	NA
WP_145980665.1\|1214291_1214690_-	hypothetical protein	NA	NA	NA	NA
WP_169925554.1\|1215540_1215684_-	hypothetical protein	NA	NA	NA	NA
WP_037487140.1\|1216094_1217126_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_123905450.1\|1217212_1217979_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_123905451.1\|1218039_1218450_-	hypothetical protein	NA	NA	NA	NA
WP_123905452.1\|1218536_1218905_-	hypothetical protein	NA	NA	NA	NA
WP_096362207.1\|1219112_1219873_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_096362085.1\|1219959_1220720_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1966727 : 1995546

Rhodobacter_phage(25.0%)

head,transposase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066517752.1\|1966727_1967570_-	hypothetical protein	R9TH35	Synechococcus_phage	1.8e-13	43.0
WP_123905472.1\|1967569_1968610_-	hypothetical protein	R9TJ58	Synechococcus_phage	2.2e-32	26.4
WP_066517746.1\|1968606_1972320_-	hypothetical protein	R9TF76	Synechococcus_phage	3.2e-25	32.2
WP_169800560.1\|1972327_1972537_-	DUF1799 domain-containing protein	NA	NA	NA	NA
WP_066517742.1\|1972680_1973010_-	hypothetical protein	NA	NA	NA	NA
WP_066517735.1\|1973124_1974084_-	hypothetical protein	A0A1B0T6E1	Thiobacimonas_phage	6.9e-73	47.4
WP_066517732.1\|1974084_1974309_-	hypothetical protein	NA	NA	NA	NA
WP_066517729.1\|1974311_1974755_-	hypothetical protein	A0A1B0T6E9	Thiobacimonas_phage	1.4e-20	40.5
WP_066517727.1\|1974768_1975197_-	DUF1320 domain-containing protein	M4SPQ8	Rhodobacter_phage	2.3e-36	54.2
WP_123905473.1\|1975193_1975526_-	hypothetical protein	NA	NA	NA	NA
WP_066517714.1\|1975699_1976668_-\|capsid	capsid protein	A0A219VH83	Ochrobactrum_phage	1.4e-81	48.1
WP_066517712.1\|1976680_1977049_-	DUF2190 family protein	NA	NA	NA	NA
WP_066517711.1\|1977045_1978131_-	hypothetical protein	M4SNT6	Rhodobacter_phage	6.6e-56	43.2
WP_066517710.1\|1978271_1978787_-	phage virion morphogenesis protein	M4ST99	Rhodobacter_phage	1.5e-21	39.5
WP_066517706.1\|1978872_1980132_-\|head	phage head protein	M4SNU0	Rhodobacter_phage	4.3e-107	47.7
WP_066517701.1\|1980222_1981788_-	DUF935 domain-containing protein	M4SPR8	Rhodobacter_phage	3.1e-163	55.2
WP_083949092.1\|1981921_1983634_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	1.0e-175	59.5
WP_066517697.1\|1983678_1984032_-	hypothetical protein	NA	NA	NA	NA
WP_066517693.1\|1984028_1984340_-	hypothetical protein	NA	NA	NA	NA
WP_066517690.1\|1984354_1984939_-	DUF3486 family protein	A0A219VH75	Ochrobactrum_phage	7.7e-19	35.0
WP_066517687.1\|1984935_1985130_-	hypothetical protein	NA	NA	NA	NA
WP_066517686.1\|1985126_1985384_-	hypothetical protein	NA	NA	NA	NA
WP_066517685.1\|1985376_1985673_-	hypothetical protein	NA	NA	NA	NA
WP_169800559.1\|1985669_1985984_-	DUF2730 family protein	NA	NA	NA	NA
WP_066517675.1\|1986030_1986651_-	hypothetical protein	NA	NA	NA	NA
WP_066517673.1\|1986647_1987196_-	lysozyme	F1ADS8	Caulobacter_phage	5.0e-20	43.0
WP_066517671.1\|1987296_1987662_-	hypothetical protein	NA	NA	NA	NA
WP_157080313.1\|1987661_1987820_-	hypothetical protein	NA	NA	NA	NA
WP_066517669.1\|1987816_1988533_-	regulatory protein GemA	A0A219VHC6	Ochrobactrum_phage	4.6e-13	26.2
WP_066517666.1\|1988534_1988927_-	hypothetical protein	NA	NA	NA	NA
WP_169800558.1\|1988923_1989079_-	hypothetical protein	NA	NA	NA	NA
WP_066517664.1\|1989087_1990050_-	AAA family ATPase	A0A2I7S9C3	Vibrio_phage	1.5e-19	25.1
WP_066517662.1\|1990065_1992054_-\|transposase	Mu transposase C-terminal domain-containing protein	A0A1B1P6Z4	Rhodovulum_phage	4.5e-135	42.5
WP_066517659.1\|1992050_1992512_-	hypothetical protein	I6P8D5	Pseudomonas_phage	3.7e-08	32.2
WP_066517657.1\|1992504_1992732_-	hypothetical protein	NA	NA	NA	NA
WP_066517656.1\|1992731_1992971_-	hypothetical protein	NA	NA	NA	NA
WP_083949087.1\|1992967_1993567_-	hypothetical protein	NA	NA	NA	NA
WP_123905474.1\|1993563_1994283_-	hypothetical protein	A0A1P8VVC3	Erythrobacter_phage	1.9e-14	32.0
WP_066517648.1\|1994476_1994902_-	hypothetical protein	NA	NA	NA	NA
WP_066517646.1\|1994898_1995546_-	HNH endonuclease	X2KPF7	Streptococcus_phage	2.6e-15	34.2

DBSCAN-SWA_7

2727063 : 2782615

uncultured_Mediterranean_phage(27.27%)

transposase,integrase

attL 2751745:2751796|attR 2782794:2782845

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066518756.1\|2727063_2728395_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.7e-82	42.7
WP_096362142.1\|2728394_2728817_+	hypothetical protein	NA	NA	NA	NA
WP_066518752.1\|2728873_2729134_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_123905512.1\|2729145_2730621_+	DUF3987 domain-containing protein	A0A1I9L2G8	Xanthomonas_phage	1.1e-85	40.1
WP_096362144.1\|2730969_2731596_+	hypothetical protein	NA	NA	NA	NA
WP_169800566.1\|2731737_2731896_+	hypothetical protein	NA	NA	NA	NA
WP_123905513.1\|2731897_2732290_+	hypothetical protein	NA	NA	NA	NA
WP_145980671.1\|2732171_2732891_+	hypothetical protein	NA	NA	NA	NA
WP_123905514.1\|2732887_2733463_+	hypothetical protein	NA	NA	NA	NA
WP_066518725.1\|2733592_2734441_+	hypothetical protein	NA	NA	NA	NA
WP_096362145.1\|2734834_2736868_-\|transposase	transposase	K4ICM1	Acidithiobacillus_phage	2.8e-23	33.3
WP_066522357.1\|2737030_2737909_+	OmpA family protein	NA	NA	NA	NA
WP_066522372.1\|2737964_2738477_-	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_066522359.1\|2738624_2739032_-	low affinity iron permease family protein	Q19XG2	Mycobacterium_phage	5.2e-06	34.5
WP_157080360.1\|2739024_2739195_-	hypothetical protein	NA	NA	NA	NA
WP_066522363.1\|2739381_2740233_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	6.1e-49	41.3
WP_066522370.1\|2740239_2740884_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_066522499.1\|2741023_2742094_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_066522145.1\|2742236_2742542_+	hypothetical protein	NA	NA	NA	NA
WP_066522143.1\|2742538_2744128_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_145980672.1\|2744124_2744397_+	hypothetical protein	NA	NA	NA	NA
WP_066522138.1\|2744569_2745934_+	TolC family protein	NA	NA	NA	NA
WP_066522152.1\|2745945_2746968_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_066522135.1\|2746967_2748158_+	ABC transporter permease	NA	NA	NA	NA
WP_066522149.1\|2748154_2749282_+	ABC transporter permease	NA	NA	NA	NA
WP_179948861.1\|2749393_2751445_-	TonB-dependent receptor	NA	NA	NA	NA
2751745:2751796	attL	NA	NA	NA	NA
WP_006964003.1\|2752215_2752380_+	hypothetical protein	NA	NA	NA	NA
WP_066522386.1\|2752485_2752965_+	hypothetical protein	NA	NA	NA	NA
WP_096362194.1\|2753461_2754190_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-33	38.6
WP_096362065.1\|2754176_2755691_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_066521275.1\|2755924_2756710_-	HNH endonuclease	NA	NA	NA	NA
WP_066521276.1\|2756703_2759433_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_123905516.1\|2759780_2760218_-	hypothetical protein	NA	NA	NA	NA
WP_174521991.1\|2763501_2766261_-	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	2.7e-29	26.1
WP_066521282.1\|2766287_2771444_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	5.9e-54	22.9
WP_066521286.1\|2771440_2772301_-	WYL domain-containing protein	NA	NA	NA	NA
WP_066521290.1\|2772643_2773621_+	DUF1738 domain-containing protein	A0A1B1IWW8	uncultured_Mediterranean_phage	4.6e-32	33.7
WP_066521292.1\|2773617_2774016_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	4.0e-19	47.2
WP_096362065.1\|2776166_2777681_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_096362194.1\|2777667_2778396_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-33	38.6
WP_083949261.1\|2779819_2780437_+	hypothetical protein	NA	NA	NA	NA
WP_066522276.1\|2780454_2780943_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_066522275.1\|2780945_2781260_-	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_066522272.1\|2781346_2782615_-\|integrase	site-specific integrase	NA	NA	NA	NA
2782794:2782845	attR	NA	NA	NA	NA

DBSCAN-SWA_8

3132194 : 3164436

Burkholderia_phage(16.0%)

tRNA,terminase,tail,transposase,capsid,head,plate,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096362194.1\|3132194_3132923_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-33	38.6
WP_096362065.1\|3132909_3134424_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_096362169.1\|3134760_3135768_-	late control protein	K4PAY4	Burkholderia_phage	3.7e-69	44.6
WP_066519771.1\|3135764_3136175_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	9.8e-29	47.2
WP_066519770.1\|3136183_3136369_-	hypothetical protein	NA	NA	NA	NA
WP_066519767.1\|3136380_3138834_-\|tail	phage tail tape measure protein	V9IQL1	Stenotrophomonas_phage	8.4e-75	44.1
WP_066519765.1\|3138833_3138974_-\|tail	GpE family phage tail protein	A0A0M4R2P3	Salmonella_phage	3.4e-05	61.8
WP_066519762.1\|3138982_3139288_-\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	3.6e-20	56.3
WP_066519757.1\|3139353_3139869_-\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	1.6e-44	52.4
WP_066519751.1\|3139899_3141069_-\|tail	phage tail sheath subtilisin-like domain-containing protein	F1BUU3	Erwinia_phage	1.8e-115	57.1
WP_066519749.1\|3141084_3141432_-	GPW/gp25 family protein	A0A1S5NNH3	Burkholderia_phage	6.4e-21	46.9
WP_066519747.1\|3141419_3141959_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	1.4e-35	46.4
WP_066519744.1\|3142008_3142290_-	hypothetical protein	NA	NA	NA	NA
WP_066519741.1\|3142286_3142916_-	hypothetical protein	NA	NA	NA	NA
WP_123905529.1\|3142912_3143572_-	hypothetical protein	NA	NA	NA	NA
WP_066519737.1\|3143581_3144397_-	hypothetical protein	NA	NA	NA	NA
WP_066519729.1\|3144377_3144575_-	hypothetical protein	NA	NA	NA	NA
WP_157080319.1\|3144590_3146834_-	hypothetical protein	A0A1X9SGY8	Bradyrhizobium_phage	7.9e-120	36.8
WP_066519720.1\|3146845_3148033_-\|tail	phage tail protein I	Q19UQ4	Mannheimia_phage	1.6e-07	38.2
WP_066519718.1\|3148029_3148914_-\|plate	baseplate J/gp47 family protein	A0A193GYM8	Enterobacter_phage	1.8e-43	40.3
WP_066519711.1\|3149000_3149678_-	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	2.0e-18	34.1
WP_066519708.1\|3149687_3150206_-\|tail	phage tail protein	A0A1S5NPS3	Burkholderia_phage	3.5e-23	44.9
WP_083949146.1\|3150205_3150388_-	hypothetical protein	NA	NA	NA	NA
WP_066519705.1\|3150332_3150731_-	hypothetical protein	NA	NA	NA	NA
WP_066519702.1\|3150727_3151180_-	hypothetical protein	A0A1B1IWJ5	uncultured_Mediterranean_phage	5.7e-38	53.7
WP_066519700.1\|3151185_3151518_-	hypothetical protein	NA	NA	NA	NA
WP_066519698.1\|3151521_3151746_-\|tail	tail protein X	A0A218M4L8	Erwinia_phage	2.4e-05	44.3
WP_066519695.1\|3151745_3152228_-\|head	head completion/stabilization protein	E5E3S2	Burkholderia_phage	5.7e-28	46.8
WP_066519693.1\|3152224_3152485_-	hypothetical protein	NA	NA	NA	NA
WP_066519691.1\|3152604_3153396_-\|terminase	terminase	A0A077K804	Ralstonia_phage	7.5e-33	42.1
WP_066519689.1\|3153448_3154501_-\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	1.2e-81	49.6
WP_066519686.1\|3154540_3155383_-\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	7.2e-42	42.5
WP_083949142.1\|3155544_3157398_+	oxidoreductase	A4JWU9	Burkholderia_virus	4.4e-177	53.7
WP_066519682.1\|3157394_3158444_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	9.1e-103	58.3
WP_066519675.1\|3158593_3159403_+	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	1.9e-84	59.7
WP_066519673.1\|3159422_3159710_-	putative addiction module antidote protein	NA	NA	NA	NA
WP_066519793.1\|3159735_3160026_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.4e-24	58.9
WP_066519670.1\|3160096_3160402_-	hypothetical protein	NA	NA	NA	NA
WP_169800571.1\|3160398_3160566_-	hypothetical protein	NA	NA	NA	NA
WP_066519668.1\|3161118_3161802_-	hypothetical protein	NA	NA	NA	NA
WP_066519667.1\|3162068_3162785_+	queuosine precursor transporter	NA	NA	NA	NA
WP_066519663.1\|3162781_3163522_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_066519656.1\|3163518_3164436_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA

DBSCAN-SWA_9

3349274 : 3354785

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066518344.1\|3349274_3350057_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.5e-28	29.5
WP_066518342.1\|3350053_3350647_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.2e-39	44.4
WP_066518340.1\|3350675_3350912_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	6.7e-06	75.0
WP_066518338.1\|3350941_3351346_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_066518336.1\|3351342_3352119_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.4e-44	42.4
WP_066518334.1\|3352185_3352314_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_066518331.1\|3352634_3353576_-	cell wall hydrolase	A0A1B0UXM4	Roseobacter_phage	5.1e-20	42.9
WP_066518401.1\|3353789_3354785_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.0e-50	41.3

DBSCAN-SWA_10

3638682 : 3707136

Pseudomonas_phage(14.29%)

tRNA,tail,transposase,capsid,head,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066514702.1\|3638682_3639408_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_066514769.1\|3639785_3640250_-	hypothetical protein	NA	NA	NA	NA
WP_066514704.1\|3640304_3641513_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.5e-96	47.6
WP_066514770.1\|3641571_3643134_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_066514705.1\|3643142_3643778_-	DedA family protein	NA	NA	NA	NA
WP_066514706.1\|3643789_3644311_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_123905537.1\|3644441_3645170_+	hypothetical protein	NA	NA	NA	NA
WP_066514709.1\|3645317_3645560_+	hypothetical protein	NA	NA	NA	NA
WP_066514773.1\|3645681_3646395_+	hypothetical protein	NA	NA	NA	NA
WP_066514777.1\|3646573_3647221_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_066514715.1\|3647376_3647952_+	hypothetical protein	NA	NA	NA	NA
WP_066514717.1\|3647972_3649286_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	1.1e-73	40.2
WP_066514720.1\|3649347_3649686_+	hypothetical protein	NA	NA	NA	NA
WP_066514722.1\|3650113_3651247_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	5.6e-50	39.2
WP_169800534.1\|3651243_3651408_-	hypothetical protein	NA	NA	NA	NA
WP_066514780.1\|3651475_3651796_+	hypothetical protein	K4I011	Acidithiobacillus_phage	2.6e-08	41.4
WP_066514725.1\|3651792_3652233_+\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	2.6e-11	36.3
WP_066514728.1\|3652335_3653472_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	2.0e-79	44.1
WP_123905538.1\|3653544_3655194_+\|tail	tail fiber domain-containing protein	A0A1S5R3Z4	Pseudomonas_phage	6.5e-31	37.3
WP_169800537.1\|3655183_3655357_+	hypothetical protein	NA	NA	NA	NA
WP_066514732.1\|3655353_3655632_+	hypothetical protein	NA	NA	NA	NA
WP_066514740.1\|3655628_3656171_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_096362181.1\|3656167_3656374_+	hypothetical protein	NA	NA	NA	NA
WP_066514744.1\|3656370_3656775_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_066520132.1\|3656964_3657288_-	hypothetical protein	NA	NA	NA	NA
WP_066520139.1\|3657342_3657750_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_066520142.1\|3657746_3658061_+	gene transfer agent family protein	NA	NA	NA	NA
WP_066520144.1\|3658057_3658267_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_066520147.1\|3658287_3658854_+\|tail	tail tape measure protein	D6PEW0	uncultured_phage	7.8e-08	36.3
WP_066520149.1\|3658850_3661181_+	DUF2460 domain-containing protein	A0A2H4P7I1	Pseudomonas_phage	1.6e-38	31.9
WP_066520152.1\|3661990_3662404_+	hypothetical protein	NA	NA	NA	NA
WP_066520155.1\|3662407_3664618_+	hypothetical protein	K4JVV3	Caulobacter_phage	7.4e-22	34.1
WP_066520158.1\|3664636_3665140_+	DUF2793 domain-containing protein	NA	NA	NA	NA
WP_066520159.1\|3665318_3666383_+	OmpA family protein	NA	NA	NA	NA
WP_169925544.1\|3666443_3666680_-	hypothetical protein	NA	NA	NA	NA
WP_066520160.1\|3666636_3667194_+	superoxide dismutase family protein	B6S2G0	Adoxophyes_orana_nucleopolyhedrovirus	5.3e-09	35.4
WP_066520224.1\|3667234_3667774_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_066520161.1\|3667893_3668634_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_066520162.1\|3668685_3669315_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_066520164.1\|3669506_3671825_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.7e-176	44.0
WP_066520171.1\|3671981_3672179_-	DUF1192 domain-containing protein	NA	NA	NA	NA
WP_066520226.1\|3672273_3673278_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_066520174.1\|3673379_3674246_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	3.6e-65	49.0
WP_066520175.1\|3674257_3675286_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_066520176.1\|3675400_3676084_+	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_066520177.1\|3676225_3677926_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	6.3e-21	22.4
WP_066520178.1\|3677969_3678503_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_066520228.1\|3678586_3678850_+	hypothetical protein	NA	NA	NA	NA
WP_066520181.1\|3678897_3679854_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	4.3e-35	36.6
WP_066520183.1\|3679963_3680779_+	ATP-binding protein	NA	NA	NA	NA
WP_066520189.1\|3680782_3682111_-	sorbosone dehydrogenase family protein	NA	NA	NA	NA
WP_169925563.1\|3682172_3682346_-	hypothetical protein	NA	NA	NA	NA
WP_174521982.1\|3682562_3682772_+	hypothetical protein	NA	NA	NA	NA
WP_066520191.1\|3682775_3683720_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_066520193.1\|3683716_3684625_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	1.0e-09	43.2
WP_066520196.1\|3684584_3684989_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066520236.1\|3685037_3686435_-	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	1.2e-28	31.1
WP_083949161.1\|3686579_3686783_+	hypothetical protein	NA	NA	NA	NA
WP_066520199.1\|3686782_3687631_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_174521983.1\|3687879_3689268_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_066520202.1\|3689302_3690361_-	potassium channel family protein	NA	NA	NA	NA
WP_083949162.1\|3690357_3691365_-	M23 family metallopeptidase	Q8SBN9	Clostridium_phage	1.4e-15	36.1
WP_066520245.1\|3691398_3692163_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-36	37.4
WP_066520208.1\|3692174_3693452_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	46.7
WP_066520248.1\|3693539_3693980_+	host attachment protein	NA	NA	NA	NA
WP_066520215.1\|3694055_3695318_-	hypothetical protein	NA	NA	NA	NA
WP_083949163.1\|3695534_3696041_-	hypothetical protein	NA	NA	NA	NA
WP_096362065.1\|3696159_3697674_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_096362194.1\|3697660_3698389_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-33	38.6
WP_123905540.1\|3698581_3698956_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157080353.1\|3699028_3699712_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_066522107.1\|3699718_3699988_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_083949251.1\|3699993_3701274_-	cytochrome P450	NA	NA	NA	NA
WP_066522099.1\|3701306_3702053_-	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_066522096.1\|3702197_3702737_-	hypothetical protein	NA	NA	NA	NA
WP_066522090.1\|3702860_3705179_-	TonB-dependent receptor	NA	NA	NA	NA
WP_066522088.1\|3705809_3706502_-	hypothetical protein	NA	NA	NA	NA
WP_096362183.1\|3706572_3707136_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_AP017659

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1682

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019053942.1\|659_1682_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	2.1e-11	36.6

DBSCAN-SWA_2

8862 : 12976

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096362271.1\|8862_9888_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	5.7e-09	24.3
WP_096362272.1\|10541_10928_+\|transposase	transposase	NA	NA	NA	NA
WP_169925571.1\|10924_11299_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_096362273.1\|11365_12976_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	5.2e-49	32.9

DBSCAN-SWA_3

18554 : 28138

Salmonella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066522055.1\|18554_19148_-	recombinase family protein	A0A1S6L009	Salmonella_phage	3.4e-46	56.6
WP_174521995.1\|19316_22244_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-225	43.6
WP_066522052.1\|22647_23280_+	SprT-like domain-containing protein	A0A1V0DYF5	Dinoroseobacter_phage	9.5e-39	47.3
WP_061939917.1\|23352_24006_+	ParA family protein	M4HZI5	Mycobacterium_phage	3.9e-11	33.3
WP_061939951.1\|24005_24329_+	hypothetical protein	NA	NA	NA	NA
WP_061939919.1\|24325_25279_+	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.9e-30	33.0
WP_001389365.1\|27373_28138_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7

DBSCAN-SWA_4

32215 : 36623

Aeromonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007688084.1\|32215_33418_-	AAA family ATPase	A0A1I9KF58	Aeromonas_phage	6.6e-41	31.3
WP_007688083.1\|33613_34702_-	replication initiation protein	NA	NA	NA	NA
WP_013041755.1\|35088_35289_-	hypothetical protein	NA	NA	NA	NA
WP_007688082.1\|35368_35695_+	single-stranded DNA-binding protein	A0A1X9SGJ7	Bradyrhizobium_phage	1.2e-05	32.7
WP_007688081.1\|35756_36623_+	toprim domain-containing protein	A0A0H5AWB1	Pseudomonas_phage	1.1e-08	29.2

DBSCAN-SWA_5

42474 : 45981

Aeromonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096362279.1\|42474_42756_-	HigA family addiction module antidote protein	I6ZVM3	Aeromonas_phage	2.3e-05	39.7
WP_061939934.1\|42766_43045_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A0M3LQB1	Mannheimia_phage	1.3e-19	45.7
WP_096362276.1\|43216_43633_-	hypothetical protein	NA	NA	NA	NA
WP_008832583.1\|45360_45981_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.6e-38	49.7

DBSCAN-SWA_6

49761 : 56147

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083949265.1\|49761_50028_+	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	4.4e-06	51.0
WP_066522521.1\|52513_53278_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.2e-88	66.5
WP_123905556.1\|53573_54566_+	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_066522521.1\|54754_55519_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.2e-88	66.5
WP_011950653.1\|55586_56147_+	recombinase family protein	A0A1W5LU24	Ralstonia_phage	3.5e-29	45.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP017657

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_AP017658

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_AP017655

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_AP017659

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection