CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041923	Wolbachia pipientis strain wAlbB-FL2016 chromosome, complete genome	4 crisprs	RT,DEDDh,cas3	0	0	15	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041923_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041923_1

158798-159046

Orphan

Consensus_repeat	Method
AATTATCTATTACATTAATATTTGCTCCGTTTTTAAGCAATAATTTCACCT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP041923_1

>merge|NZ_CP041923|1|158798-159046|PILER-CR
AATTATCTGTTATATTAATATTTGCTCCGTTTTTAAGCAATAATTTTACCACATTCTCATGGCCTCCCTGAACAGCTAAATATAAAGGAGTAGCACCGAAATGATTTTTTACATCAATATCTGCTCCGTTTTTAAGCAATAATTCCACCTCCTCTTTACAATTTATGGAAGCAGCATAATGTAAAGGAGTAAAACCATAATTATCCACTGCATTAACATTTGCTCCGTTTTTAAGCAATAATTTCACTT

>NZ_CP041923|1|1|158798-159046|PILER-CR
AATTATCTGTTATATTAATATTTGCTCCGTTTTTAAGCAATAATTTTACCA	CATTCTCATGGCCTCCCTGAACAGCTAAATATAAAGGAGTAGCACCGAAATG
ATTTTTTACATCAATATCTGCTCCGTTTTTAAGCAATAATTCCACCTCCTC	TTTACAATTTATGGAAGCAGCATAATGTAAAGGAGTAAAACCATAATT
ATCCACTGCATTAACATTTGCTCCGTTTTTAAGCAATAATTTCACTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041923.1\|WP_006015230.1\|170715_174036_+\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235554
NZ_CP041923.1\|WP_006014656.1\|151061_151388_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133393
NZ_CP041923.1\|WP_006014667.1\|159324_160329_-\|PRANC-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP041923.1\|WP_129827232.1\|153651_154524_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_129827232.1\|165367_166240_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_096616077.1\|157533_158622_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP041923.1\|WP_006014658.1\|151387_151684_-\|integration-host-factor-subunit-alpha	unknown	unknown	gnl\|CDD\|259857
NZ_CP041923.1\|WP_006013222.1\|163021_163378_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006013179.1\|155082_155385_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_129827238.1\|154791_155013_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_096560718.1\|169588_170515_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP041923.1\|WP_145510622.1\|155521_155749_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006015235.1\|167820_168438_+\|lipoyl(octanoyl)-transferase-LipB	unknown	unknown	gnl\|CDD\|237680
NZ_CP041923.1\|WP_006014663.1\|151722_152919_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|369468
NZ_CP041923.1\|WP_006015237.1\|166521_167568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_145510623.1\|161132_162005_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_129827241.1\|163509_164781_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041923.1\|WP_006015234.1\|168437_169406_+\|LD-carboxypeptidase	unknown	unknown	gnl\|CDD\|132882
NZ_CP041923.1\|WP_129827239.1\|156034_157354_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP041923.1\|WP_006014654.1\|150418_151009_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703

Protein	Function_ID	Function_description	E-value
NZ_CP041923.1\|WP_006014658.1\|151387_151684_-\|integration-host-factor-subunit-alpha	gnl\|CDD\|259857	cd13835, IHF_A, Alpha subunit of integration host factor (IHFA). This subfamily consists of the alpha subunit of integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms.	9.87637e-33
NZ_CP041923.1\|WP_006014656.1\|151061_151388_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133393	cd04765, HTH_MlrA-like_sg2, Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.69766e-34
NZ_CP041923.1\|WP_006014667.1\|159324_160329_-\|PRANC-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	2.58972e-35
NZ_CP041923.1\|WP_129827232.1\|165367_166240_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.05017e-79
NZ_CP041923.1\|WP_006015235.1\|167820_168438_+\|lipoyl(octanoyl)-transferase-LipB	gnl\|CDD\|237680	PRK14341, PRK14341, lipoyl(octanoyl) transferase LipB.	2.66347e-137
NZ_CP041923.1\|WP_096616077.1\|157533_158622_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.26423e-21
NZ_CP041923.1\|WP_129827232.1\|153651_154524_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.05017e-79
NZ_CP041923.1\|WP_096560718.1\|169588_170515_-\|hypothetical-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	1.28223e-38
NZ_CP041923.1\|WP_006015230.1\|170715_174036_+\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235554	PRK05673, dnaE, DNA polymerase III subunit alpha; Validated.	0
NZ_CP041923.1\|WP_129827241.1\|163509_164781_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	3.93722e-157
NZ_CP041923.1\|WP_145510623.1\|161132_162005_-\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	8.4428e-78
NZ_CP041923.1\|WP_006014663.1\|151722_152919_-\|MFS-transporter	gnl\|CDD\|369468	pfam07690, MFS_1, Major Facilitator Superfamily.	1.06806e-14
NZ_CP041923.1\|WP_006015234.1\|168437_169406_+\|LD-carboxypeptidase	gnl\|CDD\|132882	cd07025, Peptidase_S66, LD-Carboxypeptidase, a serine protease, includes microcin C7 self immunity protein. LD-carboxypeptidase (Muramoyltetrapeptide carboxypeptidase; EC 3.4.17.13; Merops family S66; initially described as Carboxypeptidase II) family also includes the microcin c7 self-immunity protein (MccF) as well as uncharacterized proteins including hypothetical proteins. LD-carboxypeptidase hydrolyzes the amide bond that links the dibasic amino acids to C-terminal D-amino acids. The physiological substrates of LD-carboxypeptidase are tetrapeptide fragments (such as UDP-MurNAc-tetrapeptides) that are produced when bacterial cell walls are degraded; they contain an L-configured residue (L-lysine or meso-diaminopimelic acid residue) as the penultimate residue and D-alanine as the ultimate residue. A possible role of LD-carboxypeptidase is in peptidoglycan recycling whereby the resulting tripeptide (precursor for murein synthesis) can be reconverted into peptidoglycan by attachment of preformed D-Ala-D-Ala dipeptides. Some enzymes possessing LD-carboxypeptidase activity also act as LD-transpeptidase by replacing the terminal D-Ala with another D-amino acid. MccF contributes to self-immunity towards microcin C7 (MccC7), a ribosomally encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. Its possible biological role is to defend producer cells against exogenous microcin from re-entering after having been exported. It is suggested that MccF is involved in microcin degradation or sequestration in the periplasm.	3.1313e-89
NZ_CP041923.1\|WP_129827239.1\|156034_157354_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	1.71857e-34
NZ_CP041923.1\|WP_006014654.1\|150418_151009_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	3.20581e-29

>NZ_CP041923.1|WP_096616077.1|157533_158622_+|IS481-family-transposase
MSTIQTKILKPKLGLLELAKQLGNVSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLMANRVSEDMERAVVNIATEFPAYGQQRAANELRKRGIIISEGGVRSVWLRNDLETFKKRLRALEAKVMQDGIILTEEQLAALEKVKEQREAHGEIETEHPGYLGSQDTYYVGNIKGIGRIYQQTFIDTYSRVAFAKLYTDKTAITAADLLNDRVIPFFDVQSVPLLRILTDRGTEYCGKPENHAYQLYLGIENIDHSRTKANSPQTNGICERFHKTMQDECYNIIFRKKIYNSLEDLQIDVDHWLRSYNETRPHSGKYCYGKTPTQTFLNSKHIAFQKNISSMKQETDISFNYLNSSVS
>NZ_CP041923.1|WP_129827239.1|156034_157354_+|IS66-family-transposase
MIEVLQEKIVVLESENANLKAEIENLRKEVIELQDKLGLNSKNSSLPPSQDVYRKKTKKKSNRNPGGQPGHEAHKRELMEADEIVKCAIDSICVCGGQVILEEDTIHQKVELPEIKPIVTEYRLQKGYSASLPEGVGWNLLRSNAEAIISSFTGFFINSKREVQQILSSIFNLNISLGLISKTEGKVSEKCISEYEKIREELKESKYLHIDETSHRNQGKKGWGWVVTNKTATLMKLVGSRGKKVLKGLLPEYEGIVVSDRYAAYNYFSRENRQICWAHLARDFERFFFSKNVEVSQIGAALKSLSNRVFVIDRARKQNLIDNLRFCRLMRKIRKRVKYFLQKITRVAKGTQASRMAANILRSEDMMWKFVQSPDLIETTNNLAERQGRRYVIYRKNSFFTWSKRGEKFVERMLSIFLTSRLNNQNPVQKLQNLVAIPS
>NZ_CP041923.1|WP_145510622.1|155521_155749_+|hypothetical-protein
MANLAFSKETLQHLAELSELTKQPTQELAERLFKEAIDREMEDFLLSVVADQYDIESAETVDYKDVKWRSSGLQD
>NZ_CP041923.1|WP_006013179.1|155082_155385_-|hypothetical-protein
MKNIKEKGLSSAKVKYSVEPTVSENAEVNTFEECFGACYNKYQHDEKLMGSCIRGCQYRFGHNWDLDAPESKESEPIYTSEVLKNIGDNFHALADSVSIL
>NZ_CP041923.1|WP_129827238.1|154791_155013_-|hypothetical-protein
MSIHEFADAREKLHRLSIVLQDIIRNREGMLATGSYFYDNNYSSSSKIKKALQLDEHQLYSFIDVDDSEKLRS
>NZ_CP041923.1|WP_129827232.1|153651_154524_+|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_006014663.1|151722_152919_-|MFS-transporter
MKSRAWFIWLISNLIVIFSNMQIIYTFISVDLKKELGITIAQVALVNSAYTWTFAISQFFSGAMFNVFSSKKIYFLSLSIMIFGFFILISSDSFVHLILSQFLIAIGASFGFVGAAHISSTYFPITQFGLMFSLVQTISSLSALMIQMLFSSFLAEGMDWKNLIVYVILFGVSIFVLMFFYPKGLSKKSLEKCTIKSSIKTVICSILTVLKLRDIWITSVVGAITFGTFLALNMLWAPRLLSNLELNTMELGVATAILWLGLAVGAPIADLISNLFKNRRHVISAFAILQGISVIILLYGNLTVHIIYFCMLMFGFFAGGHMLNFTVGSEIVEQKYISTSSSIINGFMFVMSGILVSILALFSDHQMALFTIFAMLTFASIFNYATKETYYKNKVAES
>NZ_CP041923.1|WP_006014658.1|151387_151684_-|integration-host-factor-subunit-alpha
MTTKDTTVTKATIAECINQKIGLSKEDSIAIIDDILDEIKTSLAKDGIVKISSFGTFLVKNKKERPGNIPRTLERVVIQARKSISFRPSKMMKKLINN
>NZ_CP041923.1|WP_006014656.1|151061_151388_-|MerR-family-transcriptional-regulator
MNKEKLFYTIGEVAEGLHLEQHVLRFWESQFHQIKPIKRKGRRLYDHKCIEAIKKIKYMLYDKGYTIKGVQKEFGNDVRIDHYSRNLLKELTDLRDYLTDKINEESNK
>NZ_CP041923.1|WP_006014654.1|150418_151009_-|M23-family-metallopeptidase
MCRIALFFILSAILISCGLQKPAPVLLKGEEFYGKRDLEYTREYHLIKENVDSSLQKESRKAFVDKVYNNDAQSMCKFVIPVKGAVISSDKICQDGIKITAQSGTKVIASAPGKVIYVGKGLRWYGNLIIVEHKDNYMTMYSYLKNIQVEIGDKVKQGQVIGSAGKSSTQDKDPQMCFTIRHNGQAVDPLVHINCD
>NZ_CP041923.1|WP_006014667.1|159324_160329_-|PRANC-domain-containing-protein
MNEREQRELDELLMNSSKGENIQQITELIEAGANINAVTTGGKETPLHIAVRYGHKEVAELMLNEGANVNAIERRKWTPLHVAVRCSSHKELVELLLEKGANVNAVDNIDMTPLHFAVKYVQEELVKLLLEKGASVNAVEKKGRTPLSIVATGCYQGYCDKPMLVRTIIVYAVLHSGITMKPECIVNNSELSEFWDLCKNEVSGRLSNSTISLYQFLRENDKNKLAGYLFDQNYDVKRYLEEKQYEKDFPIYANIITGQLHKAMKRKDLLYRSDIVMNHSVDLKDFPQEVKSKITNCLTNEELRNVIRAPFSIPSRNLDNPSAEQLQAAAQAHN
>NZ_CP041923.1|WP_145510623.1|161132_162005_-|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHLRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_006013222.1|163021_163378_-|hypothetical-protein
MSDYFKQNLEAQVGMVRNLAKLLKKLNRVDKICSYIIADKVHSYITKPSFCLFVPTLIAAIFTSGTLGTAFTVAAAVTGMCMIIGIVTSICLSVYAYNSCNSKINDPKVEGFQGELQL
>NZ_CP041923.1|WP_129827241.1|163509_164781_-|group-II-intron-reverse-transcriptase/maturase
MNKTKSFDIPKQLIWRAYKQVSKNRGAAGVDGVSITKFEENLKDNLYKLWNRMSSGSYFPEPVKAVAIPKDMGGGQRILCVPSVFDRIGQTAAAMYLEPLVEPKFHEDSYGYRPNKSALDAVDTVRKRCWRYDWTIDLDISGFFDNLDHELVLRAIKKHTDCKWVILYVERWMEAPIQQADGRRVARDKGVPQGGSVSPIISNIFMHHVIDIWMKKNYPTVPFERYVDDAIVHCRTEKQTGFMKVMIEERLAEYRLKLHPKKTQIVYCKDDNRRDEFPKQSFDFLGYTFRPRLARNKIGKHFVSFLPAISNKAKKKITTTIRSWKMLRNTHITLEEISGKVNPIVRGWYQYYGKFYRTEVYKSLKNVERHLEKWVKRKYKRLRSHGRLARQFLGKVRDRSPNIFYHWTLGLGSKRLNNGSCIS
>NZ_CP041923.1|WP_129827232.1|165367_166240_+|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_006015237.1|166521_167568_-|hypothetical-protein
MLGTTQESQNELGKFSQEQWDQFVKDSIKKDLEAVKEQSKKNKKENIETLEKHFHDRTIQPISEFKKVGEKEAGYSSGFQAEHEYSDNEGDKAHFMIKSVLNHTLTKEEEQSKLVQFKKSFYEGSRKATKLHNPYLPDSIINNRIDPLWQQVESNICYDDLNIADFIREYVAGDLYKLFLYDRAPIVELVTNNNLPEKRFVKSDTQKGKDYKPGEYDLERDGKEREGYVKGKHIFKDQFKERIEQEKSQDKLHLRSKFLDKFTTLMDLKEKGQDAKGFEKILAAQILLGEADIAQPENFGVIEKEYENAEGKKVKEKLWAKIDHGRSFYLSCSSTKGYLQNFSFFCSN
>NZ_CP041923.1|WP_006015235.1|167820_168438_+|lipoyl(octanoyl)-transferase-LipB
MTEWLISNQLVDYNHAVEFMEAKIQQIYNNLSDELVWLLQHPPLYTAGIGATDDDIIEKLFPIYKTGRGGKYTYHGPGQRIIYLMLNLKKRNKCDIKLYIRDLSNWIINVLKHFNILGEFKEDRIGIWVNNNGVEEKIAAFGIRLRKWVTYHGIALNVSPNLSHYEGIIPCGLKDYGVTSMEKLGVKVSLCELDDILKQEFHKIF
>NZ_CP041923.1|WP_006015234.1|168437_169406_+|LD-carboxypeptidase
MYSFILYFLCLLLTNPAHTINQVDIIAPSSKGKESDLPTIREYVKTLGFNPHISEKIYSNDNPFYSNSDEFRANDLVNALTDDSKIIWCIRGGEGASRLIPYLEKLPNDKKERIAQNKKILIGYSDITALHIYLQIKYDWQTLHGTMLEMIVNNSVAETSVEKLKELILKQRNSIRFDNLKMIDNGIRLKNGKLESKIIGGNMTLVENSIGTAWQINAKNKILFLEDIRVYPYSIERSLDHLKQAHIFDGVDAVIFGDFVNCYNDNLVEIVKERFAKSVNFPVFTIKGVGHGHTNDPLPFNTHATISVQDEKEFMDVQQLYK
>NZ_CP041923.1|WP_096560718.1|169588_170515_-|hypothetical-protein
MTSKYELLKKVLSTIEVKEGLNKDNIIEEIQEELKEQDQDLYQEWEKGEFDVNHGFYISSYKVTLLMVAALNGHANIVEVLLEKGAHVNEKDWRDMTPLHLAALNGHANILEVLLEKGAHVNEKGWRDTTPLHLAAFYGHASVVEVLLEKGANVNAVDSEGFTPLHLAALNGHANIVEVLLEKGANVNAVDNEGWTPLDRAEDYAKSKNAVEVLLKAGGGSFVKARNKAKIAGGVTTLLGTAIAVALFTTGIIAAQLIPIVIAVVAVTAAALVVGCATYEWSKPSTKVDGAEKPSAVLTTNEQRGAAI
>NZ_CP041923.1|WP_006015230.1|170715_174036_+|DNA-polymerase-III-subunit-alpha
MFIHLRVHSVYSLLESSVKIEELIGLCLQNKMPAVAVTDSGNLFGSLEFAEYAASRGIQLIIGCNIIVRHLEQNLSILLLAKNEQGYTNLVTLVSESFKKRKNNSDIPYVDFDELLSFNTGLIALTGGCLAQLLLEQDKETVEKLLSAFDGHLYVELQRHGLNKELELEEALIDFAYQRNIPLVATNDVFFSNRSDYEAYDILTCISEGSYALENNRKKLITEHYFKSVEEMEELFSDIPEAIYNTLVIAKRCSYMPRSRQPILPKFPCRENKTENEELREQAVAGLEFRIANETDINLKQYYDRLNYELSVITSMNYAGYFLIVSDFIRWSKANGIPVGPGRGSGAGSIVAWSLQITDLDPIKFGLIFERFLNPDRISMPDFDIDFCQEKRDLVIDYVQKKYGYVAQIITFGKLQARAVLRDVGRVLQMPYSQVDKISKMVPFNPVNPVTLSQAIEFDHNLQKERDSDEVIAKLLDISLKLEGIYRHVSTHAAGIVICDQKLENFVPVYYDPNSALPITQYSMKYVEKAGLIKFDFLGLGTLTLIDHVCRLINRDEKKFDISSVSLIDQRTYEMLSRGDSIGVFQLESSGMREALIKLKPDCIEDIIALISLYRPGPMDNIPTYVARKHGLEKPDYIHPLLEKVLKETFGVIIYQEQVMEIARILSGYSLAEADLLRRAMGKKIKEEMDKQRELFVQGATKNGVDYDRASYIFDLVAKFAGYGFNKSHAAAYAIISYQTAYLKANYPLEFFTALMNLNIDDRDKLNLFYHAAKFSGVAVLSPDISKSKAEFSIEGEHIRYGIAALRNVGFAIAEGIVNARSSSYKDIWEFIQNLGHIINKRALESLIKSGTFDSVHKNRKQLYESIDTLIYFANKNRQSNQAALFGNLDILKPKLENVEDFNEEEKLEHELFSLGFYLTNHPLEKFRTLLKKLNIGFIGESKTIKTAGVILNVRMRTSERGRFVILTLSDPHNVSEIAFYNNEIIEEKRNLFSPGAFVIIDLEISENTTRLSGKDISEFTEKVTSLMKGLVLTAVCADSQKVAEELNSVLKNGGKTKIMLKFLLEKHKVSILLPGAYSITPQAIYEISHLSWIEGVEINTNNLLI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041923_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041923_2

379513-379759

Orphan

Consensus_repeat	Method
AATTATCTTTTACATTAATATTTGCTCCGTTTTTAAGCAATAATTTCAC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP041923_2

>merge|NZ_CP041923|2|379513-379759|PILER-CR
GTGAAATTATTGCTTAAAAACGGAGCAAATGTTAATGCAGTGGATAATTATGGTTTTACTCCTTTACATTATGCTGCTTCCATAAATTGTAAAGAGGAGGTGGAATTATTGCTTAAAAACGGAGCAGATATTGATGTAAAAAATCATTTCGGTGCTACTCCTTTATATTTAGCTGTTCAGGGAGGCCATGAGAATGTGGTAAAATTATTGCTTAAAAACGGAGCAAATATTAATATAACAGATAATT

>NZ_CP041923|2|2|379513-379759|PILER-CR
GTGAAATTATTGCTTAAAAACGGAGCAAATGTTAATGCAGTGGATAATT	ATGGTTTTACTCCTTTACATTATGCTGCTTCCATAAATTGTAAAGAGGAG
GTGGAATTATTGCTTAAAAACGGAGCAGATATTGATGTAAAAAATCATT	TCGGTGCTACTCCTTTATATTTAGCTGTTCAGGGAGGCCATGAGAATGTG
GTAAAATTATTGCTTAAAAACGGAGCAAATATTAATATAACAGATAATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041923.1\|WP_145510630.1\|359892_368412_+\|DNA-directed-RNA-polymerase-subunit-beta/beta'	unknown	unknown	gnl\|CDD\|173305
NZ_CP041923.1\|WP_006014691.1\|359434_359836_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|100102
NZ_CP041923.1\|WP_129827250.1\|388757_389504_+\|hypothetical-protein	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041923.1\|WP_129827231.1\|376409_376709_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NZ_CP041923.1\|WP_006014692.1\|358889_359408_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP041923.1\|WP_006014685.1\|372139_373411_+\|phosphoribosylamine--glycine-ligase	unknown	unknown	gnl\|CDD\|234856
NZ_CP041923.1\|WP_006014688.1\|368446_369397_-\|tRNA-dihydrouridine-synthase-DusB	unknown	unknown	gnl\|CDD\|129820
NZ_CP041923.1\|WP_006013621.1\|392353_392725_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006013619.1\|392725_392998_+\|DUF2610-domain-containing-protein	unknown	unknown	gnl\|CDD\|371344
NZ_CP041923.1\|WP_006013634.1\|383790_385131_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|222980
NZ_CP041923.1\|WP_096676677.1\|376815_377688_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_096676677.1\|380753_381626_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_006014667.1\|378227_379232_+\|PRANC-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP041923.1\|WP_096616077.1\|389530_390619_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP041923.1\|WP_096560603.1\|382212_383484_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041923.1\|WP_096676677.1\|385799_386672_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_006014682.1\|374246_375674_+\|isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|236416
NZ_CP041923.1\|WP_006013625.1\|391244_392258_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224481
NZ_CP041923.1\|WP_039950729.1\|373641_374112_-\|transporter	unknown	unknown	gnl\|CDD\|377640
NZ_CP041923.1\|WP_129827249.1\|387858_388731_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648

Protein	Function_ID	Function_description	E-value
NZ_CP041923.1\|WP_145510630.1\|359892_368412_+\|DNA-directed-RNA-polymerase-subunit-beta/beta'	gnl\|CDD\|173305	PRK14844, PRK14844, DNA-directed RNA polymerase subunit beta/beta'.	0
NZ_CP041923.1\|WP_006014691.1\|359434_359836_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|100102	cd00387, Ribosomal_L7_L12, Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of the ribosome. The stalk base consists of a portion of the 23S rRNA and ribosomal proteins L11 and L10. An extended C-terminal helix of L10 provides the binding site for L7/L12. L7/L12 consists of two domains joined by a flexible hinge, with the helical N-terminal domain (NTD) forming pairs of homodimers that bind to the extended helix of L10. It is the only multimeric ribosomal component, with either four or six copies per ribosome that occur as two or three dimers bound to the L10 helix. L7/L12 is the only ribosomal protein that does not interact directly with rRNA, but instead has indirect interactions through L10. The globular C-terminal domains of L7/L12 are highly mobile. They are exposed to the cytoplasm and contain binding sites for other molecules. Initiation factors, elongation factors, and release factors are known to interact with the L7/L12 stalk during their GTP-dependent cycles. The binding site for the factors EF-Tu and EF-G comprises L7/L12, L10, L11, the L11-binding region of 23S rRNA, and the sarcin-ricin loop of 23S rRNA. Removal of L7/L12 has minimal effect on factor binding and it has been proposed that L7/L12 induces the catalytically active conformation of EF-Tu and EF-G, thereby stimulating the GTPase activity of both factors. In eukaryotes, the proteins that perform the equivalent function to L7/L12 are called P1 and P2, which do not share sequence similarity with L7/L12. However, a bacterial L7/L12 homolog is found in some eukaryotes, in mitochondria and chloroplasts. In archaea, the protein equivalent to L7/L12 is called aL12 or L12p, but it is closer in sequence to P1 and P2 than to L7/L12.	3.13283e-33
NZ_CP041923.1\|WP_129827250.1\|388757_389504_+\|hypothetical-protein	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	7.89268e-63
NZ_CP041923.1\|WP_129827231.1\|376409_376709_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.26709e-13
NZ_CP041923.1\|WP_006014692.1\|358889_359408_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	2.98497e-41
NZ_CP041923.1\|WP_006014685.1\|372139_373411_+\|phosphoribosylamine--glycine-ligase	gnl\|CDD\|234856	PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional.	0
NZ_CP041923.1\|WP_006014688.1\|368446_369397_-\|tRNA-dihydrouridine-synthase-DusB	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	1.45281e-142
NZ_CP041923.1\|WP_006013619.1\|392725_392998_+\|DUF2610-domain-containing-protein	gnl\|CDD\|371344	pfam11020, DUF2610, Domain of unknown function (DUF2610). This family is conserved in Proteobacteria. One member is annotated as being elongation factor P but this could not be confirmed. This domain is related to the Ribbon-helix-helix superfamily so may be a DNA-binding protein.	2.57615e-42
NZ_CP041923.1\|WP_006013634.1\|383790_385131_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|222980	PHA03095, PHA03095, ankyrin-like protein; Provisional.	1.17978e-28
NZ_CP041923.1\|WP_096676677.1\|376815_377688_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.0706e-77
NZ_CP041923.1\|WP_096676677.1\|380753_381626_-\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.0706e-77
NZ_CP041923.1\|WP_006014667.1\|378227_379232_+\|PRANC-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	2.58972e-35
NZ_CP041923.1\|WP_096616077.1\|389530_390619_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.26423e-21
NZ_CP041923.1\|WP_096560603.1\|382212_383484_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.69938e-157
NZ_CP041923.1\|WP_096676677.1\|385799_386672_-\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.0706e-77
NZ_CP041923.1\|WP_006014682.1\|374246_375674_+\|isocitrate-dehydrogenase	gnl\|CDD\|236416	PRK09222, PRK09222, NADP-dependent isocitrate dehydrogenase.	0
NZ_CP041923.1\|WP_006013625.1\|391244_392258_-\|hypothetical-protein	gnl\|CDD\|224481	COG1565, COG1565, Uncharacterized conserved protein [Function unknown].	1.70424e-91
NZ_CP041923.1\|WP_039950729.1\|373641_374112_-\|transporter	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	1.06489e-07
NZ_CP041923.1\|WP_129827249.1\|387858_388731_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	8.79048e-79

>NZ_CP041923.1|WP_006014667.1|378227_379232_+|PRANC-domain-containing-protein
MNEREQRELDELLMNSSKGENIQQITELIEAGANINAVTTGGKETPLHIAVRYGHKEVAELMLNEGANVNAIERRKWTPLHVAVRCSSHKELVELLLEKGANVNAVDNIDMTPLHFAVKYVQEELVKLLLEKGASVNAVEKKGRTPLSIVATGCYQGYCDKPMLVRTIIVYAVLHSGITMKPECIVNNSELSEFWDLCKNEVSGRLSNSTISLYQFLRENDKNKLAGYLFDQNYDVKRYLEEKQYEKDFPIYANIITGQLHKAMKRKDLLYRSDIVMNHSVDLKDFPQEVKSKITNCLTNEELRNVIRAPFSIPSRNLDNPSAEQLQAAAQAHN
>NZ_CP041923.1|WP_096676677.1|376815_377688_+|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTGFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_129827231.1|376409_376709_+|transposase
MASRREYTTEFKLEAIKLVKETGQSSAKIARDLGINGDSLSRWVKKYNDKMSGTDAFPGKGKLAPYDKERFDLKKELARVTRERDILKKALGYFANQKE
>NZ_CP041923.1|WP_006014682.1|374246_375674_+|isocitrate-dehydrogenase
MSTSVTVAYGDGIGPEIMEAVLSILREAKAEISIDIIEIGERVYSKEWSHGISPSGWESIERTKILLKSPTTTPQGKGHKSLNVALRKNLGLYANIRPCISYHPVIENKFDKFDVVVIRENEEDVYTGIEHRLTGDSYQCTKIITRSGSEKICRYAFEYAKKHNRKKVTCLTKDNIMKMTDGAFHAAFDRIAKEYPNIKIEHYIVDIGMAKVATEPEDFDVIVTENLYGDILSDIVAQTSGSVGLAGSSNIGNEYAMFEAVHGSAPDIAGKNMANPSGLLNAAVHMLVYIGQVSTAKLIYDAWLKTLEDGIHTADLYKKKRSKQKVGTKEFAKAVIDNLGKKPTTLSELIISSDSDSKINKVQDNYEQDYKAKKLVGSDITLAWDKSNNFDQIVGLFESSDPKIIAIYSKGLAIWPGNSEFSSDQITCRFIANNEKKTITNSDINNLLIKLEEHNFDVVRMDKLYLYDGKESFFS
>NZ_CP041923.1|WP_039950729.1|373641_374112_-|transporter
MDTKISYAGILRRVLACVVDGVLWMIIAFVSLLFDLDNVDKNMTILMATLLITYIIFNILTITKYGCTPGRLLCSVRIKDANTFKNVTLMQSTIRYIFREGIWVIYSFLSYLLPGYVSGCLFIILTLVLMFAIFDQRKQTFYDKIAKTVVIDYKPS
>NZ_CP041923.1|WP_006014685.1|372139_373411_+|phosphoribosylamine--glycine-ligase
MKVLVIGSGGREHALLWALKKSPILTKLYVTLGRPAMENFGVLVNINIQDSVDVTQFCKKENIELVIIGPEQPIINGLADDLTAEGINVFAPSQAAAKLEASKSFTKELCKQYGIPTAKYERFIDERLAKNFVRSNKIKLPLVIKANGIAAGKGVIICHTENEAFSAIDSMLVEKNLGESGEEIIIEEFLIGEEVSFFALVDGLKVVILGCAKDYKRVGENNEGQNTGGMGSYSSPSIISKDMEQKIIQKIIYPTIQALTNMGTSYKGVLFAGLMICKDSPKLLEYNVRFGDPEIQSILPRLDPNCDLLKLMLSVAEGKLNTKMVEFNHKTTVCVVVASKGYPGDYQKGEVIKGLDKIENIPGVLVFHAGTKLDENGNWISDGGRVLNIVGEGNTVEEAKSKVYSALNFLGWPGGFFRYDIGS
>NZ_CP041923.1|WP_006014688.1|368446_369397_-|tRNA-dihydrouridine-synthase-DusB
MSLQVGNLTIDYPVILAPMSGVTDYPFRSIVKKLGASLLVSEMIASRAMIMQTRQSMQKAKVDELTAVQLAGCEPDVMAEAAKLNEGMGAKIIDINFGCPVKKVVNGYAGSALMRDEKKAAEIIEAVVKAVSVPVTVKMRTGWNDENRNAPRLAKIAEDLGAKMITVHGRTRAQLYNGQADWKFVRNVKEQVKIPVIVNGDIKSLDDVQSALKESGADGVMIGRGAYGKPWLINQAINFLSGNKVSEPTASERLSIILKHYDSILEYYGSDIGIKMARKHIGWYSSGLQNSSEFRVRVNNIIDSTEVKENIIDFFS
>NZ_CP041923.1|WP_145510630.1|359892_368412_+|DNA-directed-RNA-polymerase-subunit-beta/beta'
MVDSSYMCASSAFVPRVSYSRSIDLKDSLLDLVKVQKGSYNSFTPNNESNERLEAIFHTIFPISDPLHRATIEFLNCRVDDLKYSESECIKRGITFSAQVIASIRLVIMQDGVSLEKYQEIKEYDDHSKLATVIKSAEEQEVRFCELPMMTDKGTFIINGVEKVIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARVIPYRGSWLDIEFDVKDHLYFRIDRKRKLPISVLLKALGLSNNDILNKFYEKIEYIKHKSGWKVPFFPDKFKGVRLPFDLKNVEGNVLLKANVRITSKLAKNLYDNGLKEYLIPYDSICGLFLAEDLIDSASSTKILSAGESIKLEDIKKLELLSIDKISVLNIDNVSVGPYILNTLFLDENMSYENALYEIYKVLRPGEVPVLKIVEEFFRNLFFSPEYYDLSNIGRLKLNSCLGLNYEENLTTLTHEDIIEIIRKIVLLRDGQGSVDDIDHLANRRVRSVGEFIENQFRTGLLKLGRAVVDSMSTSSLDKVSPSDFINPKVLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNKVVTDQIEYLSAIDEGLYYIADTSAKLDENNCFVDDMLYCRYAGTFVMVNSNQVSYIDLSPKQVISVAASLIPFLENDDANRALMGSNMQRQAVPLLKPTAPLVATGMESFVASGSGAVVLAKRGGIVDSSDSNSIVIRAFDKGGINYLDVDIYHLRKFQRSNHNTCINQKPLVHVGDCVKEGDVIADGPAINNGELALGQNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFECVVHDTPLGSEKITRAIPGVNEENLYHLDDSGIVKVGTRVGPGYILVGKVTPRHSLSLPPETKLLMTIFGEKSFDCVDSSLYTSPDIEGIVIDVQVFTRRGEEENERAFLIKQKEANDFEKERDHIINVINQYFYDELRKILINSGSQDRESINFIEREGWWDIGLKNQSISKQVESLKKDFDEKVSHAITNFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLETHVGWACKKLGEKVGNILDEINKIKRAFCEAIRSLSDDDFEKFAALYLDNKKFEDINDDEITASILDTPNKDELNNELTTLVENYFNSCKDAHSSLRHFLIEVYSCGSNLSICNNIRDINDNHLIEFAYKLRDGIPVTAPVFEGPKDEQIVKLFELAGLDNSGQVVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSLVTQQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESVIKGDSNFECGIPESFNVMIKELRSLCFNVDLKQNDIVIEDISHTNIAQSFNEVSISIASPESIKRMSYGEITDVSTANYRTFKVEKGGLFCPKIFGPVNDDECLCGKYKKRRHRGRICEKCGVEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIESILYSDNYVVIDPLVSSFEKGEIISEKAYNEAKDSYGVDSFIAMQGVEAIRELLIRLDLHEIRKNLRQELESVASEMRRKKIIKRLRIVENFIKSGNRPEWMILTAIPILPPDLRPLVSLESGRPAVSDLNHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNALVNKAGAAGYKKSISDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVYSRLKIYGMAPTIKFASKLIRAEKPEVWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMSINNVLSPSNGRPIIVPSKDIVLGIYYLTLQQLKEDDLPLFCAFCEVEHSLNNGTLHIHSHIKYKMEYINSDGNIQYKTIFTTPGRLILWQIFPKHKNLSFDLINQVLTVKEITSIVDLVYRSCGQSATVVFSDKLMTLGFEYATFSGTSFSRCDMVIPETKATHVDYTRGEIKKFSAQYQDGLITKSERYNKVIDEWSKCTDIIANDMLKAISLYDENSKYNSIYMMVSSGARGSTSQMKQLAGMRGLMTKPSGEIIETPIISNFREGLTVLEYFISTHGARKGLADTALKTANSGYLTRRLVDVAQNCIVTKHDCKTKNGLIVRAIVEGSTIVASLESVVLGRTAANDIYNPVTKELLLKAGELIDEDKVKQINIAGLDAIKIRSPLTCEISPGVCSLCYGRDLATGKIVSIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVMTRGIESSNIIASINARIKLNNSNIIIDKNGNKIVISRSCEVVLIDSLGSEKLKHSVPYGAKLYVNEGELVKIGDKVAEWDPYTLPIITEKSGTISYQDLKDGISITEVMDESTGISNRVVKDWKLHSGVANLRPRIALLDDNEKVITLSSGVEACYFIPVGAVLNVQDGQKVHAGDVITRTPRESVRTRDITGGLPKVIELFEARRPKEHAIVSEIDGYVTFSEKDRRGKRSIVIKPVDEQASPVEYLVSRSKHVIVNEGDFVRKGDLLMDGDPDLHDILRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLIGENIDRLEIDRENDAMNNSGKRPTHYLPILQGITRASLETNSFISAASFQETTKVLTEAAFCGKSDPLNGLKENVIVGRLIPAGTGLVMNKVKALSLCENIDKYEKYFDIETYDEKLLSDNSYQLHSDEEESVVASHYDQSS
>NZ_CP041923.1|WP_006014691.1|359434_359836_+|50S-ribosomal-protein-L7/L12
MNNVTSDLVDKILSLNLLEASELVKVLEEKIGLPGGSFLGGAVGAGVPISDNATAPVAQEKAEYKVVIKEIDASKKIGVIKAIREVNSTLNLKEAKELVESLPKDLTANVSKDEAEKIKQKLIEAGATKVELE
>NZ_CP041923.1|WP_006014692.1|358889_359408_+|50S-ribosomal-protein-L10
MKRKDKDEFIQNIMNVFVNNDFLILVNFKSMNVSNSLILRNSLKSVMGGMLVVKNTLACLALERTGKFSYLSDKFSGSVAIIYSSAIVEAAKLIVDFINANKEKMSVICAAHINELLTVEDVNKLAKLPSLDELRVKIMRLISYDIPARLALSINSSSMRLMRVLDYCSSKK
>NZ_CP041923.1|WP_096676677.1|380753_381626_-|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTGFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_096560603.1|382212_383484_+|group-II-intron-reverse-transcriptase/maturase
MNKTKSFDIPKQLIWRAYKQVSKNRGAAGVDGVSITKFEENLKDNLYKLWNRMSSGSYFPEPVKAVAIPKDMGGGQRILCVPSVFDRIGQTAAAMYLEPLVEPKFHEDSYGYRPNKSALDAVDTARKRCWRYDWTIDLDISGFFDNLDHELVLRAIKKHTDCKWVILYVERWMEAPIQQADGRRVARDKGVPQGGSVSPIISNIFMHHVIDIWMKKNYPTVPFERYVDDAIVHCRTEKQTGFMKVMIEERLAEYRLKLHPKKTQIVYCKDDNRRDEFPKQSFDFLGYTFRPRLARNKIGKHFVSFLPAISNKAKKKITTTIRSWKMLRNTHITLEEISGKVNPIVRGWYQYYGKFYRTEVYKSLKNVERHLEKWVKRKYKRLRSHGRLARQFLGKVRDRSPNIFYHWTLGLGSKRLNNGSCIS
>NZ_CP041923.1|WP_006013634.1|383790_385131_+|ankyrin-repeat-domain-containing-protein
MACEEDIHQLVESGFDINSKDVSGVTLLHKFTKEGDLVGVKSLLEHEADFNVVDNENRNPLHYAIMHGHKKIAKLLVNQLTINSRDKNGFTPLHLATLQDDTELMDFLIAKGAKINEKDAEEGYTPLHIASLYGSKKSVQILIDSGANLECEDNNFRTPLFLTIYQCTTHYESRAEIIEYLIKKGANIEAKDAENNTTLFLAAYNNKMQLVKLIVKQAKARLKEFICTKNKHGFDALDCAIENNNRKMVTFLVSKGIEADDQDCNGNTRLHKASYNGDTKAVKFLLELKVNVNAVTRCNRTPLLLAAKKGHVEIVKMLLAVKVNMNICDQQGLTPLHLSIQKNYFDIAQLLIEKGAINCSNDYTAIDMFIDKAHSKKNIEENYKKFCRFLILYLKELNSKHRAFCVLSILALSLTIIGLPFIFKPIIKYRERSKIYKKIRAMLIYI
>NZ_CP041923.1|WP_096676677.1|385799_386672_-|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTGFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_129827249.1|387858_388731_+|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGCLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_129827250.1|388757_389504_+|hypothetical-protein
MEAPIQQADGRRVARDKGVPQGGSVSPIISNIFMHHVIDIWMKKNYPTVPFERYVDDAIVHCRTEKQTGFMKVMIEERLAEYRLKLHPKKTQIVYCKDDNRRDEFPKQSFDFLGYTFRPRLARNKIGKHFVSFLPAISNKAKKKITTTIRSWKMLRNTHITLEEISGKVNPIVRGWYQYYGKFYRTEVYKSLKNVERHLEKWVKRKYKRLRSHGRLARQFLGKVRDRSPNIFYHWTLGLGSKRLNNVY
>NZ_CP041923.1|WP_096616077.1|389530_390619_-|IS481-family-transposase
MSTIQTKILKPKLGLLELAKQLGNVSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLMANRVSEDMERAVVNIATEFPAYGQQRAANELRKRGIIISEGGVRSVWLRNDLETFKKRLRALEAKVMQDGIILTEEQLAALEKVKEQREAHGEIETEHPGYLGSQDTYYVGNIKGIGRIYQQTFIDTYSRVAFAKLYTDKTAITAADLLNDRVIPFFDVQSVPLLRILTDRGTEYCGKPENHAYQLYLGIENIDHSRTKANSPQTNGICERFHKTMQDECYNIIFRKKIYNSLEDLQIDVDHWLRSYNETRPHSGKYCYGKTPTQTFLNSKHIAFQKNISSMKQETDISFNYLNSSVS
>NZ_CP041923.1|WP_006013625.1|391244_392258_-|hypothetical-protein
MLTYIHKLIDKRQGSISISDFMNAALYHKEYGYYMSKLPLGKDGDFITAPEISQLFGETIAVWIMNTWEKLGKPSKFSLVELGPGKGTLIHDVIRVTKKYSCFFSSMDIHLVEIGPILQKIQKEKLKGLDINWHTDVDNLPNQPTIFFANELFDALPIDQFVYLDGQWYENRVTKQDNGSLSLLLQCSVPITGKGKLFNGAVVEVCLAGTEILKKLENKIVNNGGAALIIDYGYVYPSYKSTLQSIRQHKYTNFLENIGNSDITALVNFQALKDSLKHVDCETLTQREFLYLLGIKERAQALMENASNEQKNRIFSEFLRLTENMGTLFKVMLIHHL
>NZ_CP041923.1|WP_006013621.1|392353_392725_+|hypothetical-protein
MNSQDTDYVTLIPQDDGIEYKFKEAINFVENKVVDADGLTLAEIFQVLVRMLNGDLELVKKVLAYANIMVKHGMRLAQESQLSRADVRRALEGKESVFNRQDFIKKPPLVPSIKSVKKKSRGL
>NZ_CP041923.1|WP_006013619.1|392725_392998_+|DUF2610-domain-containing-protein
MVESIKKFTVQCDFKGQSSPFAIYIGDPKGDTHPIHHQDSWLAKERGGNIPNKVKESLQKLYKLSKENGVSFSELCAYAITVVSNNDKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041923_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041923_3

754524-754625

Orphan

Consensus_repeat	Method
TGAAGACTAAACTTCTCAAATATGAGTTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041923_3

>merge|NZ_CP041923|3|754524-754625|CRISPRCasFinder
TGAAGACTAAACTTCTCAAATATGAGTTCTGATTTCTCAGGAGCAATATTTTCTAGTACTTTTATAATATCTTGAAGACTAAACTTCCCAAATATGAGTTCT

>NZ_CP041923|3|1|754524-754625|CRISPRCasFinder
TGAAGACTAAACTTCTCAAATATGAGTTCT	GATTTCTCAGGAGCAATATTTTCTAGTACTTTTATAATATCT
TGAAGACTAAACTTCCCAAATATGAGTTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041923.1\|WP_129827232.1\|762513_763386_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_006013763.1\|751699_752206_+\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674
NZ_CP041923.1\|WP_006013840.1\|771619_771787_+\|twin-arginine-translocase-TatA/TatE-family-subunit	unknown	unknown	gnl\|CDD\|273605
NZ_CP041923.1\|WP_006013790.1\|761485_762271_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181260
NZ_CP041923.1\|WP_006013769.1\|752501_753128_-\|phosphatidate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|366491
NZ_CP041923.1\|WP_006013753.1\|748385_749021_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_145510640.1\|767625_768549_-\|class-II-fructose-bisphosphatase	unknown	unknown	gnl\|CDD\|236536
NZ_CP041923.1\|WP_039950541.1\|747492_748161_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868
NZ_CP041923.1\|WP_006013773.1\|753117_753813_-\|di-trans,poly-cis-decaprenylcistransferase	unknown	unknown	gnl\|CDD\|376506
NZ_CP041923.1\|WP_096616077.1\|744281_745370_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP041923.1\|WP_129827232.1\|759593_760466_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_006013808.1\|764947_766042_+\|redox-regulated-ATPase-YchF	unknown	unknown	gnl\|CDD\|236583
NZ_CP041923.1\|WP_006013766.1\|752277_752487_+\|zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|370944
NZ_CP041923.1\|WP_006013756.1\|749182_750340_+\|2-octaprenyl-6-methoxyphenyl-hydroxylase	unknown	unknown	gnl\|CDD\|273911
NZ_CP041923.1\|WP_096560603.1\|757735_759007_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041923.1\|WP_006013822.1\|770741_771479_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213226
NZ_CP041923.1\|WP_006013819.1\|768667_770467_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_096560682.1\|755873_757046_+\|2-oxoglutarate-dehydrogenase-complex-dihydrolipoyllysine-residue-succinyltransferase	unknown	unknown	gnl\|CDD\|235571
NZ_CP041923.1\|WP_096560683.1\|746443_747466_-\|UDP-N-acetylmuramate--alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP041923.1\|WP_006013759.1\|750571_751492_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153216

Protein	Function_ID	Function_description	E-value
NZ_CP041923.1\|WP_129827232.1\|762513_763386_-\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.05017e-79
NZ_CP041923.1\|WP_006013763.1\|751699_752206_+\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	2.12694e-86
NZ_CP041923.1\|WP_006013840.1\|771619_771787_+\|twin-arginine-translocase-TatA/TatE-family-subunit	gnl\|CDD\|273605	TIGR01411, Sec-independent_protein_translocase_protein_TatA, twin arginine-targeting protein translocase, TatA/E family. This model distinguishes TatA/E from the related TatB, but does not distinguish TatA from TatE. The Tat (twin-arginine translocation) system is a Sec-independent exporter for folded proteins, often with a redox cofactor already bound, across the bacterial inner membrane. Functionally equivalent systems are found in the chloroplast and some in archaeal species. The signal peptide recognized by the Tat system is modeled by TIGR01409. [Protein fate, Protein and peptide secretion and trafficking].	2.77637e-13
NZ_CP041923.1\|WP_006013790.1\|761485_762271_+\|SDR-family-oxidoreductase	gnl\|CDD\|181260	PRK08159, PRK08159, enoyl-[acyl-carrier-protein] reductase FabI.	4.11113e-156
NZ_CP041923.1\|WP_006013769.1\|752501_753128_-\|phosphatidate-cytidylyltransferase	gnl\|CDD\|366491	pfam01148, CTP_transf_1, Cytidylyltransferase family. The members of this family are integral membrane protein cytidylyltransferases. The family includes phosphatidate cytidylyltransferase EC:2.7.7.41 as well as Sec59 from yeast. Sec59 is a dolichol kinase EC:2.7.1.108.	1.44592e-35
NZ_CP041923.1\|WP_096616077.1\|744281_745370_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.26423e-21
NZ_CP041923.1\|WP_145510640.1\|767625_768549_-\|class-II-fructose-bisphosphatase	gnl\|CDD\|236536	PRK09479, glpX, fructose 1,6-bisphosphatase II; Reviewed.	8.47844e-168
NZ_CP041923.1\|WP_039950541.1\|747492_748161_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	3.72163e-55
NZ_CP041923.1\|WP_006013773.1\|753117_753813_-\|di-trans,poly-cis-decaprenylcistransferase	gnl\|CDD\|376506	pfam01255, Prenyltransf, Putative undecaprenyl diphosphate synthase. Previously known as uncharacterized protein family UPF0015, a single member of this family has been identified as an undecaprenyl diphosphate synthase.	9.48987e-113
NZ_CP041923.1\|WP_129827232.1\|759593_760466_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.05017e-79
NZ_CP041923.1\|WP_006013808.1\|764947_766042_+\|redox-regulated-ATPase-YchF	gnl\|CDD\|236583	PRK09601, PRK09601, redox-regulated ATPase YchF.	0
NZ_CP041923.1\|WP_006013766.1\|752277_752487_+\|zinc-finger-domain-containing-protein	gnl\|CDD\|370944	pfam10276, zf-CHCC, Zinc-finger domain. This is a short zinc-finger domain conserved from fungi to humans. It is Cx8Hx14Cx2C.	5.42616e-05
NZ_CP041923.1\|WP_006013756.1\|749182_750340_+\|2-octaprenyl-6-methoxyphenyl-hydroxylase	gnl\|CDD\|273911	TIGR01984, 2-polyprenyl-6-methoxyphenol_hydroxylase, 2-polyprenyl-6-methoxyphenol 4-hydroxylase. This model represents the FAD-dependent monoxygenase responsible for the second hydroxylation step in the aerobic ubiquinone bioynthetic pathway. The scope of this model is limited to the proteobacteria. This family is closely related to the UbiF hydroxylase which catalyzes the final hydroxylation step. The enzyme has also been named VisB due to a mutant VISible light sensitive phenotype. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	5.60637e-174
NZ_CP041923.1\|WP_096560603.1\|757735_759007_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.69938e-157
NZ_CP041923.1\|WP_006013822.1\|770741_771479_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213226	cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	5.23931e-87
NZ_CP041923.1\|WP_096560682.1\|755873_757046_+\|2-oxoglutarate-dehydrogenase-complex-dihydrolipoyllysine-residue-succinyltransferase	gnl\|CDD\|235571	PRK05704, PRK05704, 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase.	0
NZ_CP041923.1\|WP_096560683.1\|746443_747466_-\|UDP-N-acetylmuramate--alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	1.44158e-109
NZ_CP041923.1\|WP_006013759.1\|750571_751492_-\|hypothetical-protein	gnl\|CDD\|153216	cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	0.000580164

>NZ_CP041923.1|WP_006013773.1|753117_753813_-|di-trans,poly-cis-decaprenylcistransferase
MLNLESLPKHLAIIMDGNGRWAKNQGMVRIDGYRKGSEVAFDIAKHCTTLAISYLTLYAFSMENWLRPKNETDYLFDLFYSALTNEDKINFICNCNIKLNFIGNLSLLPSKIFDQIKKAEEVTHKNDGLLLTVAVSYGAKQEIIHAINNIIKGNIDCVLEDEFEKFLYTKDLPKLDLLIRTGGEKRLSNFLLWQSAYAELYFCDTLWPDFSCQDLSRALADYTKREKKYGR
>NZ_CP041923.1|WP_006013769.1|752501_753128_-|phosphatidate-cytidylyltransferase
MVDNNFMVRTLSSIVILLIFSFATYFSDLSFYLLIFSIAVLSSFEWYNLTKGNSILYIFALLLIALPNASLIYLYNLPQGKYELIWLILTIWSIDITAYLFGKNFGGAKICPIISPGKTWSGLLGAVLAGVFCTIFGSIFLSLFPIFYSPIIGVTIAILAQLGDFTESLIKRVYNVKDSGGIIPGHGGVLDRMDSFIFTAPFIAIYIS
>NZ_CP041923.1|WP_006013766.1|752277_752487_+|zinc-finger-domain-containing-protein
MSEVRDNNLIVCCRGDENDDGSGHPVVYLHKEGEMYCPYCSKPMSEIVNSEEFQFVEVKAVNKKERTKG
>NZ_CP041923.1|WP_006013763.1|751699_752206_+|pantetheine-phosphate-adenylyltransferase
MNINNKIGIYPGTFDPITLGHLDIIKRACKLVDKLVIGVAENVNKRTAFDIKLRTSMAENEVKGVGIDADVISFNGLLMKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLLPEIETVFLPASEDTQFISSSFVKEIARLGGDVSSFVSQNVQTELINLNRVKNGE
>NZ_CP041923.1|WP_006013759.1|750571_751492_-|hypothetical-protein
MYKCYNRIFNILLITFLLLSNIAYSEKVNKELSALTAENAVSYNIIVGLLQTDESQNIYEIFNNFGVKTIFIDYDKIINLKEIQEEFAKQDEILAKKLILDRIKVEVAKFIKEQKINRIFISDNFHSALNPYRQLVNEAIVKIVDGNPTIHLLAICGGSQGIMHVKGIEVVNDEKNHLKSAQKENIPLQQIKIVPGSRLEEVVAKFLLPNQNGWFSTYFPNAHSGKVSNTTGNRRRLELLGYKIAAFANDGVIEAIEDKHGNIYFQSHLEDLVVKSDKNSRLSSQKARQVSTLVAIAIINDFLHRV
>NZ_CP041923.1|WP_006013756.1|749182_750340_+|2-octaprenyl-6-methoxyphenyl-hydroxylase
MNYDVIISGSGLIGLITAIGLSNDSISVAVIEKNSLPRAVDDNRAFAISQGSKKILEKLAIWKFLESEAEPILDICILDGDSPFTVHYDHKMVGEEPMGYVIKSAIIWNAINNNFLHKLNIYSPRSYKTIACDEGYVEVTLDNDQKLISSLFICAEGKNSKLPELFSIPMIKFDYKQNSMVFNVKHELHHQNLAVERFFPGGPFAILPMKGGYTSSIVWTEKCEISKMLMSLSEEEFVIELKKRFGSYLGEIELEGERRFYPLSFSFARKLHKSRILLIGDAAHSIHPVAGQGLNLGMRDVESVIRQITNAKVSGIDVGSNYLLKKISRDRYFDNLTMALATDGLNRIFSNRILCAQVLRNLGLMVVENSDFLKKSFVRHAMGFI
>NZ_CP041923.1|WP_006013753.1|748385_749021_-|hypothetical-protein
MTTDCKKELLNCISKYREELAENKAAIRQTLTSDKINISDYFYKGDKICNKELFNIGSECQDTKYGSRQEYTYDEWKEKIEKPHAKDLLKMLQNEIKGKILKSFEDYEKYHKNATEAIKRELDMDSKLKAILKEKQQPETDETRAYYDVIRGLYENGDMRSQLKCNDLDCFNRTIEDNLSQKQSELAAIKDDFLDNTQNIFQHIQVEDSIF
>NZ_CP041923.1|WP_039950541.1|747492_748161_+|septal-ring-lytic-transglycosylase-RlpA-family-protein
MIKKLAFICLIFVLMSSCSFSNRCNHTAGHYKIGNSYTINGITYHPKYCSCYEEVGIASWYGIEDHGTITANGEVFNRHLISAAHKTLPLPCFVRVTNLENGRKLVIRVNDRGPFVEGRIIDLSEKAAQVLGLHKSGLAKVKVEYLRKRSEQLIQNTPHYKRQYEKEMQKRHPKQNNAESKGYVAFFVNAQVAKSAASKLRNQGIENVRLLFKNDQYCVKVS
>NZ_CP041923.1|WP_096560683.1|746443_747466_-|UDP-N-acetylmuramate--alanine-ligase
MRILNYTIINLVISKRLLPNMHSTKKEVIHIIGIGGIGMSAIAEILHNSSYKVQGSDTRSNDNIDRLQKLGIEVYIGHDASSIRQAQIVVHSSAIKPDNVELVAARDNNKTVLHRSDMLAKIMKGKYVIAVSGSSGKTTTTAMIASIFDHSGADATVIVGGILNSYQSNAKLGKSDIFLIEADESDGTMLKIPADIAVVTSINDDHIDHYGTFNDIKNAFSRFVNNANFAILPDSADINHDASNSIKFWFGNGKIRASNIKQHNNSIEFDVLISINESNRIPLSTTRVVERGGIKAALSSSPQCLKLDYRFNVKQDTIEFKRTIPRKSLHSKKVNRTNAI
>NZ_CP041923.1|WP_096616077.1|744281_745370_+|IS481-family-transposase
MSTIQTKILKPKLGLLELAKQLGNVSQACKVMGYSRDTFYRFKELYENGGEEALHEISKKKPLMANRVSEDMERAVVNIATEFPAYGQQRAANELRKRGIIISEGGVRSVWLRNDLETFKKRLRALEAKVMQDGIILTEEQLAALEKVKEQREAHGEIETEHPGYLGSQDTYYVGNIKGIGRIYQQTFIDTYSRVAFAKLYTDKTAITAADLLNDRVIPFFDVQSVPLLRILTDRGTEYCGKPENHAYQLYLGIENIDHSRTKANSPQTNGICERFHKTMQDECYNIIFRKKIYNSLEDLQIDVDHWLRSYNETRPHSGKYCYGKTPTQTFLNSKHIAFQKNISSMKQETDISFNYLNSSVS
>NZ_CP041923.1|WP_096560682.1|755873_757046_+|2-oxoglutarate-dehydrogenase-complex-dihydrolipoyllysine-residue-succinyltransferase
MSKIIEIRAPKTLGGESVTEGIVKIKKNIGEAIKVDDLIFEIETDKTALELTAEASGQITEFLVKEDDVISPDQLLAKLAVGEVKEEVKKEDKGESPDKKDAPSARKIMEENAISAENVKGTGMGGRITKADVIDHMSKAEQPAVKQYESPKSVASGERREERVKMSKIRQVIAARLKASQNTAAILTTFNEIDMKNVMDLRAKYKETFEKKYGIKLGFMSFFIKAAVQALKEIREINAEISGDEIVYKNYYDIGVAVGTDKGLVVPVIRDADQMSFAEIELTLVALGKKAREGKLQVSEMEGATFTISNGGVYGSLLSTPIINPLQSGILGMHSIQNRPVAVSSSIEIRPMMYIALSYDHRIVDGKGAVTFLVKIKNYIEDPNRLVLEI
>NZ_CP041923.1|WP_096560603.1|757735_759007_-|group-II-intron-reverse-transcriptase/maturase
MNKTKSFDIPKQLIWRAYKQVSKNRGAAGVDGVSITKFEENLKDNLYKLWNRMSSGSYFPEPVKAVAIPKDMGGGQRILCVPSVFDRIGQTAAAMYLEPLVEPKFHEDSYGYRPNKSALDAVDTARKRCWRYDWTIDLDISGFFDNLDHELVLRAIKKHTDCKWVILYVERWMEAPIQQADGRRVARDKGVPQGGSVSPIISNIFMHHVIDIWMKKNYPTVPFERYVDDAIVHCRTEKQTGFMKVMIEERLAEYRLKLHPKKTQIVYCKDDNRRDEFPKQSFDFLGYTFRPRLARNKIGKHFVSFLPAISNKAKKKITTTIRSWKMLRNTHITLEEISGKVNPIVRGWYQYYGKFYRTEVYKSLKNVERHLEKWVKRKYKRLRSHGRLARQFLGKVRDRSPNIFYHWTLGLGSKRLNNGSCIS
>NZ_CP041923.1|WP_129827232.1|759593_760466_+|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_006013790.1|761485_762271_+|SDR-family-oxidoreductase
MATSLLQGKKGLITGITNKRSIAYGIAKTLSEHGAELAITYQNETIKEKLLPIASELNVELILHCNVSNEETIDNAFEEIKKEWNTLDFLVHAIAFSDKNELNGKYVNTSLNNFINAMHISCYSFTALAQRAEKMMLNGGSLLTLSYYGAEKVMPNYNVMGLCKAALEASVKYIACDLGPQNIRVNAISAGPIRTLASSGISDFHSISEWNRSNSPLRRNVTIEDVGKAALYLLSDLSSGTTGEILHVDSGYNVVGMKIVD
>NZ_CP041923.1|WP_129827232.1|762513_763386_-|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHSRHRSPINFLVHIFSTLVSYSMKPKKPSISRFYCID
>NZ_CP041923.1|WP_006013808.1|764947_766042_+|redox-regulated-ATPase-YchF
MSFNCGIVGLPNIGKSTLFNALTESSAAEAANYPFCTIEPNVGKVPIRDQRLKQIASIAHSGKIIYNQLEVVDIAGLVKGASKGEGLGNKFLSHIREVDAIVHLLRCFTDDDISHVNSKIDPISDAEIVEMELILADIDSIEKRLPQLEKKAKQGDKELKRQLELMQEVLATLKLGKPARSLENIDEDEMKLLQLLTTKPVMYVCNVEDTHIITGNELSKRVEKMAKENKSKFYCISAKLEADIANLDSEEEKQNFLSEFGLQESGLDGVARIMYEVLSMITFFTVGPKEARAWPIKIGSTADKAAGVIHTDFEKGFIKAETISFEDYIKYGSELACKDAGKIRFEGRDYIVQDGDIMHFRFNV
>NZ_CP041923.1|WP_145510640.1|767625_768549_-|class-II-fructose-bisphosphatase
MEDLAYKLVKVTEAAALAAYKLAGLGNEKKADQVAVDAMRTVLNSMEMKGTVVIGEGEMDEAPMLYIGEKLGTGSGPEIDIAVDPLEGTTICAHYKQGAMSVLAATKKGNFLHAPDVYMEKIAVGKNLPEGVVSLKNRIEKNLDNLAKAKGCKASDLIVTVLKRERHDELIAKIRKLGAKVKLIDDGDVAAIVSLINGNHDMYIGTGGAPEGVLAAAALSSIGGQIEGRLIFDTDQLKERAKNLNITDPEKIYTVKDMARSESVFIATGVTNGEFVDGVKFDQDICLTHSLIILPGKVIKIQTKSIS
>NZ_CP041923.1|WP_006013819.1|768667_770467_+|ankyrin-repeat-domain-containing-protein
MVGNLTYEDVKKFVTDNPNIAAQEFGEKLKQSGLTDAKICDLFMDILRSGKSSILNDYDTFLKIAELLAKSNIKIDIGDTTSKTVLDYAVVGGQPKVIKVFLDSGKFDQEKKLNALSAAVNGGNVQEFEIFLDYIDHTKILDVLNTAPYNEGNEVMKILLNNKRFTGEEKVQDLSNASIDGDLPKVKLLLKYMTGIPEDGIRNLLKIIEEGKLPLRKQLQIDFEFKVDFSNSDHNKYLSSCVIIALLRSALSNTPNLGGNRAESSSSGETAVLNSNDVKKWYARIARTINSISFEDLQGDLNKQETSFQSKCEQGTVLGNALLERAIQNENFNVIKFLLENRVTVINAISQEDRYYVSKIEGDKSILCSVVSYTDDDAEILSMLLQSVNAEQLKLDPESELYRLYQQLKDDAFCIAFSKKNSVAAATLIQNDRAIIVPHGSATNKEQETSHIETNSVSNSNRNVISRPVAIVPPVSISGNNNKNETPISTRADPTVTPNNDKKANGFIDAQFSSPHKKETKYKESFYTSLRSDVIGVVITGLFVATAVIVPSVAGAVICGVVAVLVTIVTGLHVKNSTLPSYREMKENKVEPAKLIKSV
>NZ_CP041923.1|WP_006013822.1|770741_771479_+|ABC-transporter-ATP-binding-protein
MLVNNISYFYSNQDGFALSNINIQVKKGGVACLLGHSGCGKSTILKLIAGIENPKSGTIVINDKLVASNKVSIAIERRNIGLIFQHSALFPHKTVIENITFAICSTSKKEKYLTALEILKLFNIEKYENMYPHALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKYRIRHHILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGKIIQSGVPSYIYHRPKDDTLAKFFSELPFTPQLN
>NZ_CP041923.1|WP_006013840.1|771619_771787_+|twin-arginine-translocase-TatA/TatE-family-subunit
MSLGPWQLFLVLIIILVLFGAGRLPQVMGDLGKGIKNLKQELKDSEKLSSNEPDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041923_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041923_4

920465-920703

Orphan

Consensus_repeat	Method
GAATTCATATATAGTAGCATAATGCAAAGGAGTACTACCATTTCTGTCTT	PILER-CR

2 spacers

RT,DEDDh

The CRISPR arrays of NZ_CP041923_4

>merge|NZ_CP041923|4|920465-920703|PILER-CR
TAAAGTAGCATAATGCAAAGGAGTATTACCATTTTCATCTTTTACATTAATATCTGCACCTCTTTTTAGTAGAACATTTACTACATCTATGAATTTATATATAGTAGCATAATGCAAAGGAGTACTACCACTTCTGTCTTTTACATTAACATCCGCACCTTTTTTTAGTAGAGCATTTACTACATCTATGAGTTCATATATAGTAGCATAATGCAAAGGAGTACTACCATTTCTGTCTT

>NZ_CP041923|4|3|920465-920703|PILER-CR
TAAAGTAGCATAATGCAAAGGAGTATTACCATTTTCATCTTTTACATTAA	TATCTGCACCTCTTTTTAGTAGAACATTTACTACATCTATGAATTTATATATAGTA
GCATAATGCAAAGGAGTACTACCACTTCTGTCTTTTACATTAACATCCGC	ACCTTTTTTTAGTAGAGCATTTACTACATCTATGAGTTCATATATAGTA
GCATAATGCAAAGGAGTACTACCATTTCTGTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041923.1\|WP_006012656.1\|916441_917632_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006012653.1\|918272_919610_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224143
NZ_CP041923.1\|WP_006012681.1\|907456_907975_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_129827276.1\|911841_912654_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP041923.1\|WP_006012607.1\|931789_932173_-\|Fe-S-cluster-assembly-scaffold-IscU	unknown	unknown	gnl\|CDD\|183087
NZ_CP041923.1\|WP_006012640.1\|927857_928211_-\|TrbC/VirB2-family-protein	unknown	unknown	gnl\|CDD\|368210
NZ_CP041923.1\|WP_039950275.1\|908784_909420_+\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|99835
NZ_CP041923.1\|WP_006012616.1\|930946_931405_-\|molecular-chaperone-Hsc20	unknown	unknown	gnl\|CDD\|179914
NZ_CP041923.1\|WP_096560603.1\|913240_914512_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041923.1\|WP_006012627.1\|928410_929193_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|182787
NZ_CP041923.1\|WP_006012614.1\|931397_931784_-\|iron-sulfur-cluster-assembly-accessory-protein	unknown	unknown	gnl\|CDD\|272875
NZ_CP041923.1\|WP_006012645.1\|925467_926793_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP041923.1\|WP_006012648.1\|921573_922278_-\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_CP041923.1\|WP_006012658.1\|915512_916322_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_039950273.1\|910448_911246_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006012643.1\|926853_927852_+\|pyruvate-dehydrogenase-complex-E1-component-subunit-beta	unknown	unknown	gnl\|CDD\|237011
NZ_CP041923.1\|WP_006012683.1\|906494_907358_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|235493
NZ_CP041923.1\|WP_006012667.1\|911347_911758_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041923.1\|WP_006012624.1\|929196_930969_-\|Fe-S-protein-assembly-chaperone-HscA	unknown	unknown	gnl\|CDD\|273915
NZ_CP041923.1\|WP_006012604.1\|932350_933262_+\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686

Protein	Function_ID	Function_description	E-value
NZ_CP041923.1\|WP_006012616.1\|930946_931405_-\|molecular-chaperone-Hsc20	gnl\|CDD\|179914	PRK05014, hscB, co-chaperone HscB; Provisional.	2.8882e-15
NZ_CP041923.1\|WP_006012627.1\|928410_929193_+\|signal-peptidase-I	gnl\|CDD\|182787	PRK10861, PRK10861, signal peptidase I.	5.11615e-41
NZ_CP041923.1\|WP_039950275.1\|908784_909420_+\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|99835	cd06131, DNA_pol_III_epsilon_Ecoli_like, DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins. This subfamily is composed of the epsilon subunit of Escherichia coli DNA polymerase III (Pol III) and similar proteins. Pol III is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. It is a holoenzyme complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of Pol III also functions as a stabilizer of the holoenzyme complex.	2.97242e-97
NZ_CP041923.1\|WP_006012653.1\|918272_919610_-\|AAA-family-ATPase	gnl\|CDD\|224143	COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones].	2.69093e-31
NZ_CP041923.1\|WP_129827276.1\|911841_912654_-\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.80616e-79
NZ_CP041923.1\|WP_006012614.1\|931397_931784_-\|iron-sulfur-cluster-assembly-accessory-protein	gnl\|CDD\|272875	TIGR00049, Uncharacterized_protein_in_nifU_5'region, Iron-sulfur cluster assembly accessory protein. Proteins in this subfamily appear to be associated with the process of FeS-cluster assembly. The HesB proteins are associated with the nif gene cluster and the Rhizobium gene IscN has been shown to be required for nitrogen fixation. Nitrogenase includes multiple FeS clusters and many genes for their assembly. The E. coli SufA protein is associated with SufS, a NifS homolog and SufD which are involved in the FeS cluster assembly of the FhnF protein. The Azotobacter protein IscA (homologs of which are also found in E.coli) is associated which IscS, another NifS homolog and IscU, a nifU homolog as well as other factors consistent with a role in FeS cluster chemistry. A homolog from Geobacter contains a selenocysteine in place of an otherwise invariant cysteine, further suggesting a role in redox chemistry. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	5.02007e-39
NZ_CP041923.1\|WP_006012645.1\|925467_926793_+\|hypothetical-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	8.48999e-14
NZ_CP041923.1\|WP_006012648.1\|921573_922278_-\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	8.61375e-53
NZ_CP041923.1\|WP_006012643.1\|926853_927852_+\|pyruvate-dehydrogenase-complex-E1-component-subunit-beta	gnl\|CDD\|237011	PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional.	0
NZ_CP041923.1\|WP_006012607.1\|931789_932173_-\|Fe-S-cluster-assembly-scaffold-IscU	gnl\|CDD\|183087	PRK11325, PRK11325, scaffold protein; Provisional.	3.20058e-93
NZ_CP041923.1\|WP_006012640.1\|927857_928211_-\|TrbC/VirB2-family-protein	gnl\|CDD\|368210	pfam04956, TrbC, TrbC/VIRB2 family. Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure. This family also contains several VIRB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species.	1.28907e-09
NZ_CP041923.1\|WP_006012683.1\|906494_907358_+\|lipoyl-synthase	gnl\|CDD\|235493	PRK05481, PRK05481, lipoyl synthase; Provisional.	0
NZ_CP041923.1\|WP_096560603.1\|913240_914512_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.69938e-157
NZ_CP041923.1\|WP_006012624.1\|929196_930969_-\|Fe-S-protein-assembly-chaperone-HscA	gnl\|CDD\|273915	TIGR01991, HscA, Fe-S protein assembly chaperone HscA. The Heat Shock Cognate proteins HscA and HscB act together as chaperones. HscA resembles DnaK but belongs in a separate clade. The apparent function is to aid assembly of iron-sulfur cluster proteins. Homologs from Buchnera and Wolbachia are clearly in the same clade but are highly derived and score lower than some examples of DnaK. [Protein fate, Protein folding and stabilization].	0
NZ_CP041923.1\|WP_006012604.1\|932350_933262_+\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	7.84109e-161

>NZ_CP041923.1|WP_006012653.1|918272_919610_-|AAA-family-ATPase
MSSRANIPFFIAGAIASLTLITSGVFAVAPYVAFLSSVAALNIAPPVIFILFALSAVVIVFSYKMIKQSKKSQENSKAEVKELNKESSKEENKLTPIKEELEDGKDKENKYGFSGLEEKVHRILENFVTKDEVNGLKKEVSDLSARLINSPTTKNEVEAKLNMEFYVKGEARGWNTTFDNIILPSDIKEKLRGICESKSGGYLLYGPPGTGKTSISKAIANQTKSLFAFMSVSASCLSSQRNIDQIFEKAETNSPCMIFIDEIDGVGKKRTVHEDAGPLTYLLTKLDKEFLSSKNITVVAAINHKNHLDPALIRDGRLECIEVPGLDKDDTRQKILQERLEKLKDSDMKILVQASKGFSMANLICLIDKISETTEKEGEIKYLRTFCKNFKKKHNIKDEPDKKHSNGKTKNKDIRLSSGSLSRSSSVSSSLSDVSSRGSNRQIEG
>NZ_CP041923.1|WP_006012656.1|916441_917632_-|hypothetical-protein
MTNSVNELSNKAPIILTWVPRVRGTSLPNGKNSTLNYLEIIKNHKLKNKEKRDIYLVINGPGFEENQIDNLKRELKEIKGVHVVDLHQYDWSEIDEGWKIDGKDISIKDFFKNMYNMSEEQRMYFAIEIDTFRLIALALSEKMTGEKGAIYIDFDSLKAIDTHIGKDITIPEGILLGNVIACFLDQEGNTNYTSAVDIKNSNHYDEYKNLMIFTNNDCIAVNNSSVAVSILSNYKDRILSQKEACNEVKKRLSLALEQEEELDRGVSLFIKDEELKNETIKQAKEKIKKCISDFESNGIQELYNIENFHYINTGLGEFSLNSAQMSTIKPLLVQLNGEKVSKCPSFSFNCNNGNYVSVLGSDLSWMKGESLYCQQVDKKLEGAEVDQVAMEKLSLA
>NZ_CP041923.1|WP_006012658.1|915512_916322_-|hypothetical-protein
MSKKIVNALKAKVKELKYQDLKARESNYHLTYIDLARINNIVINGTVVTNEVIRQLLGGMRGESTIFHEMFRYAGATVPNDLIIKELAANYNQSGYVKFLYESYSSIEDWEKTGLKLLTNCNGERTFRMDCYDPNRLKFSFSMERIPVTDTEIEYFGHFHELCNLSGSVEFKLKYKDGNVTYEDGKVLLTIPKELEDYKAGDDSLLDKLTDIINKIAEYLKKLCEKLGFKFDTKIEYNSERNINIEHNLGRPLKVIDEPDIYAVNGLEL
>NZ_CP041923.1|WP_096560603.1|913240_914512_+|group-II-intron-reverse-transcriptase/maturase
MNKTKSFDIPKQLIWRAYKQVSKNRGAAGVDGVSITKFEENLKDNLYKLWNRMSSGSYFPEPVKAVAIPKDMGGGQRILCVPSVFDRIGQTAAAMYLEPLVEPKFHEDSYGYRPNKSALDAVDTARKRCWRYDWTIDLDISGFFDNLDHELVLRAIKKHTDCKWVILYVERWMEAPIQQADGRRVARDKGVPQGGSVSPIISNIFMHHVIDIWMKKNYPTVPFERYVDDAIVHCRTEKQTGFMKVMIEERLAEYRLKLHPKKTQIVYCKDDNRRDEFPKQSFDFLGYTFRPRLARNKIGKHFVSFLPAISNKAKKKITTTIRSWKMLRNTHITLEEISGKVNPIVRGWYQYYGKFYRTEVYKSLKNVERHLEKWVKRKYKRLRSHGRLARQFLGKVRDRSPNIFYHWTLGLGSKRLNNGSCIS
>NZ_CP041923.1|WP_129827276.1|911841_912654_-|IS982-family-transposase
MNKNVTELFCFVDDFCKAINKNFAEKLLPNSKKPTRTPGITHSEILTIILLYQQSRCEDFKSFYTYYLKALHGSEFQNLPTYSRFIRLKSRVLWYLVLLLKWLCEQSKMTGISYIDATSIAVCHPKRISRNKVFKGLAKLGKTTYGWFLGFKLHMVINEKGEIQGVTMTKGNVDDRKPVPKLTEKLTGLLFGDKGYIKKELFAKLFDRGIKLVTKVKKGMKNTLMLLEEKIFLRKRSIIQTVFGYLKNRLDLEHSRHRSPINFLVHIFPH
>NZ_CP041923.1|WP_006012667.1|911347_911758_-|hypothetical-protein
MGEKQLLDDEAKKKGKSVIEELDKIEHKIVDLRNGKIRELYEPLVCHYSRYREIGLNLGQFYTVEVVRNGLIGQDESKIGLFFFEKNNGNYVCTINGDLSWARGANLYHKQLKSELEKVQVDQMELEKLSLKQSQI
>NZ_CP041923.1|WP_039950273.1|910448_911246_-|hypothetical-protein
MKDKARERRYADLKSTESSDYRTYKDLDMDFNSEYEFVCDLVINGKAITNDFIKNLYLKHKNLITEDKDKKGSYRLFLKQIFTEVFVNAGAAVPNDPIMEELITYYNRSGYKQFFSSQSQALRSFGLCMYSFRYLIPSYRERTYISCEDPNCLKFSFSVNDGIYHDNKILVCDLQNSVEFKLKCEGENVKYEEGKVSLTIPKELKNYKANDKNLFDVIIEYFQKFCEKFGFHFETKIEHILDNPLGVLSDINTSQDKNLNLKNLK
>NZ_CP041923.1|WP_039950275.1|908784_909420_+|DNA-polymerase-III-subunit-epsilon
MREIVLDTETTGLDVNSHRIIEIGCVELINHIPTGKVFHRYINPERSIDKGAFKVHGISEEFLKDKPLFSEIASEFLNFISSDTLVIHNAGFDIKFLNMELGKLNAKLISSDRVLDTLPLARKKFGPPASLSALCERFGISLESRELHGALIDAELLAKVYVERLQTPLDRCQHAVRNLSLRGHLPSNEEVSEQLDEINVSVHEGVVDRRL
>NZ_CP041923.1|WP_006012681.1|907456_907975_+|hypothetical-protein
MGGSNEKVDYTELSKSSISDKIKPKKKVTFCQQVQVKEIPLEGKKGKCKRHKEKKQSKKKNWTRGQYSAPPPYFLLIREQVQKTQLWERGAAIIVPPVIGLLGGLITLILITEEIRSPFLIAALAATVITAAIYELEYLLKPELLEKPGKTLKDLVTDSFVKEEKNSRTVSQ
>NZ_CP041923.1|WP_006012683.1|906494_907358_+|lipoyl-synthase
MHSKPTWLRAKAPAGKIFNETLNTVKLHNLHTVCEEAACPNIGECWNKRHATVMILGSVCTRACAFCNVATGIPDKLDPHEPENLAKAIKKLNLKHVVITSVDRDDLPDGGANQFIRCIEEIRKITSETTIEILTPDFVNKKGAFEAIAIASPDVYNHNIETVPRLYAKIRPRARYFHSLYLLKMVKQINSKLFTKSGLMVGLGETKEEIFQVMDDLRSAEVDFITIGQYLQPTPKHAKIDRYVTPEEFEHYKYIAYSKGFLVVASSPLTRSSYHAEEDFNRLKACS
>NZ_CP041923.1|WP_006012648.1|921573_922278_-|ComF-family-protein
MNLLLLKKATDLIFPNVCVSCERIIDKSYDLCSECNKKINFLTKHYCNVCGVVIPDNIYTCGKCISNPPPFKVLRSVFAYDEHSKNMIINFKFFDNLNYMKVYAKCMYKANKDMFQNAEVIIPIPLHKIRLFKRKYNQAALLAKELSKLSHLSYTPFAIKRIRHTVPQAGLSLKRREKNLRKAFKISNSEIIKNKIVILVDDVVTTGATARSCSQEILNSGAREVRVLSLARTI
>NZ_CP041923.1|WP_006012645.1|925467_926793_+|hypothetical-protein
MAIEKEKFFEIINEVSESRDLDEDNLLEKIKNELKGKDAGEYNKFSKNFSKEHQFSIKISEEAAEDWTLLHLATACNNMLIVELLLKKKASVNARVKDGSKNDGLTALHIATFCGHESMVKQLLSDDRVNPSLKSKNKTPREVVGNTENKEAIVQMLEEAEENHSRKKKIKGFHIQVGEGSCDRSSQNDNITRVSSFVNGITELGNDRKKSIAVEIQMWNERRKENNDNIQSEQIASHSITGESVSNEDSGLEFEDTFDTSFCSEINNDGAANEVNDQILESLQPQIQLQDRQIRKLEKPGKELKHIEKALEKLKSDLAGHETRSEILDKLSEENQSLKQQIQDLKSKNTTLNSELSKTKANKVEKTQLCFLKIASVNFAIMLTVGVAFSIAFQLPILLMIATSVMSSLIVGGVTYALSPQPTELKEVSIKCSMQHDACKT
>NZ_CP041923.1|WP_006012643.1|926853_927852_+|pyruvate-dehydrogenase-complex-E1-component-subunit-beta
MAILSVREALCTAIREEMQNDPDIFIMGEEVAEYDGAYKVTKGLLKEFGENRVVDTPITEHGFAGLAVGAAFAGLRPIVEFMTFNFSMQAIDQIVNSAAKTNYMSGGQLGCPIVFRGPNGAAARVAAQHSQCFASWYSHVPGLKVIAPYFASDCRGLLKAAIRDPNPVIFLENEIAYGHEHEVPDSELSNKDYLLEIGKAVVIREGKDVTITAFSLKLMDALNAADLLSIEGIEAEVIDLRTLRPLDTETVINSIKKTNRLVSVEEGWPFGGIGAELSAVVMEQGFDYLDAPVVRVTGKDIPLPYAANLEKKALPQIEDIVEAVHQVCFRKK
>NZ_CP041923.1|WP_006012640.1|927857_928211_-|TrbC/VirB2-family-protein
MNPTIRKVFCILLIILFISFSHVGSAANSNDDTTAQVICNIIGYVWGIGGPLMTVVIIGAALLAIFGRMPWPALFALGVFCAVFFGAKTIVIKVMGGINSTNASFMEKCGTEETKNN
>NZ_CP041923.1|WP_006012627.1|928410_929193_+|signal-peptidase-I
MCYDKFKFIKKIKLKELRENRIARTRKFLSSLFFLLLIALSIRSFLFEPFHIPSGSMKSTLLEGDYIFTSKYSYGYSKHSFPFSPNIFSGRIFYTPPERGDVIVFRPTRNESVRYVKRVIGLPGDKVQVIKGELYLNDQKVERRQIKDFFDYESKRSIPRYIETLPGGKEHEILTYNIDDEPSNTPVYYVPDDQFFVMGDNRNNSRDSRFSDVGFVQMENIVGRVSMVGLSFKLGKVDWLPFNFRLPVALRFDRILHKVV
>NZ_CP041923.1|WP_006012624.1|929196_930969_-|Fe-S-protein-assembly-chaperone-HscA
MRPVQISEPSSNEVVFGIDLGTTNSLIAMVNKAGNVEIFKDEQGRELLPSVISYEKDVLKVGYDVGENAICSIKRLMGKSVKDLHKEGINCEIDNESEKVIRVKCSEEKYLTPIEISAEILKTLCKRVKKFTGMKVNKAVITVPAYFDDSARNATKYAAKLAGIDVLRLINEPTAAALSYSIEKNNNSGIYAVYDLGGGTFDISILKLHQGVFQVLAVGGDTKLGGDDFDHLLSLIVLEKYREQVGLSKSVIPASATCMAGPSLIESRIVKEYLSNNTSGTFEFSINGELFECEITKEEFEQAISPLVNKTINIVTRTISNIDLKIDNIKGVILVGGATRVPLVQNSLIKLFGNKVLNDVDPDKAVANGAALQAHYLTSNSKDRNILLDVLPLSLGIETMGGIVEKIIPRNTPLPVSEIKEFTTYANGQTAMKIHVCQGEREMIKDNKSLARFELKGIPKLPAGSAKVEIGFTVSIDGILTVTAREKTTGVEQTVEINSSSGLSEEDIQDMVNQSVSNFDEDMKARSLAEAKINGNKLIHLVENVSTEQKLKILLQNAKDALQENDLDNINNAISELENSALELCESSDR
>NZ_CP041923.1|WP_006012616.1|930946_931405_-|molecular-chaperone-Hsc20
MSSNHFTLFGIEPAFNISFDELEKKYIELSKTDINERESKNMENINKAYQVLKSPLKRAEHLLDLFDVQSKKEHLDPEILNESMEIREYFLDCDDLQFASRMIDEKVKDCTKNLINAFATKNFDEAATQVFRLRYLYKSFEEIKENAASSNF
>NZ_CP041923.1|WP_006012614.1|931397_931784_-|iron-sulfur-cluster-assembly-accessory-protein
MSEFQGVNSVKKPITLTANAVERVRFLLDKKKHANLEEAIGIRVLIKQKGCSGLKYDIEYAYDVRPLESVIEESCSDDQKVKVLIDPKSIMFILGSEMDYVEEKFSSGFIFKNPNEKGKCGCGESFHV
>NZ_CP041923.1|WP_006012607.1|931789_932173_-|Fe-S-cluster-assembly-scaffold-IscU
MSYNEKILDHYENPRNVGSLDKNDPNVGTGLVGAPSCGDVMKLQIKVNDKGVIEDAKFKTFGCGSAIASSSLLTEMIKGKTIEDVTKIKNTQIVEELSLPPVKIHCSVLAEDAIKAAIHDYQNKQKH
>NZ_CP041923.1|WP_006012604.1|932350_933262_+|signal-recognition-particle-docking-protein-FtsY
MSLLSNLYQGLLKTSSRFSDGVKNIFSGKKKLDQSLLDDLEELLISMDIGHKTSRLLIDKLASIKFESEVEHSVITQQLMSEIESILNPVVQPLILNKKPHIIMVCGVNGNGKTTTIGKLAYKYKEKGKSVMLVACDTFRAAASEQLNIWAERSDCSIVTGEHGSDSASVAYRAVNQAIKDSVDVVLIDTAGRLQNNVNLMQELSKIHRTIKKLDDTAPHDVILVLDATTGQNAYSQLEAFSKMVGVTGLIVTKLDGTAKGGVVIGLAEIYKVKLHAIGIGESIEDLREFTGKEFAEALFKCD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13818 : 56914

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(20.0%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006014241.1\|13818_14820_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_129827230.1\|15108_15768_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-46	43.6
WP_129827231.1\|15962_16262_-\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_129827232.1\|16291_17164_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827233.1\|17750_19022_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096560668.1\|19474_20695_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.7e-47	34.2
WP_006014255.1\|20694_21876_-	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_006014258.1\|21923_22370_+	heme biosynthesis protein HemY	A0A2H4N7M3	Lake_Baikal_phage	9.7e-14	36.9
WP_006014261.1\|22396_23071_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-28	38.6
WP_006014264.1\|23100_23325_-	hypothetical protein	NA	NA	NA	NA
WP_006014267.1\|23317_24016_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_006014270.1\|24150_25338_+	cysteine desulfurase	A0A141ZJV0	Faustovirus	5.4e-27	32.1
WP_006014273.1\|25540_26263_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_039950656.1\|26263_26800_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_096560667.1\|26846_27314_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006014286.1\|27662_28640_+	quinone oxidoreductase	NA	NA	NA	NA
WP_096560603.1\|29075_30347_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|30933_31806_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013045.1\|31955_33002_-	glycine zipper family protein	NA	NA	NA	NA
WP_006013084.1\|33143_33842_+	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_006013081.1\|33971_34280_+	hypothetical protein	NA	NA	NA	NA
WP_096560649.1\|34338_35265_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_006014305.1\|35514_36975_+	hypothetical protein	NA	NA	NA	NA
WP_006014307.1\|36979_37588_+	hypothetical protein	NA	NA	NA	NA
WP_006014310.1\|37584_38373_+	hypothetical protein	NA	NA	NA	NA
WP_006014313.1\|38527_39010_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	2.0e-36	60.3
WP_006014316.1\|39019_39898_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_096560648.1\|39890_40475_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|40776_41649_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827234.1\|42235_43507_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_063630856.1\|44316_45642_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_096560644.1\|45777_46602_+	hypothetical protein	NA	NA	NA	NA
WP_006014358.1\|46726_48253_+	acyl-CoA carboxylase subunit beta	NA	NA	NA	NA
WP_136122016.1\|48925_49360_+	hypothetical protein	NA	NA	NA	NA
WP_006014364.1\|49361_50153_+	peptidase M61	NA	NA	NA	NA
WP_006014367.1\|50218_50473_+	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|50514_51387_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096616077.1\|52685_53774_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827235.1\|53784_54327_-	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|54363_55452_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006014381.1\|55651_56914_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	4.1e-65	34.5

DBSCAN-SWA_2

147909 : 194341

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006014650.1\|147909_150414_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.3e-163	37.9
WP_006014654.1\|150418_151009_-	M23 family metallopeptidase	A0A7K9	Microcystis_virus	1.2e-08	33.6
WP_006014656.1\|151061_151388_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_006014658.1\|151387_151684_-	integration host factor subunit alpha	NA	NA	NA	NA
WP_006014663.1\|151722_152919_-	MFS transporter	NA	NA	NA	NA
WP_129827232.1\|153651_154524_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827238.1\|154791_155013_-	hypothetical protein	NA	NA	NA	NA
WP_006013179.1\|155082_155385_-	hypothetical protein	NA	NA	NA	NA
WP_145510622.1\|155521_155749_+	hypothetical protein	NA	NA	NA	NA
WP_129827239.1\|156034_157354_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_096616077.1\|157533_158622_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_096641400.1\|158648_159197_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006014667.1\|159324_160329_-	PRANC domain-containing protein	NA	NA	NA	NA
WP_145510623.1\|161132_162005_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013222.1\|163021_163378_-	hypothetical protein	NA	NA	NA	NA
WP_129827241.1\|163509_164781_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|165367_166240_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006015237.1\|166521_167568_-	hypothetical protein	NA	NA	NA	NA
WP_006015235.1\|167820_168438_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_006015234.1\|168437_169406_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_096560718.1\|169588_170515_-	hypothetical protein	NA	NA	NA	NA
WP_006015230.1\|170715_174036_+	DNA polymerase III subunit alpha	A0A291AWR1	Streptomyces_phage	4.5e-164	34.1
WP_006015228.1\|174084_174858_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_039950823.1\|174857_175136_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_006015225.1\|175139_175664_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_006015222.1\|175776_177069_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.7e-16	25.6
WP_129827309.1\|177374_177506_-	hypothetical protein	NA	NA	NA	NA
WP_129827230.1\|177591_178251_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-46	43.6
WP_129827231.1\|178445_178745_-\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_006013981.1\|178859_180134_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_006013980.1\|180176_181373_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_129827239.1\|181633_182953_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_006015211.1\|183246_183537_+	hypothetical protein	NA	NA	NA	NA
WP_015587954.1\|183533_184079_-	hypothetical protein	NA	NA	NA	NA
WP_129827310.1\|184754_184916_+	hypothetical protein	NA	NA	NA	NA
WP_039950817.1\|185420_185999_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_145510624.1\|186270_186741_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	4.6e-14	33.9
WP_145510625.1\|186737_187991_-	dihydropteroate synthase	S4W084	Pandoravirus	2.8e-26	26.9
WP_039950813.1\|187987_188374_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_096560656.1\|188396_189056_-	CADD family putative folate metabolism protein	NA	NA	NA	NA
WP_129827242.1\|189237_189600_+	type IV secretion protein Dot	NA	NA	NA	NA
WP_096616077.1\|189808_190897_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827311.1\|191724_192099_-	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|193468_194341_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

205069 : 280599

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096676677.1\|205069_205942_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006015142.1\|205971_207471_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006015139.1\|207602_208829_+	cytochrome b/b6	NA	NA	NA	NA
WP_096560735.1\|208828_209590_+	cytochrome c1	NA	NA	NA	NA
WP_006015133.1\|209676_211611_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_096616077.1\|212162_213251_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006015122.1\|213301_214393_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_129827243.1\|214653_215880_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_080589545.1\|215908_216268_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_006015115.1\|216329_216902_+	NifU family protein	A0A218MN08	uncultured_virus	4.3e-06	31.5
WP_006015112.1\|216898_218122_+\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	6.1e-26	25.8
WP_006015109.1\|218118_218889_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.5e-27	28.7
WP_006015105.1\|219100_220510_-	hypothetical protein	NA	NA	NA	NA
WP_006015102.1\|220635_221910_+	amino acid permease	NA	NA	NA	NA
WP_006015099.1\|221980_223267_+	amino acid permease	NA	NA	NA	NA
WP_096560665.1\|223295_223721_-	hypothetical protein	NA	NA	NA	NA
WP_006015092.1\|223859_224882_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_039950789.1\|224883_225960_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_039950787.1\|226066_226471_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_006015083.1\|226673_228272_-	iron ABC transporter permease	NA	NA	NA	NA
WP_006015082.1\|228402_229248_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_006015080.1\|229244_229658_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|229867_230740_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827312.1\|231048_231915_+	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|232522_233395_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827245.1\|234823_235360_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|235406_236279_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006015057.1\|236907_238485_-\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_006015054.1\|238549_238846_+	type VI secretion protein	NA	NA	NA	NA
WP_006015049.1\|238855_241261_+	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_006015045.1\|241253_243827_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_006015043.1\|243844_246235_+	type IV secretion system protein	NA	NA	NA	NA
WP_039950782.1\|246231_249105_+	conjugal transfer protein TrbL	NA	NA	NA	NA
WP_096560625.1\|249186_252420_+	type IV secretion system protein	NA	NA	NA	NA
WP_006015036.1\|252403_253033_+	hypothetical protein	NA	NA	NA	NA
WP_129827246.1\|253356_254400_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_096676677.1\|255725_256598_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|257184_258456_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006015015.1\|258723_260463_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.7e-67	33.2
WP_006015006.1\|261128_262451_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_006015001.1\|262887_266136_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	4.3e-175	34.0
WP_006014998.1\|266177_268949_+	hypothetical protein	NA	NA	NA	NA
WP_006014995.1\|268945_271285_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_006014992.1\|271397_271667_-	hypothetical protein	NA	NA	NA	NA
WP_006014988.1\|271867_272593_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_006014985.1\|272652_272880_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_006014971.1\|272883_273363_+	ATP synthase F0 subunit B	NA	NA	NA	NA
WP_006014968.1\|273370_273847_+	hypothetical protein	NA	NA	NA	NA
WP_006014959.1\|275423_276419_+	heme A synthase	NA	NA	NA	NA
WP_145510626.1\|276401_278381_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_006014954.1\|278442_279093_-	hypothetical protein	NA	NA	NA	NA
WP_006014952.1\|279246_280599_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_4

287406 : 352229

Bacillus_virus(18.18%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096676677.1\|287406_288279_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006014920.1\|289140_289641_+	NADH-quinone oxidoreductase subunit NuoE	NA	NA	NA	NA
WP_006014918.1\|289641_290853_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.1e-79	40.9
WP_006014915.1\|290956_291274_+	hypothetical protein	NA	NA	NA	NA
WP_006014912.1\|291270_292545_-	insulinase family protein	G3MBJ8	Bacillus_virus	3.0e-52	33.1
WP_006014910.1\|292546_293155_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.6e-35	41.0
WP_096560749.1\|293291_293828_+	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|295391_296264_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006014897.1\|296509_299008_-	hypothetical protein	NA	NA	NA	NA
WP_006014896.1\|299004_299391_-	hypothetical protein	NA	NA	NA	NA
WP_039950762.1\|299383_300880_-	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_006014888.1\|301226_301787_+	hypothetical protein	NA	NA	NA	NA
WP_006014886.1\|301876_303925_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_006014883.1\|303933_305589_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	1.6e-85	35.0
WP_006014880.1\|305684_306050_+	hypothetical protein	NA	NA	NA	NA
WP_006014877.1\|306139_306784_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_006014874.1\|306789_307569_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_006014871.1\|307659_308733_+	hypothetical protein	NA	NA	NA	NA
WP_129827248.1\|308966_310286_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_039950755.1\|310422_313251_-	hypothetical protein	NA	NA	NA	NA
WP_006014858.1\|313231_315586_-	type VI secretion protein	NA	NA	NA	NA
WP_039950758.1\|315637_316003_-	hypothetical protein	NA	NA	NA	NA
WP_006014852.1\|316107_317553_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_006014849.1\|317657_318698_-	2-nitropropane dioxygenase	NA	NA	NA	NA
WP_006014846.1\|318703_319225_-	cytochrome b	NA	NA	NA	NA
WP_006014843.1\|319490_320663_+	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_129827232.1\|320798_321671_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|321896_323168_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|323861_324950_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827313.1\|325450_326497_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	5.8e-166	80.7
WP_006014834.1\|328005_328776_-	response regulator transcription factor	A0A0K0PVG9	Roseobacter_phage	6.0e-11	41.3
WP_006014776.1\|329098_330076_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_096560653.1\|330095_330578_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_006014768.1\|330567_331359_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006014755.1\|331394_332531_+	hypothetical protein	NA	NA	NA	NA
WP_006014752.1\|332534_333323_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_007302008.1\|333377_333836_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_006014745.1\|333829_334228_-	EVE domain-containing protein	NA	NA	NA	NA
WP_006014742.1\|334227_335412_-	cell division protein FtsZ	NA	NA	NA	NA
WP_006014739.1\|335650_336124_-	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|336571_337444_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006014725.1\|338364_339135_+	polysaccharide deacetylase family protein	A0A2I2L4G0	Orpheovirus	2.9e-05	26.2
WP_006014723.1\|339155_340712_+	penicillin-binding protein	NA	NA	NA	NA
WP_006014721.1\|340811_343268_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.2e-193	44.6
WP_145510627.1\|343283_344561_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	9.0e-105	51.1
WP_096560730.1\|344560_345187_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.9e-60	61.4
WP_006014712.1\|345198_346542_-	trigger factor	NA	NA	NA	NA
WP_006014710.1\|347034_347634_+	BON domain-containing protein	NA	NA	NA	NA
WP_006014706.1\|347800_348007_-	hypothetical protein	NA	NA	NA	NA
WP_145510667.1\|348066_348207_-\|transposase	transposase	NA	NA	NA	NA
WP_006014702.1\|348344_349196_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_096560603.1\|349498_350770_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|351356_352229_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

368446 : 426624

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(40.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006014688.1\|368446_369397_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_006014685.1\|372139_373411_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_039950729.1\|373641_374112_-	transporter	NA	NA	NA	NA
WP_006014682.1\|374246_375674_+	isocitrate dehydrogenase	NA	NA	NA	NA
WP_129827231.1\|376409_376709_+\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_096676677.1\|376815_377688_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006014667.1\|378227_379232_+	PRANC domain-containing protein	NA	NA	NA	NA
WP_096641400.1\|379359_379908_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_096676677.1\|380753_381626_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|382212_383484_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006013634.1\|383790_385131_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_096676677.1\|385799_386672_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827249.1\|387858_388731_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827250.1\|388757_389504_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|389530_390619_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006013625.1\|391244_392258_-	hypothetical protein	NA	NA	NA	NA
WP_006013621.1\|392353_392725_+	hypothetical protein	NA	NA	NA	NA
WP_006013619.1\|392725_392998_+	DUF2610 domain-containing protein	NA	NA	NA	NA
WP_006013616.1\|393008_393851_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_006013614.1\|393889_394300_+	hypothetical protein	NA	NA	NA	NA
WP_006013610.1\|394496_396296_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_006013606.1\|396267_398592_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006013603.1\|398842_399451_-	guanylate kinase	E7DUI8	Liberibacter_phage	3.4e-17	32.4
WP_039950511.1\|399486_401253_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_006013597.1\|401236_402220_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006013595.1\|402873_403779_-	aspartate carbamoyltransferase catalytic subunit	M1HGA5	Paramecium_bursaria_Chlorella_virus	1.6e-26	31.5
WP_006013592.1\|403859_404876_-	Fe(3+) ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_129827246.1\|405772_406816_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_129827252.1\|406865_407999_-	hypothetical protein	NA	NA	NA	NA
WP_006013579.1\|408082_408868_-	NAD kinase	NA	NA	NA	NA
WP_006013575.1\|408889_409102_-	50S ribosomal protein L31	NA	NA	NA	NA
WP_006013569.1\|409226_410195_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_039950503.1\|410246_411002_+	hypothetical protein	NA	NA	NA	NA
WP_006013563.1\|411016_412513_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_006013560.1\|412709_413444_+	hypothetical protein	NA	NA	NA	NA
WP_145510631.1\|413812_416452_-\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	6.3e-76	37.6
WP_006013553.1\|416670_417627_+	hypothetical protein	NA	NA	NA	NA
WP_006013551.1\|417916_418678_+	hypothetical protein	NA	NA	NA	NA
WP_006013549.1\|418889_419333_+	PAS domain-containing protein	NA	NA	NA	NA
WP_006013548.1\|419431_419638_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_006013542.1\|419659_420025_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_039950500.1\|420044_420944_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-10	36.2
WP_145510668.1\|420983_421277_-	hypothetical protein	NA	NA	NA	NA
WP_006013536.1\|421314_422835_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.1e-67	45.2
WP_096616077.1\|423015_424104_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827253.1\|424169_425450_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_096616077.1\|425535_426624_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2

DBSCAN-SWA_6

430959 : 492510

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(13.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129827246.1\|430959_432003_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_006013510.1\|432823_433744_+	hypothetical protein	NA	NA	NA	NA
WP_039950492.1\|433731_435030_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_006013506.1\|435026_435521_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006013504.1\|435907_436369_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_006013501.1\|436383_437115_+	DsbA family protein	NA	NA	NA	NA
WP_017532317.1\|437143_437422_-	DUF2671 domain-containing protein	NA	NA	NA	NA
WP_006013497.1\|437672_438350_+	O-methyltransferase	A0A2P1JQT7	Mycobacterium_phage	1.7e-17	32.1
WP_006013494.1\|438321_438975_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_006013492.1\|438971_439181_-	hypothetical protein	NA	NA	NA	NA
WP_006013489.1\|439354_440938_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.8e-41	36.5
WP_015588155.1\|440941_441274_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_006013486.1\|441610_442297_+	P44/Msp2 family outer membrane protein	NA	NA	NA	NA
WP_006013484.1\|442567_443461_+	sigma-70 family RNA polymerase sigma factor	A0A248SJA5	Salicola_phage	1.0e-25	29.0
WP_006013483.1\|443453_443951_+	hypothetical protein	NA	NA	NA	NA
WP_096560624.1\|444062_445214_+	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	4.7e-52	36.6
WP_006013481.1\|445215_445953_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_006012936.1\|446066_447134_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	8.6e-117	62.2
WP_129827239.1\|447394_448714_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_006013480.1\|448945_449500_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_006013479.1\|449499_450111_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_145510632.1\|450253_450553_+	ETC complex I subunit	NA	NA	NA	NA
WP_129827249.1\|451093_451966_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013473.1\|452126_453011_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_006013471.1\|453208_454411_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.8e-46	32.2
WP_006013469.1\|454435_455218_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_006013467.1\|455334_456573_-	cell division protein FtsA	NA	NA	NA	NA
WP_006013465.1\|456704_457244_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.2e-21	39.4
WP_006013463.1\|457233_458007_+	uracil-DNA glycosylase	A0A127AW33	Bacillus_phage	1.9e-12	30.2
WP_006013459.1\|458518_459046_+	demethoxyubiquinone hydroxylase family protein	NA	NA	NA	NA
WP_006013456.1\|459173_460406_-	hypothetical protein	NA	NA	NA	NA
WP_006013453.1\|460656_462042_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.4e-52	31.9
WP_006013441.1\|462764_463052_-	hypothetical protein	NA	NA	NA	NA
WP_006013437.1\|463072_463393_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_039950484.1\|463521_464337_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_006013430.1\|464323_465088_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-10	28.4
WP_145510633.1\|465204_468408_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_096676677.1\|468833_469706_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013351.1\|469794_470748_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	4.8e-10	27.8
WP_039950469.1\|472600_474625_-	ComEC/Rec2 family competence protein	NA	NA	NA	NA
WP_129827232.1\|474829_475702_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013335.1\|476139_476820_+	hypothetical protein	NA	NA	NA	NA
WP_006013332.1\|476845_477439_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.3e-29	42.2
WP_006013329.1\|477541_478114_+	thioredoxin family protein	NA	NA	NA	NA
WP_006013327.1\|478119_479838_+	potassium transporter	NA	NA	NA	NA
WP_006013324.1\|479927_481088_+	aspartate kinase	NA	NA	NA	NA
WP_006013321.1\|481105_482185_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_006013317.1\|482193_482661_-	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_006013315.1\|482724_483651_+	glutathione synthase	NA	NA	NA	NA
WP_006013311.1\|483635_484658_-	UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase	NA	NA	NA	NA
WP_039950466.1\|484731_485097_+	hypothetical protein	NA	NA	NA	NA
WP_006013306.1\|485098_486484_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.5e-44	28.6
WP_006013300.1\|487172_487652_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_006013294.1\|487731_488346_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|488445_489318_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|489904_491176_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|491421_492510_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2

DBSCAN-SWA_7

497476 : 582267

Wolbachia_phage(18.75%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006013270.1\|497476_498589_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_145510634.1\|498801_499869_-	MreB/Mrl family cell shape determining protein	NA	NA	NA	NA
WP_039950459.1\|499889_501308_-	carboxypeptidase	NA	NA	NA	NA
WP_006013262.1\|501579_502059_+	OmpA family protein	NA	NA	NA	NA
WP_006013259.1\|502194_503487_+\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	1.9e-09	29.5
WP_006013256.1\|503499_503982_+	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	6.4e-11	47.1
WP_080589540.1\|504141_504627_+	AAA family ATPase	E4WLN5	Ostreococcus_tauri_virus	8.1e-22	52.1
WP_145510635.1\|504846_506676_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	1.2e-115	42.5
WP_096641557.1\|506799_507801_-	hypothetical protein	NA	NA	NA	NA
WP_006013244.1\|508037_508532_+	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|508820_509693_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013192.1\|510102_511359_+	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_129827239.1\|511871_513191_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_129827232.1\|513506_514379_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827232.1\|514573_515446_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013106.1\|515674_517420_-	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	1.1e-15	29.6
WP_006013103.1\|517701_521307_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006013099.1\|521417_522428_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.8e-62	39.9
WP_006013098.1\|522499_523237_-	hypothetical protein	NA	NA	NA	NA
WP_039950406.1\|523413_524841_-	two-component sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-27	32.4
WP_006013093.1\|524905_526075_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.5e-34	31.0
WP_096676677.1\|527574_528447_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|529033_530305_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827256.1\|530355_530541_-	hypothetical protein	NA	NA	NA	NA
WP_051008230.1\|530539_531109_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006013026.1\|531158_532232_+	AI-2E family transporter	NA	NA	NA	NA
WP_006013023.1\|532335_532971_+	chromosomal DNA replication initiator DnaA	NA	NA	NA	NA
WP_006013018.1\|533342_534329_+	tyrosine recombinase XerD	Q83VS6	Escherichia_phage	3.4e-11	26.6
WP_039950381.1\|534385_535111_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_006013011.1\|535154_535424_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_006013009.1\|535504_536746_+	citrate synthase	NA	NA	NA	NA
WP_006013005.1\|536790_538233_-	hypothetical protein	NA	NA	NA	NA
WP_006013002.1\|538262_538445_-	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|539319_540192_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_039950357.1\|540238_540526_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_039950355.1\|540820_542032_-	hypothetical protein	NA	NA	NA	NA
WP_006012928.1\|542298_543288_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	3.0e-07	29.1
WP_006012927.1\|543284_543857_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_006012925.1\|544156_544681_+	cytochrome c family protein	NA	NA	NA	NA
WP_006012924.1\|544682_545438_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006012922.1\|545480_547394_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	3.6e-113	38.2
WP_006012920.1\|547522_547945_-	hypothetical protein	NA	NA	NA	NA
WP_006012918.1\|548137_548725_+	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_006012916.1\|548715_549024_+	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_006012909.1\|550875_552318_+	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_096560722.1\|552314_553679_+	NADH-quinone oxidoreductase subunit N	NA	NA	NA	NA
WP_006012905.1\|553696_554419_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_006012899.1\|554536_554938_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_096616077.1\|555081_556170_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827257.1\|556626_558567_-	hypothetical protein	Q9JML0	Wolbachia_phage	1.2e-289	84.6
WP_006012795.1\|559224_561423_-	hypothetical protein	Q9JMK9	Wolbachia_phage	1.0e-127	99.2
WP_006012794.1\|561430_562768_-	hypothetical protein	NA	NA	NA	NA
WP_006012791.1\|563741_569672_+	hypothetical protein	NA	NA	NA	NA
WP_129827246.1\|574506_575550_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_006012424.1\|580016_580928_+	helix-turn-helix domain-containing protein	A0A1B2LRS2	Wolbachia_phage	6.8e-46	37.8
WP_096676677.1\|581394_582267_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

585743 : 660208

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(31.25%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129827248.1\|585743_587063_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_129827258.1\|587049_587289_-	hypothetical protein	NA	NA	NA	NA
WP_145510636.1\|588348_590910_+	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	5.2e-128	35.3
WP_006012006.1\|590937_595599_+	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_006012003.1\|595604_595895_+	hypothetical protein	NA	NA	NA	NA
WP_006012001.1\|595866_597243_+	PleD family two-component system response regulator	G3MA91	Bacillus_virus	2.1e-22	35.8
WP_006011997.1\|597265_597994_-	DNA repair protein RecO	NA	NA	NA	NA
WP_006011994.1\|598190_598739_+	hypothetical protein	NA	NA	NA	NA
WP_006011989.1\|599218_600286_+	hypothetical protein	NA	NA	NA	NA
WP_006011986.1\|600381_600600_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|600786_601875_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827259.1\|601940_602948_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-161	82.6
WP_145510637.1\|602997_603348_-	hypothetical protein	A0A0U4B0A1	Bacillus_phage	5.1e-18	53.6
WP_129827261.1\|604698_605571_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827263.1\|606251_607124_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_039950809.1\|607486_608374_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_006015187.1\|608377_608728_-	ribosome-binding factor A	NA	NA	NA	NA
WP_006015184.1\|608737_611059_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	7.1e-23	25.7
WP_096560606.1\|611066_612620_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_096616077.1\|615291_616380_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006014820.1\|617146_617851_+	hypothetical protein	NA	NA	NA	NA
WP_006014818.1\|617854_618592_-	glutamine synthetase	NA	NA	NA	NA
WP_006014815.1\|618918_620301_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_006014812.1\|620458_621331_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-43	39.9
WP_006014805.1\|621744_622086_+	hypothetical protein	NA	NA	NA	NA
WP_006014802.1\|622126_622651_-\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_006014799.1\|622764_624474_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_006014796.1\|624451_624880_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.2e-14	36.8
WP_006014794.1\|624879_625362_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_096560728.1\|625462_626107_-	hypothetical protein	NA	NA	NA	NA
WP_006014782.1\|626174_626636_-	dUTP diphosphatase	A0A1Q1PNN8	Noumeavirus	2.5e-36	54.8
WP_129827232.1\|627354_628227_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|628813_630085_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006014342.1\|630351_631536_+	hypothetical protein	NA	NA	NA	NA
WP_006014335.1\|631693_632293_+	peroxiredoxin	NA	NA	NA	NA
WP_006014332.1\|632279_633227_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.3e-68	46.5
WP_096616077.1\|633320_634409_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827264.1\|634474_635737_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|636323_637196_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_145510638.1\|637475_639689_-	TonB-dependent receptor	NA	NA	NA	NA
WP_006013682.1\|640888_641374_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|641856_642729_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827241.1\|643315_644587_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827266.1\|644705_645461_+	hypothetical protein	NA	NA	NA	NA
WP_129827246.1\|645873_646917_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_006013418.1\|647325_648747_-	2-polyprenylphenol 6-hydroxylase	A0A0R6PHP6	Moraxella_phage	1.0e-19	24.9
WP_006013415.1\|648743_649475_-	metal ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.2e-05	22.5
WP_039950476.1\|649466_650342_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_006013410.1\|650701_650998_-	hypothetical protein	NA	NA	NA	NA
WP_012481745.1\|651707_651908_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_096560696.1\|652057_653806_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_145510639.1\|653879_655802_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.6e-150	50.2
WP_039950480.1\|655874_656159_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_006013396.1\|656166_657399_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_039950474.1\|657367_658957_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_006013385.1\|659323_660208_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA

DBSCAN-SWA_9

668489 : 895453

173

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(30.77%)

head,protease,integrase,tRNA,transposase

attL 762498:762557|attR 821503:822433

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096616077.1\|668489_669578_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006011971.1\|669927_671253_+	dihydroorotase	NA	NA	NA	NA
WP_096560695.1\|671337_672522_+	ribonuclease D	A0A0M5KJQ5	Mollivirus	6.8e-06	28.9
WP_006013234.1\|672511_673090_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_096676677.1\|673135_674008_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827234.1\|674594_675866_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827233.1\|676463_677735_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827267.1\|678132_678333_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|678670_679543_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827268.1\|680129_681392_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|681713_682802_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006013953.1\|683244_683472_-	hypothetical protein	NA	NA	NA	NA
WP_080589543.1\|683576_683885_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006013958.1\|683881_684871_-	ribonucleotide-diphosphate reductase subunit beta	A0A1B1IW95	uncultured_Mediterranean_phage	2.7e-104	56.1
WP_006013961.1\|685002_685341_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_006013963.1\|685512_685869_+	hypothetical protein	NA	NA	NA	NA
WP_006013965.1\|685986_687516_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.3e-94	40.1
WP_129827231.1\|687784_688084_+\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_129827269.1\|688080_688938_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.7e-52	41.1
WP_006013948.1\|689384_690788_-	2-nitropropane dioxygenase	NA	NA	NA	NA
WP_129827270.1\|691004_692276_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827271.1\|692862_693735_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096616077.1\|694621_695710_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006013657.1\|698366_699125_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.9e-51	43.9
WP_006013653.1\|699128_700100_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_006013649.1\|700251_700611_+	hypothetical protein	NA	NA	NA	NA
WP_006013646.1\|700854_701703_+	hypothetical protein	NA	NA	NA	NA
WP_129827271.1\|702267_703140_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827270.1\|703726_704998_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006013670.1\|705290_705824_+\|head,protease	HK97 family phage prohead protease	Q8W628	Enterobacteria_phage	5.6e-32	45.2
WP_096560733.1\|705925_708088_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|708114_709203_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_096560729.1\|709277_710495_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A2L0UZ92	Agrobacterium_phage	3.2e-51	36.0
WP_007302691.1\|710828_712658_-	translational GTPase TypA	E4ZFJ7	Streptococcus_phage	8.0e-22	40.8
WP_006013690.1\|712879_714214_+\|tRNA	glutamate--tRNA ligase	A0A2K9L0I5	Tupanvirus	1.3e-13	34.9
WP_006013692.1\|714332_715352_-	hypothetical protein	NA	NA	NA	NA
WP_006013694.1\|715357_715540_-	hypothetical protein	NA	NA	NA	NA
WP_006013696.1\|715654_716464_-	metal ABC transporter permease	NA	NA	NA	NA
WP_006013698.1\|716457_716805_-	membrane protein	NA	NA	NA	NA
WP_006013700.1\|716808_717675_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_006013703.1\|717749_721019_+	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	3.2e-13	25.3
WP_096676677.1\|723573_724446_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827232.1\|725034_725907_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013710.1\|726301_727315_-	hypothetical protein	NA	NA	NA	NA
WP_006013713.1\|727322_727670_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_006013719.1\|729803_731102_-	sodium:proton antiporter	NA	NA	NA	NA
WP_006013721.1\|731200_732934_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.5e-62	35.4
WP_006013724.1\|733079_734246_+	multifunctional ribose 5-phosphate isomerase B/3-demethylubiquinone-9 3-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	A0A2K9L4K8	Tupanvirus	3.6e-07	33.9
WP_006013725.1\|734353_735484_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_039950529.1\|735483_736089_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_129827314.1\|736100_736595_-	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|736853_737942_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_039950534.1\|738596_739244_-	transcriptional regulator	NA	NA	NA	NA
WP_006013738.1\|739352_739736_+	molecular chaperone DnaK	NA	NA	NA	NA
WP_006013741.1\|740165_741380_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_129827272.1\|741494_742367_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827268.1\|742953_744216_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|744281_745370_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_096560683.1\|746443_747466_-	UDP-N-acetylmuramate--alanine ligase	NA	NA	NA	NA
WP_039950541.1\|747492_748161_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	8.0e-20	52.8
WP_006013753.1\|748385_749021_-	hypothetical protein	NA	NA	NA	NA
WP_006013756.1\|749182_750340_+	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_006013759.1\|750571_751492_-	hypothetical protein	NA	NA	NA	NA
WP_006013763.1\|751699_752206_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.4e-30	45.9
WP_006013766.1\|752277_752487_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_006013769.1\|752501_753128_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_006013773.1\|753117_753813_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.2e-21	46.5
WP_096560682.1\|755873_757046_+	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_096560603.1\|757735_759007_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|759593_760466_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013790.1\|761485_762271_+	SDR family oxidoreductase	NA	NA	NA	NA
762498:762557	attL	NA	NA	NA	NA
WP_129827232.1\|762513_763386_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013808.1\|764947_766042_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_145510640.1\|767625_768549_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_006013819.1\|768667_770467_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006013822.1\|770741_771479_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-26	35.4
WP_006013840.1\|771619_771787_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_006013842.1\|771913_772570_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_006013843.1\|772665_773322_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_145510641.1\|773314_774709_+\|tRNA	cysteine--tRNA ligase	A0A2K9V966	Bandra_megavirus	5.9e-49	30.4
WP_080589542.1\|774677_775091_+	hypothetical protein	NA	NA	NA	NA
WP_039950557.1\|775121_778058_-	DUF3971 domain-containing protein	NA	NA	NA	NA
WP_006013851.1\|778050_778488_-	ribonuclease HI	J9Q745	Salmonella_phage	3.2e-33	44.8
WP_006013853.1\|778663_779551_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_006013855.1\|779552_781103_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.5e-10	35.0
WP_006013857.1\|781118_781883_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_006013859.1\|782439_783951_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_006013861.1\|784105_784534_-	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_006013863.1\|784599_785580_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_006013868.1\|785779_787210_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_096641426.1\|787202_787880_+	hypothetical protein	NA	NA	NA	NA
WP_006013881.1\|788937_789858_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.4e-14	35.6
WP_006013883.1\|789860_791240_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	8.2e-35	27.4
WP_039950562.1\|791232_792342_-	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_039950565.1\|792665_793958_+	membrane protein	NA	NA	NA	NA
WP_006013892.1\|794075_794723_-	hypothetical protein	NA	NA	NA	NA
WP_006013894.1\|794869_797443_+\|tRNA	valine--tRNA ligase	A0A2K9KZB8	Tupanvirus	7.1e-250	50.7
WP_006013896.1\|797484_799560_+	hypothetical protein	NA	NA	NA	NA
WP_006013899.1\|799697_800864_+	hypothetical protein	NA	NA	NA	NA
WP_006013901.1\|800907_801588_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_096616077.1\|803477_804566_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827268.1\|805539_806802_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|807388_808261_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006013906.1\|808846_809608_+	hypothetical protein	NA	NA	NA	NA
WP_039950580.1\|809843_810638_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_006013910.1\|810634_811393_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-19	33.3
WP_129827273.1\|811461_812166_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_129827315.1\|812257_813304_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.3e-165	80.7
WP_006013920.1\|813803_814982_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_006013922.1\|815009_815504_-	hypothetical protein	NA	NA	NA	NA
WP_129827274.1\|815823_817125_+	hypothetical protein	NA	NA	NA	NA
WP_129827231.1\|817159_817459_+\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_096616077.1\|817695_818784_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827275.1\|818794_820087_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|820673_821546_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827277.1\|821538_822405_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.0e-52	40.7
WP_006013933.1\|822851_824111_+\|tRNA	proline--tRNA ligase	A0A1V0SEQ8	Hokovirus	1.8e-12	22.2
821503:822433	attR	NA	NA	NA	NA
WP_006013935.1\|824107_824482_+	holo-[acyl-carrier-protein] synthase	NA	NA	NA	NA
WP_006013937.1\|824534_825269_-	hypothetical protein	NA	NA	NA	NA
WP_006013939.1\|825334_825724_-	hypothetical protein	NA	NA	NA	NA
WP_006013941.1\|825698_826100_-	hypothetical protein	NA	NA	NA	NA
WP_096560603.1\|826779_828051_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|828637_829510_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_108784648.1\|830367_830871_+	hypothetical protein	NA	NA	NA	NA
WP_129827278.1\|831030_832236_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_129827279.1\|832246_833335_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.3e-172	80.9
WP_006012843.1\|833653_834544_-	hypothetical protein	NA	NA	NA	NA
WP_039950321.1\|835182_836508_+	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_129827280.1\|836900_839141_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|839151_840240_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_017531625.1\|840315_840906_-	septum formation protein Maf	NA	NA	NA	NA
WP_006012837.1\|840902_841139_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_006012835.1\|841241_843179_-	hypothetical protein	NA	NA	NA	NA
WP_006012833.1\|843337_844615_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	1.4e-52	31.6
WP_129827281.1\|844795_846313_+	hypothetical protein	A0A1B2LRR2	Wolbachia_phage	5.2e-83	50.7
WP_096616077.1\|846367_847456_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006012827.1\|847850_848759_-	acetylglutamate kinase	NA	NA	NA	NA
WP_006012825.1\|848763_849357_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_096560709.1\|849470_850562_+	peptide chain release factor 1	NA	NA	NA	NA
WP_129827248.1\|851397_852717_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_006012815.1\|852928_853858_-	permease	NA	NA	NA	NA
WP_129827313.1\|854521_855568_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	5.8e-166	80.7
WP_129827282.1\|855659_855860_-	hypothetical protein	NA	NA	NA	NA
WP_006012806.1\|855876_857037_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_096676677.1\|857804_858677_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827283.1\|859263_860535_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006012786.1\|860821_861448_+	hypothetical protein	NA	NA	NA	NA
WP_006012784.1\|861464_862745_+	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_096560603.1\|863026_864298_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|865592_866681_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827284.1\|866759_866900_+	hypothetical protein	NA	NA	NA	NA
WP_007302667.1\|866987_867545_-	hypothetical protein	NA	NA	NA	NA
WP_039950302.1\|867726_869838_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	4.7e-74	41.6
WP_006012772.1\|869838_870117_-	YggT family protein	NA	NA	NA	NA
WP_129827231.1\|870605_870905_+\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_129827269.1\|870901_871759_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.7e-52	41.1
WP_006012948.1\|871857_872286_-	hypothetical protein	NA	NA	NA	NA
WP_129827269.1\|873206_874064_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.7e-52	41.1
WP_129827285.1\|874060_874360_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.5e-05	31.2
WP_006012758.1\|874635_875649_-	GTPase ObgE	NA	NA	NA	NA
WP_006012755.1\|875636_876905_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	2.7e-133	59.5
WP_006012750.1\|877237_878236_-	murC	NA	NA	NA	NA
WP_039950297.1\|878245_878857_-	SURF1 family protein	NA	NA	NA	NA
WP_006012742.1\|878858_879335_-	bacterioferritin	NA	NA	NA	NA
WP_006012739.1\|879388_879862_-	RDD family protein	NA	NA	NA	NA
WP_006012737.1\|879861_880500_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_145510642.1\|880642_881998_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|883295_884384_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_145510643.1\|885090_886479_-	class II fumarate hydratase	NA	NA	NA	NA
WP_006012720.1\|886670_888077_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006012717.1\|888290_891101_-	hypothetical protein	NA	NA	NA	NA
WP_006012714.1\|891197_894248_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	2.3e-58	26.5
WP_129827279.1\|894364_895453_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.3e-172	80.9

DBSCAN-SWA_10

911841 : 989126

uncultured_virus(15.79%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129827276.1\|911841_912654_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|913240_914512_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006012658.1\|915512_916322_-	hypothetical protein	A0A1B2LRR2	Wolbachia_phage	5.0e-24	41.2
WP_006012656.1\|916441_917632_-	hypothetical protein	NA	NA	NA	NA
WP_006012653.1\|918272_919610_-	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	3.9e-18	36.8
WP_006012651.1\|919915_921073_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006012648.1\|921573_922278_-	ComF family protein	NA	NA	NA	NA
WP_006012645.1\|925467_926793_+	hypothetical protein	NA	NA	NA	NA
WP_006012643.1\|926853_927852_+	pyruvate dehydrogenase complex E1 component subunit beta	A0A0K0KW14	Prochlorococcus_phage	9.2e-12	29.5
WP_006012640.1\|927857_928211_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_006012627.1\|928410_929193_+	signal peptidase I	NA	NA	NA	NA
WP_006012624.1\|929196_930969_-	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	2.9e-85	35.2
WP_006012616.1\|930946_931405_-	molecular chaperone Hsc20	NA	NA	NA	NA
WP_006012614.1\|931397_931784_-	iron-sulfur cluster assembly accessory protein	A0A0P0CQC4	Ostreococcus_lucimarinus_virus	2.2e-14	40.2
WP_006012607.1\|931789_932173_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	3.1e-53	79.8
WP_006012604.1\|932350_933262_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	2.5e-16	38.3
WP_129827232.1\|934133_935006_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560750.1\|935667_936051_-	hypothetical protein	NA	NA	NA	NA
WP_006012580.1\|936179_936977_-	folate-binding protein YgfZ	NA	NA	NA	NA
WP_006012576.1\|937089_937380_+	co-chaperone GroES	A0A221S331	uncultured_virus	1.1e-10	35.1
WP_006012568.1\|937459_939118_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.8e-129	49.3
WP_129827316.1\|939927_940974_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.7e-165	80.5
WP_129827287.1\|941081_942344_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827232.1\|942930_943803_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012557.1\|944115_945459_-	DNA repair protein RadA	NA	NA	NA	NA
WP_006012555.1\|945525_946797_-	MFS transporter	NA	NA	NA	NA
WP_129827288.1\|946871_947111_-	hypothetical protein	NA	NA	NA	NA
WP_006012553.1\|947531_949982_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.7e-102	32.3
WP_096616077.1\|950415_951504_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006012545.1\|952272_954291_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_006012542.1\|954421_955408_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_006012537.1\|955409_956921_-	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_006012534.1\|956937_957723_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_006012531.1\|957715_958396_-	type IV secretion system protein	NA	NA	NA	NA
WP_039950245.1\|958468_959554_-	GTP cyclohydrolase II RibA	A0A2I2L4Y7	Orpheovirus	5.1e-24	38.1
WP_006012524.1\|959853_961089_+	phosphoesterase	NA	NA	NA	NA
WP_006012513.1\|962722_963280_-	dCTP deaminase	S5VM63	Pseudomonas_phage	1.5e-56	62.1
WP_006012510.1\|963351_964809_-	TrkH family potassium uptake protein	NA	NA	NA	NA
WP_096560662.1\|964933_965902_+	hypothetical protein	NA	NA	NA	NA
WP_006012504.1\|966004_967021_-	phosphate ABC transporter substrate-binding protein	A0A1B1IWY0	uncultured_Mediterranean_phage	9.2e-60	40.7
WP_006012501.1\|967214_967772_-	ribosome recycling factor	NA	NA	NA	NA
WP_006012495.1\|968507_969353_-	elongation factor Ts	NA	NA	NA	NA
WP_006012492.1\|969349_970165_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_006012489.1\|970553_970967_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.9e-12	46.9
WP_006012485.1\|970975_972787_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1GV45	Paramecium_bursaria_Chlorella_virus	8.1e-91	36.7
WP_006012482.1\|973411_974158_+	hypothetical protein	NA	NA	NA	NA
WP_006012476.1\|975425_975950_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_007302593.1\|976066_976387_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_145510645.1\|976386_977994_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.9e-147	49.4
WP_006012464.1\|978344_978752_+	nucleoside deaminase	NA	NA	NA	NA
WP_006012461.1\|978987_979419_+	hypothetical protein	NA	NA	NA	NA
WP_006012458.1\|979422_980046_+	heme ABC exporter ATP-binding protein CcmA	NA	NA	NA	NA
WP_006012455.1\|980108_981809_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_006012452.1\|981943_982507_-	hypothetical protein	NA	NA	NA	NA
WP_006012449.1\|982592_982841_-	hypothetical protein	NA	NA	NA	NA
WP_006012446.1\|983062_984760_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	6.9e-52	29.3
WP_006012444.1\|984919_985618_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_051008229.1\|985767_986940_+	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_129827289.1\|987796_988261_-	reverse transcriptase	NA	NA	NA	NA
WP_096676677.1\|988253_989126_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1007384 : 1028451

Wolbachia_phage(70.59%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006012370.1\|1007384_1007714_+	helix-turn-helix transcriptional regulator	A0A1B2LRS2	Wolbachia_phage	3.9e-12	41.7
WP_006012367.1\|1007736_1008099_+	helix-turn-helix transcriptional regulator	A0A1B2LRR8	Wolbachia_phage	3.4e-09	37.9
WP_129827290.1\|1008461_1009082_-	hypothetical protein	NA	NA	NA	NA
WP_096676677.1\|1009502_1010375_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012357.1\|1010670_1012161_-	ankyrin repeat domain-containing protein	F8QZT5	Wolbachia_phage	2.0e-196	89.5
WP_039950216.1\|1012185_1012650_-	hypothetical protein	A0A1B2LRT3	Wolbachia_phage	1.1e-63	87.2
WP_006012353.1\|1012794_1013265_-	hypothetical protein	E9P621	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.1e-63	74.8
WP_006012344.1\|1014144_1014636_+	sigma-70 family RNA polymerase sigma factor	A0A1B2LRS7	Wolbachia_phage	1.6e-30	50.7
WP_006012341.1\|1014687_1015485_+	ATP-binding protein	E9P631	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.7e-125	82.5
WP_006012339.1\|1015508_1015997_+	hypothetical protein	A0A1B2LRU0	Wolbachia_phage	5.0e-56	66.9
WP_006012334.1\|1015993_1017220_+	AAA family ATPase	A0A1B2LRQ9	Wolbachia_phage	1.3e-140	63.0
WP_006012332.1\|1017243_1019298_+	AAA family ATPase	A0A1B2LRQ1	Wolbachia_phage	0.0e+00	76.9
WP_039950207.1\|1019545_1020658_-	hypothetical protein	Q9JMN2	Wolbachia_phage	2.4e-130	61.2
WP_096560645.1\|1020623_1021820_-	hypothetical protein	Q9JMN1	Wolbachia_phage	3.1e-147	62.3
WP_006012324.1\|1022015_1022234_+	hypothetical protein	A0A1B2LRU8	Wolbachia_phage	4.0e-13	52.9
WP_129827292.1\|1022133_1023816_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	1.3e-140	50.3
WP_096616077.1\|1023865_1024954_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006012309.1\|1025269_1026004_+	3-oxoacyl-[acyl-carrier-protein] reductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.6e-11	27.5
WP_006012302.1\|1026099_1026435_+	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_096560629.1\|1026436_1027726_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_006012296.1\|1027797_1028451_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	4.1e-37	43.8

DBSCAN-SWA_12

1054862 : 1122812

Staphylococcus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129827232.1\|1054862_1055735_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012187.1\|1056225_1056528_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_006012184.1\|1056538_1056808_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_145510646.1\|1056932_1058096_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.0e-91	48.7
WP_096560655.1\|1058198_1058864_+	TenA family transcriptional regulator	NA	NA	NA	NA
WP_006012167.1\|1058903_1059563_+	TenA family transcriptional regulator	NA	NA	NA	NA
WP_006012165.1\|1059610_1060438_+	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_006012163.1\|1060438_1060927_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_006012162.1\|1060952_1061420_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_006012160.1\|1061485_1063270_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0K1LMZ5	Caulobacter_phage	6.1e-200	58.9
WP_039950199.1\|1063318_1064389_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_129827232.1\|1068369_1069242_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827234.1\|1069828_1071100_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006012150.1\|1071911_1072121_-	hypothetical protein	NA	NA	NA	NA
WP_080589533.1\|1072194_1072572_-	ribonuclease P protein component	NA	NA	NA	NA
WP_006012144.1\|1072555_1072690_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_006012141.1\|1072797_1073886_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_145510647.1\|1073973_1075419_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_006012135.1\|1075424_1075766_+	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|1076550_1077423_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|1078009_1079281_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006012123.1\|1079844_1080315_-	P44/Msp2 family outer membrane protein	NA	NA	NA	NA
WP_006012113.1\|1081171_1082407_-	NTP transferase domain-containing protein	A0A0N7G7P8	Chrysochromulina_ericina_virus	1.4e-17	29.8
WP_006012109.1\|1082407_1083451_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	4.9e-32	36.4
WP_039950189.1\|1084321_1086289_+	hypothetical protein	NA	NA	NA	NA
WP_006012104.1\|1086329_1086926_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	6.0e-27	35.6
WP_006012102.1\|1086983_1087571_+	CvpA family protein	NA	NA	NA	NA
WP_039950186.1\|1087702_1089061_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.5e-41	29.6
WP_096560605.1\|1089157_1091167_+	hypothetical protein	NA	NA	NA	NA
WP_006012089.1\|1091357_1092950_+	hypothetical protein	NA	NA	NA	NA
WP_006012088.1\|1093178_1093886_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_006012085.1\|1093885_1094713_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_006012082.1\|1094705_1095662_-	hypothetical protein	NA	NA	NA	NA
WP_129827294.1\|1096612_1097884_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|1098470_1099343_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012066.1\|1099375_1101904_-	DNA polymerase I	A0A142F1Q9	Bacillus_phage	6.9e-56	36.5
WP_006012063.1\|1102007_1103474_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_129827295.1\|1106399_1107272_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012047.1\|1108557_1109424_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006012044.1\|1109658_1110342_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_006012041.1\|1110338_1111124_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_006012038.1\|1111132_1112467_+	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_006012035.1\|1112469_1113936_+	amino acid carrier protein	NA	NA	NA	NA
WP_006012032.1\|1114173_1114749_+	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_006012029.1\|1114743_1116555_-	hypothetical protein	NA	NA	NA	NA
WP_096560705.1\|1116610_1117507_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_096641494.1\|1118162_1121648_+	peptidase M2	NA	NA	NA	NA
WP_096616077.1\|1121723_1122812_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2

DBSCAN-SWA_13

1126260 : 1271219

115

Wolbachia_phage(27.03%)

tail,protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006015767.1\|1126260_1128369_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_006015765.1\|1128372_1129212_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_006015763.1\|1129256_1130015_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|1130154_1131027_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827231.1\|1131706_1132006_+\|transposase	transposase	A9YX41	Burkholderia_phage	1.5e-05	32.3
WP_129827296.1\|1132002_1132860_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.6e-52	41.1
WP_096560711.1\|1132882_1133902_-	porphobilinogen synthase	NA	NA	NA	NA
WP_039950909.1\|1133894_1134920_-	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_006015761.1\|1134903_1136952_-	NADH-quinone oxidoreductase subunit G	NA	NA	NA	NA
WP_006015760.1\|1136957_1137170_-	hypothetical protein	NA	NA	NA	NA
WP_051008240.1\|1137387_1138884_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.7e-54	38.2
WP_039950913.1\|1138980_1139622_-	dioxygenase	NA	NA	NA	NA
WP_145510648.1\|1139788_1142929_-	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_145510649.1\|1143056_1145660_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_006015752.1\|1145666_1146170_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_006015750.1\|1146333_1146993_+	Tim44 domain-containing protein	NA	NA	NA	NA
WP_006015748.1\|1147007_1147712_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	3.6e-39	38.7
WP_006015746.1\|1147747_1148347_+	SCO family protein	NA	NA	NA	NA
WP_129827234.1\|1149253_1150525_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|1151111_1151984_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_039950902.1\|1152400_1153093_-	ribonuclease III	A0A0P0YNG1	Yellowstone_lake_phycodnavirus	1.7e-28	35.2
WP_006015737.1\|1153185_1154253_-	quinone-dependent dihydroorotate dehydrogenase	A0A1V0SH91	Hokovirus	8.6e-16	25.2
WP_006015735.1\|1154324_1155122_-	hypothetical protein	NA	NA	NA	NA
WP_006015733.1\|1155307_1156198_-	class I fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_006015731.1\|1156256_1157255_-	hypothetical protein	NA	NA	NA	NA
WP_006015729.1\|1157311_1159591_-	AAA domain-containing protein	A0A223W0B1	Agrobacterium_phage	9.4e-145	39.5
WP_006015727.1\|1159888_1161115_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.5e-52	31.9
WP_006015726.1\|1161149_1161401_-	cold-shock protein	NA	NA	NA	NA
WP_006015725.1\|1161576_1162911_-	TldD/PmbA family protein	NA	NA	NA	NA
WP_006015724.1\|1162929_1163802_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_006015723.1\|1163968_1165189_-	hypothetical protein	NA	NA	NA	NA
WP_006015721.1\|1165185_1165917_-	hypothetical protein	NA	NA	NA	NA
WP_096560694.1\|1165909_1167139_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_129827232.1\|1167540_1168413_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006015704.1\|1169328_1170567_-	hypothetical protein	NA	NA	NA	NA
WP_006015702.1\|1170643_1171009_-	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_006015700.1\|1171005_1171383_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_039950891.1\|1173141_1173759_+	hypothetical protein	NA	NA	NA	NA
WP_006015696.1\|1174236_1174437_-	hypothetical protein	NA	NA	NA	NA
WP_096560652.1\|1176221_1178105_-	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	3.0e-32	37.2
WP_039950889.1\|1178244_1178547_-	cation:proton antiporter subunit C	NA	NA	NA	NA
WP_006015683.1\|1178546_1178963_-	Na(+)/H(+) antiporter subunit B	NA	NA	NA	NA
WP_006015680.1\|1178955_1179483_-	DUF4040 domain-containing protein	NA	NA	NA	NA
WP_006015677.1\|1179494_1179767_-	cation:proton antiporter	NA	NA	NA	NA
WP_039950888.1\|1179773_1180019_-	multiple resistance and pH regulation protein F (MrpF / PhaF) superfamily	NA	NA	NA	NA
WP_006015671.1\|1180047_1180440_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_006015668.1\|1180500_1180797_-	XRE family transcriptional regulator	A0A0D5BHH6	Escherichia_phage	2.4e-08	36.2
WP_006015665.1\|1181655_1182156_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.5e-20	42.4
WP_096560651.1\|1182155_1183985_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.9e-252	75.3
WP_039950896.1\|1183989_1184259_+	hypothetical protein	NA	NA	NA	NA
WP_006015657.1\|1184391_1185417_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_006015654.1\|1185419_1186292_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_096560650.1\|1186295_1187759_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	7.1e-21	27.2
WP_006015648.1\|1188080_1192265_+	collagen-like protein	NA	NA	NA	NA
WP_006015645.1\|1192269_1193595_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|1193739_1194828_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_096616077.1\|1195786_1196875_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_145510650.1\|1197249_1197747_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_145510651.1\|1197799_1198744_-\|tail	phage tail protein	A0A1B2LRT8	Wolbachia_phage	1.0e-137	77.0
WP_006015620.1\|1198744_1198954_-\|tail	tail protein	A0A1B2LRT9	Wolbachia_phage	1.1e-23	72.5
WP_039950887.1\|1198950_1199298_-\|tail	phage tail protein	A0A1B2LRV9	Wolbachia_phage	1.4e-44	74.6
WP_145510652.1\|1199297_1201562_-\|tail	phage tail tape measure protein	E9P5Y8	Wolbachia_endosymbiont_wVitA_of_Nasonia_vitripennis_phage	2.3e-220	62.4
WP_145510653.1\|1201671_1201929_-\|tail	phage tail assembly protein	A0A1B2LRV6	Wolbachia_phage	8.0e-37	94.1
WP_145510654.1\|1202060_1202984_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	6.2e-148	94.8
WP_145510655.1\|1203079_1203586_-\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	1.5e-90	97.6
WP_145510656.1\|1207660_1207846_-	hypothetical protein	A0A1B2LRW5	Wolbachia_phage	1.3e-17	70.3
WP_145510657.1\|1207848_1209030_-	hypothetical protein	A0A1B2LRR4	Wolbachia_phage	2.0e-199	87.2
WP_096616077.1\|1210734_1211823_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827297.1\|1211872_1212604_-	triosephosphate isomerase	NA	NA	NA	NA
WP_006015557.1\|1212778_1213573_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_006015555.1\|1213696_1215184_+	IMP dehydrogenase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.3e-41	40.2
WP_145510658.1\|1215449_1216868_-	transcription termination factor Rho	NA	NA	NA	NA
WP_006015546.1\|1217062_1217665_-	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_006015543.1\|1217898_1219698_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_006015540.1\|1219832_1220147_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_006015537.1\|1220157_1221144_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_006015534.1\|1221206_1221767_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_096560685.1\|1221782_1222781_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_096616077.1\|1222945_1224034_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827285.1\|1226131_1226431_+\|transposase	transposase	A9YX41	Burkholderia_phage	2.5e-05	31.2
WP_129827296.1\|1226427_1227285_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.6e-52	41.1
WP_006015517.1\|1227616_1230319_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_096616077.1\|1231213_1232302_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006015498.1\|1232383_1232749_-	hypothetical protein	NA	NA	NA	NA
WP_006015496.1\|1232882_1233110_-	hypothetical protein	NA	NA	NA	NA
WP_006015493.1\|1233137_1233572_-	hypothetical protein	NA	NA	NA	NA
WP_006015490.1\|1233782_1234523_-	DsbA family protein	NA	NA	NA	NA
WP_006015487.1\|1234862_1236746_+	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_006015485.1\|1236793_1238281_+	UbiD family decarboxylase	NA	NA	NA	NA
WP_006015482.1\|1238321_1238849_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	2.3e-46	60.3
WP_129827317.1\|1240093_1241140_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	7.5e-166	81.0
WP_129827298.1\|1241723_1242917_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_006015468.1\|1243152_1243944_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_006015465.1\|1243950_1244400_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	3.5e-27	47.1
WP_006015458.1\|1245503_1246025_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_006015456.1\|1246017_1246434_-	hypothetical protein	NA	NA	NA	NA
WP_006015454.1\|1246700_1247267_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.8e-36	42.9
WP_039950872.1\|1247260_1248583_-	insulinase family protein	NA	NA	NA	NA
WP_006015450.1\|1248569_1249901_-	insulinase family protein	NA	NA	NA	NA
WP_006015448.1\|1249905_1250382_-	signal peptidase II	NA	NA	NA	NA
WP_006015446.1\|1250378_1251311_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_006015443.1\|1251381_1251753_+	glutaredoxin	NA	NA	NA	NA
WP_006015439.1\|1251848_1252721_+	hypothetical protein	NA	NA	NA	NA
WP_006015434.1\|1252961_1254758_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	8.2e-19	40.7
WP_006015428.1\|1255946_1257323_-	malonyl-CoA decarboxylase	NA	NA	NA	NA
WP_006015425.1\|1257605_1258298_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.7e-26	33.8
WP_006015419.1\|1258518_1260081_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.3e-07	25.5
WP_006015416.1\|1260308_1261769_-	secretion system protein	NA	NA	NA	NA
WP_129827248.1\|1262462_1263782_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_096676677.1\|1264128_1265001_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|1265587_1266859_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_006015382.1\|1268081_1268792_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_006015380.1\|1268934_1269753_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_006015378.1\|1269822_1269951_+	50S ribosomal protein L36	NA	NA	NA	NA
WP_096676677.1\|1270346_1271219_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1274898 : 1355954

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(40.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145510659.1\|1274898_1275987_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	5.1e-173	81.5
WP_006013054.1\|1276349_1276598_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|1277230_1278103_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|1278689_1279961_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_039950853.1\|1280432_1280594_+	hypothetical protein	NA	NA	NA	NA
WP_006015355.1\|1280668_1281895_+\|tRNA	tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB	NA	NA	NA	NA
WP_006015353.1\|1281954_1282914_+	P44/Msp2 family outer membrane protein	NA	NA	NA	NA
WP_129827233.1\|1283180_1284452_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|1285796_1286885_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827300.1\|1287091_1287286_-	hypothetical protein	NA	NA	NA	NA
WP_006015341.1\|1287428_1288934_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_006015339.1\|1289006_1289381_-	hypothetical protein	NA	NA	NA	NA
WP_006015337.1\|1289499_1290378_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_096560746.1\|1290368_1291253_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_006015333.1\|1291320_1292505_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_006015331.1\|1292501_1293092_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_096616077.1\|1294096_1295185_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006015319.1\|1295811_1297767_+	NAD-dependent DNA ligase LigA	A0A1W6DX16	Sphingobium_phage	6.4e-102	37.6
WP_129827301.1\|1298023_1298965_-	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|1298985_1300074_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_145510660.1\|1300804_1301800_+	hypothetical protein	NA	NA	NA	NA
WP_096616077.1\|1301849_1302938_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_039950839.1\|1303220_1303979_-	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_006015304.1\|1303959_1304913_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_006015300.1\|1305476_1305743_+	hypothetical protein	NA	NA	NA	NA
WP_039950835.1\|1305772_1306150_-	ferredoxin family protein	NA	NA	NA	NA
WP_006015295.1\|1306211_1307297_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.6e-30	35.2
WP_096616077.1\|1308455_1309544_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_145510661.1\|1309521_1309824_+	hypothetical protein	NA	NA	NA	NA
WP_006015279.1\|1309954_1312606_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_006015276.1\|1312831_1313905_+	hypothetical protein	NA	NA	NA	NA
WP_006015273.1\|1314074_1314878_+	hypothetical protein	NA	NA	NA	NA
WP_039950829.1\|1314978_1316139_+	porin	NA	NA	NA	NA
WP_006015267.1\|1316402_1317743_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_096560716.1\|1317775_1318882_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	7.0e-45	37.4
WP_096560717.1\|1319533_1320226_+	DNA repair protein RadC	A0A1B2LRS6	Wolbachia_phage	4.4e-45	41.8
WP_006015253.1\|1321412_1322654_-	hypothetical protein	NA	NA	NA	NA
WP_006015251.1\|1322800_1324891_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_006015248.1\|1324941_1327275_-	ankyrin repeat domain-containing protein	Q9JML0	Wolbachia_phage	2.8e-67	36.2
WP_006015245.1\|1327388_1329872_+	DNA mismatch repair protein MutS	A0A2H4UUR2	Bodo_saltans_virus	8.6e-35	21.6
WP_129827233.1\|1330383_1331655_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|1332449_1333322_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_129827234.1\|1333908_1335180_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827304.1\|1335230_1335509_-	hypothetical protein	NA	NA	NA	NA
WP_006012858.1\|1335989_1337360_-	magnesium transporter	NA	NA	NA	NA
WP_096560601.1\|1337514_1338615_+	peptide chain release factor 2	NA	NA	NA	NA
WP_039950324.1\|1338790_1340044_-	sodium:proton antiporter	NA	NA	NA	NA
WP_006012864.1\|1340239_1342537_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_006012865.1\|1342656_1343580_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_006012867.1\|1343587_1344850_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.7e-34	26.1
WP_096560736.1\|1345027_1345162_+	hypothetical protein	A0A1U9WQS3	Geobacillus_phage	9.3e-05	64.7
WP_129827263.1\|1345158_1346031_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|1346377_1347649_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096676677.1\|1348235_1349108_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096641534.1\|1349100_1349625_+	hypothetical protein	NA	NA	NA	NA
WP_145510662.1\|1349689_1351498_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	4.2e-07	23.8
WP_096676677.1\|1352004_1352877_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096560603.1\|1353463_1354735_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_129827263.1\|1355081_1355954_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1367790 : 1446401

Wolbachia_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096676677.1\|1367790_1368663_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006012884.1\|1369458_1369764_+	hypothetical protein	Q9JMM1	Wolbachia_phage	9.2e-40	76.2
WP_129827249.1\|1369864_1370737_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_136122018.1\|1370952_1372896_-	hypothetical protein	Q9JML0	Wolbachia_phage	7.2e-287	84.8
WP_129827246.1\|1386496_1387540_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_145510663.1\|1387760_1388660_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	8.1e-84	61.6
WP_006014015.1\|1388788_1389718_+	helix-turn-helix domain-containing protein	A0A1B2LRR8	Wolbachia_phage	6.2e-79	57.3
WP_006014017.1\|1389889_1390546_+	DNA repair protein RadC	A0A1B2LRS6	Wolbachia_phage	7.0e-69	60.5
WP_006014019.1\|1390644_1391832_+	hypothetical protein	A0A1B2LRQ6	Wolbachia_phage	1.0e-171	82.7
WP_006014021.1\|1391928_1392843_+	helix-turn-helix transcriptional regulator	E9P5Z7	Wolbachia_endosymbiont_wVitA_of_Nasonia_vitripennis_phage	1.3e-84	58.9
WP_006014023.1\|1392868_1393780_+	helix-turn-helix transcriptional regulator	A0A1B2LRR7	Wolbachia_phage	1.5e-85	58.4
WP_129827306.1\|1393875_1394790_-	patatin	A0A1B2LRS3	Wolbachia_phage	1.5e-133	77.9
WP_006013123.1\|1394735_1395302_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	4.6e-85	94.7
WP_096616077.1\|1395390_1396479_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_129827307.1\|1396494_1397457_-	hypothetical protein	NA	NA	NA	NA
WP_006014035.1\|1398125_1399379_+	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_006014037.1\|1399401_1399920_-	translation initiation factor IF-3	A0A2I7S9Q1	Vibrio_phage	1.4e-11	34.4
WP_006014039.1\|1399932_1401834_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	9.9e-132	39.9
WP_006014041.1\|1401830_1402013_-	hypothetical protein	NA	NA	NA	NA
WP_039950622.1\|1402019_1402502_-	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_006014044.1\|1402693_1404022_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_006014046.1\|1404325_1405336_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	3.0e-18	29.0
WP_096676677.1\|1406112_1406985_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_006014054.1\|1407550_1408531_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_006014056.1\|1408536_1409130_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	1.1e-25	38.5
WP_006014058.1\|1409137_1409923_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_125855783.1\|1410461_1410827_-	hypothetical protein	NA	NA	NA	NA
WP_012481935.1\|1410811_1411087_-	hypothetical protein	NA	NA	NA	NA
WP_006014063.1\|1411224_1412262_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.1e-59	43.3
WP_006014065.1\|1412258_1412981_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	7.0e-38	38.5
WP_006014067.1\|1413055_1413754_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_006014069.1\|1413750_1414128_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_006014071.1\|1414381_1415632_+	DUF3333 domain-containing protein	NA	NA	NA	NA
WP_006014073.1\|1415628_1416426_+	phosphoribosylformylglycinamidine synthase subunit PurQ	A9YX36	Burkholderia_phage	1.2e-22	32.0
WP_096616077.1\|1416495_1417584_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006014087.1\|1417742_1418336_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_006014085.1\|1418351_1419167_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.1e-28	34.5
WP_039950626.1\|1419184_1419412_-	hypothetical protein	NA	NA	NA	NA
WP_129827232.1\|1419879_1420752_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096676677.1\|1421938_1422811_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_039950628.1\|1422850_1423402_-	hypothetical protein	NA	NA	NA	NA
WP_006014095.1\|1423793_1424813_+	Mrp/NBP35 family ATP-binding protein	NA	NA	NA	NA
WP_129827318.1\|1425100_1425202_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_129827234.1\|1426175_1427447_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096616077.1\|1428426_1429515_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-172	81.2
WP_006014110.1\|1430586_1431042_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_006014112.1\|1431044_1431350_-	NADH:ubiquinone oxidoreductase	NA	NA	NA	NA
WP_006014114.1\|1431414_1432863_+	cation:proton antiporter	NA	NA	NA	NA
WP_006014116.1\|1432908_1434012_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_145510664.1\|1434060_1435308_-	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	2.5e-35	38.3
WP_129827246.1\|1436149_1437193_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.1e-168	82.4
WP_006013990.1\|1437509_1438496_-	helix-turn-helix transcriptional regulator	A0A1B2LRR7	Wolbachia_phage	1.1e-174	97.0
WP_006013992.1\|1438542_1439451_-	helix-turn-helix domain-containing protein	A0A1B2LRS2	Wolbachia_phage	3.2e-157	97.0
WP_129827233.1\|1439568_1440840_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_051008237.1\|1441412_1442540_-	hypothetical protein	A0A1B2LRQ6	Wolbachia_phage	4.9e-179	93.1
WP_006014130.1\|1442770_1443436_-	DNA repair protein RadC	A0A1B2LRS6	Wolbachia_phage	4.8e-118	99.1
WP_006014132.1\|1443606_1444545_-	helix-turn-helix domain-containing protein	A0A1B2LRR8	Wolbachia_phage	4.1e-163	99.7
WP_006014134.1\|1444613_1446401_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	0.0e+00	99.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041923

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection