CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP010589	Phaeobacter gallaeciensis strain P11 plasmid pP11_a, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010588	Phaeobacter gallaeciensis strain P11 chromosome, complete genome	1 crisprs	csa3,WYL,casR,DEDDh,cas3	2	1	6	1
NZ_CP010592	Phaeobacter gallaeciensis strain P11 plasmid pP11_d, complete sequence	0 crisprs	csa3	0	0	0	0
NZ_CP010593	Phaeobacter gallaeciensis strain P11 plasmid pP11_e, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010590	Phaeobacter gallaeciensis strain P11 plasmid pP11_b, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010591	Phaeobacter gallaeciensis strain P11 plasmid pP11_c, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010594	Phaeobacter gallaeciensis strain P11 plasmid pP11_f, complete sequence	0 crisprs	NA	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010588_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010588_1

2303494-2303666

Orphan

Consensus_repeat	Method
GCCGCACGGGACGCCGCATGGGCCGCCGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP010588_1

>merge|NZ_CP010588|1|2303494-2303666|CRISPRCasFinder
GACGCCACCGAAGCAGAACGGGCCGCCGCACGGGACGCCGCACGGGACGCCGCACGGGCCGCCGCACGGGACGCCGCATGGGCCGCCGCCGGAGCTGCCGCACGGGACGCCGCATGGGCCGCCGCCGGAGCTGCCACACGGGACGCCGCACGGGACGCCGCACGGGCCGCCGC

>NZ_CP010588|1|1|2303494-2303666|CRISPRCasFinder
GACGCCACCGAAGCAGAACGGGCCGCCGC	ACGGGACGCCGCACGGGAC
GCCGCACGGGCCGCCGCACGGGACGCCGC	ATGGGCCGCCGCCGGAGCT
GCCGCACGGGACGCCGCATGGGCCGCCGC	CGGAGCTGCCACACGGGAC
GCCGCACGGGACGCCGCACGGGCCGCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010588.1\|WP_024097685.1\|2299739_2300036_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_043939785.1\|2305271_2305478_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097698.1\|2304969_2305272_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_040104145.1\|2302836_2303142_+\|DUF1364-domain-containing-protein	unknown	unknown	gnl\|CDD\|377777
NZ_CP010588.1\|WP_024097701.1\|2306440_2306914_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
NZ_CP010588.1\|WP_024097694.1\|2303737_2304055_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097704.1\|2311418_2311835_+\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP010588.1\|WP_024097688.1\|2301116_2301821_+\|3'-5'-exonuclease	unknown	unknown	gnl\|CDD\|99825
NZ_CP010588.1\|WP_040104147.1\|2307082_2310526_+\|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA	unknown	unknown	gnl\|CDD\|237018
NZ_CP010588.1\|WP_024097691.1\|2302312_2302768_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097690.1\|2302008_2302299_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097689.1\|2301820_2302009_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_102892809.1\|2304051_2304294_+\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP010588.1\|WP_024097686.1\|2300032_2300362_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097700.1\|2305738_2306371_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP010588.1\|WP_024097683.1\|2298899_2299184_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097687.1\|2300458_2301127_+\|ERF-family-protein	unknown	unknown	gnl\|CDD\|377346
NZ_CP010588.1\|WP_024097684.1\|2299389_2299734_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010588.1\|WP_024097703.1\|2310589_2311378_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|223777
NZ_CP010588.1\|WP_024097696.1\|2304290_2304755_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010588.1\|WP_024097703.1\|2310589_2311378_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|223777	COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism].	2.15402e-42
NZ_CP010588.1\|WP_102892809.1\|2304051_2304294_+\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	0.00237169
NZ_CP010588.1\|WP_024097701.1\|2306440_2306914_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	5.1118e-44
NZ_CP010588.1\|WP_024097700.1\|2305738_2306371_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	8.56322e-12
NZ_CP010588.1\|WP_024097704.1\|2311418_2311835_+\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	2.17418e-20
NZ_CP010588.1\|WP_024097687.1\|2300458_2301127_+\|ERF-family-protein	gnl\|CDD\|377346	pfam04404, ERF, ERF superfamily. The DNA single-strand annealing proteins (SSAPs), such as RecT, Red-beta, ERF and Rad52, function in RecA-dependent and RecA-independent DNA recombination pathways. This family includes proteins related to ERF.	1.43415e-22
NZ_CP010588.1\|WP_040104145.1\|2302836_2303142_+\|DUF1364-domain-containing-protein	gnl\|CDD\|377777	pfam07102, DUF1364, Protein of unknown function (DUF1364). This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.	3.62655e-36
NZ_CP010588.1\|WP_024097688.1\|2301116_2301821_+\|3'-5'-exonuclease	gnl\|CDD\|99825	cd05782, DNA_polB_like1_exo, Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.	3.55352e-56
NZ_CP010588.1\|WP_040104147.1\|2307082_2310526_+\|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA	gnl\|CDD\|237018	PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0

>NZ_CP010588.1|WP_040104145.1|2302836_2303142_+|DUF1364-domain-containing-protein
MKASGPKTTKLRTAAKGQPCTLRLPCCNSNPETTSLSHIRAFGWAGTAEKPMDFLAVFACSDCHDALDRRRNGELWGWDDVTRALGETLIAQHRMGNLIVA
>NZ_CP010588.1|WP_024097691.1|2302312_2302768_+|hypothetical-protein
MATRVLNSKEGIGPLADFLGARDKFPLTITITKGAARRGRQNRLAQRWFTDVSRQKEDETHEEVRAYCKLHFGVPILRAENEAFRQSYDRTMRPLDYETKLAAMKNLDIPVTRLMTVKQMTAFMDEMQRHWSGLGFRLTDPEALKYEEEFA
>NZ_CP010588.1|WP_024097690.1|2302008_2302299_+|hypothetical-protein
MGRYELPVNYDRLHWMERREVREQYAQEQGGKCQHCGADLAGQPAKRILRKRINWGLFPKNFRKYPVHLHHSHETGMTIGAVHNYCNAVLWQYHGE
>NZ_CP010588.1|WP_024097689.1|2301820_2302009_+|hypothetical-protein
MATPKQIRKTYEQVEDEARRLVSFLCEDTVQTCLEETATRTGESLEQVKEVMAAEWSMAGSG
>NZ_CP010588.1|WP_024097688.1|2301116_2301821_+|3'-5'-exonuclease
MPLDMSIIQEAYAAQRFVYFDIETIPCQDESYLHDLERKVKPPANLKKPESIEKWLAENRKSAAIDALAKTSFDGGRGRVCTIAWAKNDSPISVRHAKTTADERDILADFFADLDPYHSETLVGHNIAGFDIGFLRKRAVYLGVRMPAPNSFPRDPKPWDRSIVDTMTAWAGGTGWISMDELCQILGIQGKDGFDGSQVAAAWAAGEHDKIAEYCRDDVHRTREIHKRFLQAGF
>NZ_CP010588.1|WP_024097687.1|2300458_2301127_+|ERF-family-protein
MTKHEAIPALDTAVGHKSIASALSAAQMEMGKALKQANNPHFRSKYADLGNVMDACLPALNKNGIAVVQPTTDDDTGRYVKTILIHGETGETLECRVPLIVSKNDMQGYGSAVTYARRYGLMAMAGIAPEDDDGNAAAKAAPQVQTVSAGQYTKLRDLAQAAGVTEQDICAKVGAPSLEQFPANRFDAVAKGLQSKIDAANPSPAEQITGDEIPHKEPPHAP
>NZ_CP010588.1|WP_024097686.1|2300032_2300362_+|hypothetical-protein
MNSACNVHRIGKTIEKLRTDYAAASTPAGPLPPDHSREPRRGLDTGNPGCVADACETLNSEADQERFRESLSDAFIWGVWFLAFLCAAGAYLAAGPILRLIAWMAGAAI
>NZ_CP010588.1|WP_024097685.1|2299739_2300036_+|hypothetical-protein
MTIHPIHVIPSDDGIYKTIGGDLDVTAPLGTGFSDISSLSDAVRNCFEDAHPALPDLIIKLFETEAAAMEKKAKGEITQFHKAQGLRFAAKTIAQSTP
>NZ_CP010588.1|WP_024097684.1|2299389_2299734_+|hypothetical-protein
MQDRVFKTIYLGDDIECMAQVFFTTDYDAPDASVGCAGGHGVYASIADAVVEDVLHSRDELAEIFGKADVTRAEQIIEAQLTEALNDGESIIDDDGAEFDPADYAAPIHQIAAE
>NZ_CP010588.1|WP_024097683.1|2298899_2299184_+|hypothetical-protein
MNSTVSDLADYKKTLKSSGGGGTYDPMEVRVAKLEAELHSIDRRLDGIDRRLDRIEDKIPSKWDMAQVIFYVVGALMAAAIFGPRLLGLISAAT
>NZ_CP010588.1|WP_024097694.1|2303737_2304055_+|hypothetical-protein
MTDAGKEAVAGGDRLTQIEQLMLCVESDLSEPCLDTLWEETKRLLSENETLRAQLQAGRADYGCPDDETALNYIESTYGDDMRCAVSCMFDAIRALKSTSTEGEG
>NZ_CP010588.1|WP_102892809.1|2304051_2304294_+|DUF551-domain-containing-protein
MMDWQPIETAPKDGTEILAVYVPSGKFSPDFSIVEWDGKSWVGKCDGYRSIEAQSDFHTNYHEPFLTHWMPLPEPPKDPQ
>NZ_CP010588.1|WP_024097696.1|2304290_2304755_+|hypothetical-protein
MTDLIKAADALAECQDAKDLLAACKVDLEKAVVGRTAQSQLMTIHRVLGYVEENLSVIHHTLTTYRQARESADGVKVKPLVWSEDEEHAMGYRENSLTLIGPYWVEDHENSGEWRTYFDSFAGDVFISGSDSEEDAKAAAQADYEARIKAALED
>NZ_CP010588.1|WP_024097698.1|2304969_2305272_+|hypothetical-protein
MELPDRIWVYCNGGEHGDWGVTDDPENAKFGDIEYIQFPRFYELLNEIEVNRSRHYEDCLELLRKAEKRRSEALRIMAFAGALIITAGIIFALDIMIGGT
>NZ_CP010588.1|WP_043939785.1|2305271_2305478_+|hypothetical-protein
MADQIITDEVKYVTATQAINSPRWPFGRDKFYRMVQRGKITPSIPFEGSRKVYSVAQIDGLFQAPSEQ
>NZ_CP010588.1|WP_024097700.1|2305738_2306371_-|tetratricopeptide-repeat-protein
MRQFWIAPILGFGFATAASLAQAEGAGLPPPSGDIASCPAAPDHQGAVDQLIGRVQAARDEASAQQISNQFWQYWADAPNAQAQALLDRGMTRRSAFDFLGALEAFDRLVAYCPEYAEGYNQRAFVHYLRRDFAAALTDLDRALALSPRHVAAMSGRALSLYGLSRLGEARVALEQALSLNPWLPERHLVAPGGPLAPEGADPTTPEVEL
>NZ_CP010588.1|WP_024097701.1|2306440_2306914_-|Lrp/AsnC-family-transcriptional-regulator
MQMDFPGMDRFDQAILVALGEDGRMSIADLARRIGLSKTPTQARLRRLEAEGIITGYRALIDPIRLGLDHVAFVEVKLTDTREAALAKFNAALARVPEIEQAHLMASHFDYLLKVRTRSMSAYRAVLGEKISALPHVASTSTYVAMQAVIEDSALLP
>NZ_CP010588.1|WP_040104147.1|2307082_2310526_+|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA
MPSAPTPAHSNALRYRIDAGTYADQAQMRDQLFALANLDATDRSTISANAAALVRDIRGHSSPGLMEVFLAEYGLSTDEGVALMCLAEALLRVPDADTIDALIEDKIAPSEWGKHLGKSTSSLVNASTWALMLTGKVLDEKRSPVSALRGAIKRLGEPVIRTAVSRAMKEMGRQFVLGETIESAMKRAASMEAKGYTYSYDMLGEAARTEADAARYHLAYSRAISAIAAACNSEDIRQNPGISVKLSALHPRYELAQETRVMEELVPRLQALALLAKAAGMGLNVDAEEADRLSLSLEVIEEVISDPALAGWDGFGVVVQAYGPRTRAALDALYDMADRYDRRLMVRLVKGAYWDTEVKRAQVEGVDGFPVYTHKSLTDVSYIANARKLLSMTDRIYPQFATHNAHTVSAILHMAKETDNGAYEFQRLHGMGETLHQMVLEQNRTHCRIYAPVGAHRDLLAYLVRRLLENGANSSFVNQIVDETVPPEVVAADPFAQVEDLTANLRKGPDLFQPERPNSMGFDLGHAPTLAAIDAARTPWKSNNWTAEPLLAEAPATTTTTDEPVRNPADLTTVGHVKTAGEAEIDAALSAATPWNAGAETRAEILNRAADLYEKNYGELFALLTREAGKSLPDCVAELREAVDFLRYYAARIPAEPPVGVFTCISPWNFPLAIFSGQIAAALAVGNAVLAKPAEQTPLIAHRAISLLHEAGVPRSALQLLPGGGSVGGALTSDARVGGVAFTGSTATALKIRAAMAEHLRPGAPLIAETGGLNAMIVDSTALPEQAVQSVIESAFQSAGQRCSALRCLYLQDDIADNVLKMLKGAMDALRLGDPWNLSTDSGPVIDETARKGILAHIDTARAEGRVLKEMTAPQGGTFVAPTLIEITGIQALEQEIFGPVLHVVRFKSQDLDQIISDINATGYGLTFGLHTRIDDRVQYICDRIHAGNLYVNRNQIGAIVGSQPFGGEGLSGTGPKAGGPFYMARFCAPDRQSAATDWPSETAPMTSLPAPTGQPMQEVTTSLPGPTGESNRLSQLSRPPLLCLGPGPEAVAAQARAVHALGGTAIEATGPLDMAFLQTMVDTGGVIWWGDEPTAREIEHQLAKHDGPILPLIPGLPDIARVQAERHVCVDTTAAGGNAALLGGMS
>NZ_CP010588.1|WP_024097703.1|2310589_2311378_+|rhomboid-family-intramembrane-serine-protease
MFPIRDHNPSGRTPYVTYALMVANIAIFALIYFGYDSPRRLTALYNAYALLPAEVTSGYDWKTLLTSTFLHGSWMHLGGNMLFLWIFGDNMEDEMGHFTFLAFYLVSGVGAGLIHVASAPYSLVPLVGASGAIAGVMGGYLLLFPRARVDILLILIIYFRVFSIPAFVMLGVWLGMQFLGGIGSDPQAGGVAYWAHAGGFGVGLVLTIPLWLRRGGPTYWGKTHGQPPHPKVSYSASRIPRVARKSPRDAHRNSRRDSPWGR
>NZ_CP010588.1|WP_024097704.1|2311418_2311835_+|GFA-family-protein
MTSGTPTATTTDGPTTCRASCHCGAVEISADLPRGLASASRCNCSFCIRRGAAAVTARTDSLRILKGAENLSLYTWGSHTAKHYFCKTCGIYVYHQRRSDPAECGINLGCIDGGNPRAHAETYGEIPWHDGVNHPSDQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010588_1	1.1\|2303523\|19\|NZ_CP010588\|CRISPRCasFinder	2303523-2303541	19	NZ_CP010588.1	2303655-2303673	1	0.947
NZ_CP010588_1	1.2\|2303571\|19\|NZ_CP010588\|CRISPRCasFinder	2303571-2303589	19	NZ_CP010588.1	403244-403262	2	0.895

1. spacer 1.1|2303523|19|NZ_CP010588|CRISPRCasFinder matches to position: 2303655-2303673, mismatch: 1, identity: 0.947

acgggacgccgcacgggac	CRISPR spacer
acgggccgccgcacgggac	Protospacer
***** *************

2. spacer 1.2|2303571|19|NZ_CP010588|CRISPRCasFinder matches to position: 403244-403262, mismatch: 2, identity: 0.895

atgggccgccgccggagct	CRISPR spacer
atgggccgccgccagcgct	Protospacer
*************.* ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010588_1	1.1\|2303523\|19\|NZ_CP010588\|CRISPRCasFinder	2303523-2303541	19	NC_023549	Clavibacter phage CN1A, complete genome	5375-5393	0	1.0

1. spacer 1.1|2303523|19|NZ_CP010588|CRISPRCasFinder matches to NC_023549 (Clavibacter phage CN1A, complete genome) position: , mismatch: 0, identity: 1.0

acgggacgccgcacgggac	CRISPR spacer
acgggacgccgcacgggac	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1033313 : 1096003

uncultured_Mediterranean_phage(20.0%)

protease,transposase,integrase

attL 1085641:1085669|attR 1089074:1089102

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024096488.1\|1033313_1034471_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_024096489.1\|1034470_1035361_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_024096491.1\|1035631_1037146_+	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.1e-24	29.6
WP_040103920.1\|1037695_1038352_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_024096493.1\|1038502_1039087_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_014875267.1\|1039410_1039734_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_024096494.1\|1039733_1040597_+	VCBS repeat-containing protein	NA	NA	NA	NA
WP_024096495.1\|1040816_1042592_+	DUF1217 domain-containing protein	NA	NA	NA	NA
WP_024096496.1\|1043409_1044042_-	PAS domain S-box protein	NA	NA	NA	NA
WP_024096497.1\|1044189_1045071_-	hypothetical protein	NA	NA	NA	NA
WP_024096498.1\|1045380_1046646_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_024096499.1\|1046790_1048356_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	7.8e-34	34.5
WP_024096500.1\|1048431_1048845_-	hypothetical protein	NA	NA	NA	NA
WP_024096501.1\|1049073_1049751_+	lysoplasmalogenase	NA	NA	NA	NA
WP_024096502.1\|1049862_1051146_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	1.1e-12	34.1
WP_040103907.1\|1051242_1052145_+	EamA family transporter	NA	NA	NA	NA
WP_024096504.1\|1052268_1052883_+	septation protein IspZ	NA	NA	NA	NA
WP_024096505.1\|1053186_1054377_+	O-succinylhomoserine sulfhydrylase	NA	NA	NA	NA
WP_024096506.1\|1054587_1055691_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_024096507.1\|1055915_1056677_+	hypothetical protein	NA	NA	NA	NA
WP_024096508.1\|1056741_1058190_+	TrkH family potassium uptake protein	NA	NA	NA	NA
WP_024096509.1\|1058347_1059586_+	aspartate kinase	NA	NA	NA	NA
WP_024096510.1\|1059632_1061873_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_145957941.1\|1061847_1062141_-	hypothetical protein	NA	NA	NA	NA
WP_024096511.1\|1062544_1064839_+	bifunctional salicylyl-CoA 5-hydroxylase/oxidoreductase	NA	NA	NA	NA
WP_024096512.1\|1064835_1065594_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_024096513.1\|1065593_1066052_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024096514.1\|1066048_1066852_+	enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_024096515.1\|1066957_1068118_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_024096516.1\|1068119_1069736_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	3.0e-44	32.0
WP_024096517.1\|1069768_1070893_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_040103909.1\|1070896_1074244_-	glycosyltransferase family 92 protein	NA	NA	NA	NA
WP_024096519.1\|1074585_1075368_+	hypothetical protein	NA	NA	NA	NA
WP_096596711.1\|1075932_1076796_+	hypothetical protein	NA	NA	NA	NA
WP_024096522.1\|1076936_1077188_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024096523.1\|1077189_1078491_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_024096524.1\|1078761_1078959_+	hypothetical protein	NA	NA	NA	NA
WP_024096525.1\|1079226_1080129_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024096526.1\|1080225_1080831_+	putative protein-disulfide isomerase	NA	NA	NA	NA
WP_024096527.1\|1080848_1081712_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_040103922.1\|1081973_1082363_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_024096530.1\|1082861_1083485_+	protocatechuate 3,4-dioxygenase beta subunit	NA	NA	NA	NA
WP_024096531.1\|1083517_1084342_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
1085641:1085669	attL	NA	NA	NA	NA
WP_024096534.1\|1085725_1086724_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.7e-27	28.9
WP_024096535.1\|1086720_1087665_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_036563100.1\|1087661_1088573_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_024096539.1\|1089405_1089609_+	hypothetical protein	NA	NA	NA	NA
1089074:1089102	attR	NA	NA	NA	NA
WP_024096540.1\|1089605_1089830_+	hypothetical protein	NA	NA	NA	NA
WP_024096541.1\|1089816_1090098_+	hypothetical protein	NA	NA	NA	NA
WP_024096542.1\|1090272_1090863_+	mobilization protein MobC	NA	NA	NA	NA
WP_024096543.1\|1090849_1092646_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_024096544.1\|1092638_1094567_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_024096545.1\|1094614_1096003_+\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1148606 : 1203212

Acinetobacter_phage(14.29%)

lysis,integrase,transposase,tRNA

attL 1141431:1141447|attR 1193517:1193533

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1141431:1141447	attL	NA	NA	NA	NA
WP_040103929.1\|1148606_1148738_-\|transposase	transposase	NA	NA	NA	NA
WP_024096611.1\|1148795_1149377_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_096596796.1\|1149386_1149497_-	hypothetical protein	NA	NA	NA	NA
WP_024096612.1\|1149509_1150286_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-42	40.0
WP_024096613.1\|1151019_1151829_+	response regulator	Q6JIH3	Burkholderia_virus	4.2e-07	52.3
WP_040103941.1\|1151816_1154507_-	response regulator	A0A1V0SGX0	Hokovirus	1.8e-33	37.4
WP_024096615.1\|1154509_1155253_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024096616.1\|1155422_1156256_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_024096617.1\|1156284_1157040_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_024096618.1\|1157029_1157917_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_024096619.1\|1157929_1158679_+	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.2e-10	30.9
WP_024096620.1\|1158797_1159802_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024096621.1\|1159806_1160610_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_024096622.1\|1160666_1162757_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-10	28.0
WP_024096623.1\|1162851_1164057_-	ABC transporter permease	NA	NA	NA	NA
WP_024096624.1\|1164069_1165155_-	ABC transporter permease	NA	NA	NA	NA
WP_024096625.1\|1165228_1166899_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024096626.1\|1167455_1168400_-	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	7.6e-08	28.1
WP_024096627.1\|1168497_1169958_+	catalase	A0A2K9L0T1	Tupanvirus	2.5e-106	48.7
WP_024096628.1\|1170190_1170715_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_024096629.1\|1170772_1171522_-	hypothetical protein	NA	NA	NA	NA
WP_024096630.1\|1171626_1172169_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024096631.1\|1172169_1172868_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_024096632.1\|1173274_1173571_+\|transposase	transposase	NA	NA	NA	NA
WP_024096633.1\|1173567_1174287_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.4e-31	38.2
WP_040103945.1\|1174428_1174641_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024096634.1\|1174799_1175441_+	hypothetical protein	NA	NA	NA	NA
WP_040103946.1\|1175443_1175758_-	Arc family DNA-binding protein	A0A0U4B0M9	Pseudomonas_phage	3.1e-06	56.1
WP_024096636.1\|1175842_1176037_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_024096637.1\|1176061_1176253_+	hypothetical protein	NA	NA	NA	NA
WP_024096638.1\|1176249_1177281_+\|integrase	tyrosine-type recombinase/integrase	K7PHK0	Enterobacteria_phage	2.0e-06	23.6
WP_024096639.1\|1177680_1178430_-	hypothetical protein	NA	NA	NA	NA
WP_024096640.1\|1178605_1180876_-	hybrid sensor histidine kinase/response regulator	A0A2K9L0Z8	Tupanvirus	9.1e-15	28.9
WP_040103947.1\|1180872_1182126_-	GfdT protein	NA	NA	NA	NA
WP_024096642.1\|1182143_1182860_-	response regulator transcription factor	NA	NA	NA	NA
WP_024096643.1\|1183230_1183779_+	carbon monoxide dehydrogenase subunit G	NA	NA	NA	NA
WP_024096644.1\|1184173_1185973_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	6.0e-62	31.0
WP_024096645.1\|1186154_1188050_+	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	2.6e-23	26.4
WP_024096646.1\|1188189_1189116_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_024096647.1\|1189118_1189682_-	DUF4453 domain-containing protein	NA	NA	NA	NA
WP_024096648.1\|1189738_1190575_-	protein of the AP superfamily	NA	NA	NA	NA
WP_024096649.1\|1190700_1192338_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.2e-22	34.7
WP_024096650.1\|1192334_1193150_-	ABC transporter permease	NA	NA	NA	NA
WP_024096651.1\|1193146_1194103_-	ABC transporter permease	NA	NA	NA	NA
1193517:1193533	attR	NA	NA	NA	NA
WP_024096652.1\|1194117_1195704_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024096654.1\|1196160_1196607_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_024096655.1\|1196635_1197307_-	nitroreductase	NA	NA	NA	NA
WP_024096656.1\|1197362_1198514_-	TFIIB-type zinc finger domain-containing protein	NA	NA	NA	NA
WP_024096658.1\|1198818_1200006_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_040103961.1\|1200104_1200989_-	DUF2927 domain-containing protein	NA	NA	NA	NA
WP_024096660.1\|1201075_1202272_-	toxic anion resistance protein	NA	NA	NA	NA
WP_024096661.1\|1202294_1203212_-\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis protein	NA	NA	NA	NA

DBSCAN-SWA_3

1510659 : 1578267

uncultured_Mediterranean_phage(22.22%)

tail,head,tRNA,capsid,portal,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024096945.1\|1510659_1511952_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.6e-87	46.9
WP_024096946.1\|1512061_1513558_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_024096947.1\|1513737_1514022_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.0e-20	53.8
WP_024096948.1\|1514056_1515718_+	protein translocase subunit SecD	A0A1B1IVP7	uncultured_Mediterranean_phage	1.6e-05	24.0
WP_024096949.1\|1515720_1516689_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.7e-61	48.7
WP_024096950.1\|1516855_1517209_+	membrane protein	NA	NA	NA	NA
WP_024096951.1\|1517306_1517933_+	heme ABC exporter ATP-binding protein CcmA	G9BWD6	Planktothrix_phage	2.0e-09	29.2
WP_024096952.1\|1517929_1518586_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_024096953.1\|1518631_1519363_+	heme ABC transporter permease	NA	NA	NA	NA
WP_040104006.1\|1519362_1519533_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_024096955.1\|1519525_1520065_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_024096956.1\|1520140_1520440_-	hypothetical protein	NA	NA	NA	NA
WP_024096957.1\|1520715_1523403_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_024096958.1\|1523648_1524380_+	DUF1223 domain-containing protein	NA	NA	NA	NA
WP_024096959.1\|1524394_1525330_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_024096960.1\|1525700_1526897_-	flagellar motor switch protein	NA	NA	NA	NA
WP_024096961.1\|1526973_1527579_-	hypothetical protein	NA	NA	NA	NA
WP_024096962.1\|1527768_1529073_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.1e-17	30.2
WP_024096963.1\|1529352_1530609_-	OsmC family protein	NA	NA	NA	NA
WP_024096964.1\|1530704_1531265_+	NUDIX hydrolase	NA	NA	NA	NA
WP_024096965.1\|1531340_1532684_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024096966.1\|1532871_1533630_+	DUF3445 domain-containing protein	NA	NA	NA	NA
WP_024096967.1\|1533667_1534693_-	hypothetical protein	NA	NA	NA	NA
WP_024096968.1\|1535234_1536641_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_014874894.1\|1536734_1537073_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_024096969.1\|1537265_1538957_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_024096970.1\|1539331_1541536_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-13	29.1
WP_024096971.1\|1541945_1543076_+	porin	NA	NA	NA	NA
WP_024096972.1\|1543333_1544665_+	trigger factor	NA	NA	NA	NA
WP_024096973.1\|1544879_1546148_-	hemolysin-type calcium-binding protein	M4SNJ8	Pseudoalteromonas_phage	2.8e-05	25.9
WP_024096974.1\|1546446_1548405_-	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase	NA	NA	NA	NA
WP_024096975.1\|1548553_1549024_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_024096976.1\|1549336_1549519_-	hypothetical protein	NA	NA	NA	NA
WP_024096977.1\|1549751_1550366_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_005982441.1\|1550378_1550606_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_014874885.1\|1550634_1550988_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_040103985.1\|1551513_1552110_+	hypothetical protein	NA	NA	NA	NA
WP_014874883.1\|1552348_1552924_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_024096979.1\|1553048_1553348_-	hypothetical protein	NA	NA	NA	NA
WP_024096980.1\|1553619_1554411_+	FRG domain-containing protein	NA	NA	NA	NA
WP_024096981.1\|1554563_1555865_-	cytochrome b561	NA	NA	NA	NA
WP_024096982.1\|1556050_1556983_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_024096983.1\|1557067_1557805_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_005982462.1\|1558439_1558673_+	acyl carrier protein	A0A2C9CX86	Yersinia_phage	7.3e-05	52.1
WP_024096984.1\|1558837_1559581_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	NA	NA	NA	NA
WP_024096985.1\|1559764_1560778_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_024096986.1\|1561037_1562303_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024096987.1\|1562302_1563457_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_024096988.1\|1563748_1564084_+	hypothetical protein	NA	NA	NA	NA
WP_024096989.1\|1564061_1565354_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	3.9e-71	41.4
WP_024096990.1\|1565557_1566751_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	3.1e-59	35.9
WP_024096991.1\|1566743_1566962_+	hypothetical protein	NA	NA	NA	NA
WP_024096992.1\|1566997_1567615_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.8e-34	56.2
WP_024096993.1\|1567663_1568848_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	3.3e-61	41.7
WP_043939826.1\|1569037_1569682_+	hypothetical protein	NA	NA	NA	NA
WP_024096995.1\|1569678_1570050_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_024096996.1\|1570046_1570460_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_024096997.1\|1570564_1570978_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_024096998.1\|1570992_1571346_+	gene transfer agent family protein	NA	NA	NA	NA
WP_024096999.1\|1571342_1571600_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_024097000.1\|1571592_1572249_+\|tail	phage tail tape measure protein	D6PFD6	uncultured_phage	1.7e-14	36.6
WP_024097001.1\|1572264_1572897_+	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	2.0e-57	50.0
WP_024097002.1\|1572896_1573847_+	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	2.5e-51	35.8
WP_024097003.1\|1573843_1574314_+	phage cell wall peptidase NlpC/P60 family	A0A1V0DYB6	Dinoroseobacter_phage	2.3e-29	47.1
WP_024097004.1\|1574313_1578267_+\|tail	phage tail protein	A0A0B5A7K5	Paracoccus_phage	6.4e-226	37.5

DBSCAN-SWA_4

1779006 : 1806970

Ruegeria_phage(23.53%)

tail,head,capsid,integrase,terminase,portal,protease

attL 1772200:1772214|attR 1794160:1794174

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1772200:1772214	attL	NA	NA	NA	NA
WP_024097172.1\|1779006_1780086_-\|integrase	tyrosine-type recombinase/integrase	A0A240F4W2	Ochrobactrum_phage	1.4e-50	33.2
WP_024097174.1\|1780379_1781033_-	recombinase family protein	A0A1S6L009	Salmonella_phage	6.4e-30	45.5
WP_024097175.1\|1781054_1781231_-	hypothetical protein	NA	NA	NA	NA
WP_096596809.1\|1781466_1782165_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	2.0e-29	45.0
WP_024097178.1\|1782238_1782385_-	hypothetical protein	NA	NA	NA	NA
WP_024097179.1\|1782441_1782831_-	hypothetical protein	NA	NA	NA	NA
WP_052440150.1\|1782860_1784948_-	hypothetical protein	A0A1X9HVK8	Ruegeria_phage	4.6e-215	59.7
WP_024097179.1\|1785004_1785394_-	hypothetical protein	NA	NA	NA	NA
WP_052331592.1\|1785418_1786165_-	site-specific DNA-methyltransferase	O03956	Myxococcus_phage	1.1e-57	52.9
WP_024097181.1\|1786195_1786969_-	hypothetical protein	A0A068CE44	Rhizobium_phage	3.6e-08	28.8
WP_024097182.1\|1787117_1787447_-	hypothetical protein	NA	NA	NA	NA
WP_024097183.1\|1787446_1787686_-	hypothetical protein	NA	NA	NA	NA
WP_024097184.1\|1787682_1787997_-	hypothetical protein	NA	NA	NA	NA
WP_024097185.1\|1788193_1788679_-	ABC-2 family transporter protein	NA	NA	NA	NA
WP_024097186.1\|1788688_1789618_-	hypothetical protein	NA	NA	NA	NA
WP_040104019.1\|1789690_1790341_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024097189.1\|1790766_1791207_+	hypothetical protein	NA	NA	NA	NA
WP_024097190.1\|1791203_1791371_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043939781.1\|1791414_1791741_-	hypothetical protein	NA	NA	NA	NA
WP_024097192.1\|1792019_1792613_+	SAM-dependent methyltransferase	A0A218MLE3	uncultured_virus	1.3e-42	48.3
WP_024097193.1\|1792609_1793521_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024097194.1\|1793520_1793835_+	hypothetical protein	NA	NA	NA	NA
WP_024097195.1\|1793827_1794490_+	DUF2312 domain-containing protein	A0A1X9HX62	Ruegeria_phage	4.4e-55	60.5
1794160:1794174	attR	NA	NA	NA	NA
WP_024097196.1\|1794499_1794916_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.6e-08	42.9
WP_024097197.1\|1794984_1795365_+	hypothetical protein	A0A1X9HVL1	Ruegeria_phage	1.5e-07	35.1
WP_024097198.1\|1795364_1797053_+	DEAD/DEAH box helicase	A0A1X9HX80	Ruegeria_phage	6.3e-138	47.6
WP_024097199.1\|1797042_1797621_+	transcription antiterminator	NA	NA	NA	NA
WP_081731415.1\|1797815_1798040_+	twin-arginine translocation signal domain-containing protein	NA	NA	NA	NA
WP_024097200.1\|1798042_1798234_+	hypothetical protein	NA	NA	NA	NA
WP_145957933.1\|1798230_1798557_+	hypothetical protein	NA	NA	NA	NA
WP_024097202.1\|1798732_1799140_+\|terminase	phage terminase small subunit	NA	NA	NA	NA
WP_024097203.1\|1799117_1800896_+\|terminase	phage terminase-like protein, large subunit	B0VK29	Azospirillum_phage	6.9e-119	40.5
WP_024097204.1\|1800903_1802154_+\|portal	phage portal protein	A0A141GEV9	Brucella_phage	3.4e-104	52.9
WP_024097205.1\|1802131_1802968_+\|protease	Clp protease ClpP	A0A141GEW1	Brucella_phage	8.5e-112	73.9
WP_024097206.1\|1802984_1804223_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	2.1e-127	55.6
WP_024097207.1\|1804283_1804424_+	hypothetical protein	NA	NA	NA	NA
WP_024097208.1\|1804430_1805000_+	hypothetical protein	A0A141GEW4	Brucella_phage	3.1e-33	43.1
WP_024097209.1\|1804999_1805326_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_024097210.1\|1805322_1805778_+	hypothetical protein	NA	NA	NA	NA
WP_024097211.1\|1805777_1806131_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_024097212.1\|1806175_1806463_+	hypothetical protein	NA	NA	NA	NA
WP_024097213.1\|1806523_1806970_+	hypothetical protein	A0A2I7RB20	Vibrio_phage	5.9e-11	32.0

DBSCAN-SWA_5

2285871 : 2296719

Vibrio_phage(33.33%)

coat,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024097661.1\|2285871_2287113_-\|coat	phage coat protein	I3PUX4	Vibrio_phage	5.4e-54	34.3
WP_024097662.1\|2287125_2287968_-	hypothetical protein	I3PUX5	Vibrio_phage	3.7e-14	31.1
WP_024097663.1\|2287981_2289973_-	hypothetical protein	I3PUX6	Vibrio_phage	3.6e-124	39.6
WP_024097664.1\|2289969_2291307_-\|terminase	phage terminase large subunit	F8TUR5	EBPR_podovirus	6.2e-181	71.8
WP_024097665.1\|2291287_2291590_-	hypothetical protein	A0A088FAU1	Sulfitobacter_phage	1.5e-05	41.6
WP_024097666.1\|2292217_2292808_-	transcription antiterminator	NA	NA	NA	NA
WP_040104067.1\|2293076_2293463_-	hypothetical protein	NA	NA	NA	NA
WP_024097669.1\|2293474_2293828_-	HNH endonuclease	A0A0B4N249	Escherichia_phage	5.5e-20	49.0
WP_024097670.1\|2293896_2294367_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	4.4e-49	81.7
WP_024097671.1\|2294366_2294735_-	ATPase involved in DNA replication initiation	NA	NA	NA	NA
WP_024097672.1\|2294731_2295100_-	hypothetical protein	NA	NA	NA	NA
WP_024097673.1\|2295086_2295884_-	hypothetical protein	NA	NA	NA	NA
WP_024097674.1\|2295880_2296414_-	T5domain protein	A0A088F856	Sulfitobacter_phage	2.6e-45	52.3
WP_024097675.1\|2296410_2296719_-	VRR-NUC domain protein	E2GLY0	Acinetobacter_phage	1.6e-20	55.7

DBSCAN-SWA_6

2300458 : 2303745

Pseudoalteromonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024097687.1\|2300458_2301127_+	ERF family protein	A0A0H4A6R9	Pseudoalteromonas_phage	9.1e-24	48.9
WP_024097688.1\|2301116_2301821_+	3'-5' exonuclease	X2CYL5	Brucella_phage	2.3e-41	45.3
WP_024097689.1\|2301820_2302009_+	hypothetical protein	NA	NA	NA	NA
WP_024097690.1\|2302008_2302299_+	hypothetical protein	A0A0B5HDX4	Vibrio_phage	6.5e-27	59.8
WP_024097691.1\|2302312_2302768_+	hypothetical protein	A0A2H4J106	uncultured_Caudovirales_phage	2.0e-06	29.2
WP_040104145.1\|2302836_2303142_+	DUF1364 domain-containing protein	A0A088F868	Sulfitobacter_phage	7.3e-29	60.4
WP_024097693.1\|2303163_2303745_+	hypothetical protein	K4NZ13	Pseudomonas_phage	2.7e-16	55.2

Anti-CRISPR protein detection

Acr_ID: NZ_CP010588.1|WP_024097689.1|2301820_2302009_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP010588.1|WP_024097689.1|2301820_2302009_+|hypothetical-protein

2301820_2302009_+

62 aa aa

2300458-2303745

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP010588_1	Orphan	1.1\|2303523\|19\|NZ_CP010588\|CRISPRCasFinder	2303523-2303541	19	2303655-2303673	1

1. spacer 1.1|2303523|19|NZ_CP010588|CRISPRCasFinder matches to NZ_CP010588 position: 2303655-2303673, mismatch: 1

acgggacgccgcacgggac	CRISPR spacer
acgggccgccgcacgggac	Protospacer
***** *************

2. NZ_CP010594

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21785 : 34631

Emiliania_huxleyi_virus(20.0%)

head,portal,capsid,tail,terminase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024099703.1\|21785_22088_-\|head,tail	head-tail adaptor protein	A0A141GEW5	Brucella_phage	2.6e-10	44.3
WP_024099704.1\|22087_22378_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_024099705.1\|22374_22911_-	hypothetical protein	NA	NA	NA	NA
WP_024099706.1\|22984_24280_-\|capsid	phage major capsid protein	C4ML06	Xanthomonas_virus	3.9e-55	35.3
WP_158524454.1\|24293_25130_-\|protease	Clp protease ClpP	A0A0U4B0J0	Pseudomonas_phage	2.9e-59	50.8
WP_081731486.1\|25141_26371_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	9.1e-62	37.2
WP_024099709.1\|26370_28098_-\|terminase	terminase large subunit	A0A0P0ZEI4	Stx2-converting_phage	2.8e-133	44.3
WP_040104520.1\|28097_28598_-	hypothetical protein	I3ULZ5	Rhodobacter_phage	9.5e-26	43.5
WP_024099711.1\|29186_29882_-	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	1.7e-36	44.8
WP_024099712.1\|30209_32093_-	hypothetical protein	A0A291LAR9	Bordetella_phage	9.5e-26	29.1
WP_024099713.1\|32085_33261_-	DNA primase	G8DGB8	Emiliania_huxleyi_virus	1.2e-84	46.1
WP_024099714.1\|33257_33566_-	hypothetical protein	NA	NA	NA	NA
WP_024099715.1\|33562_33862_-	hypothetical protein	NA	NA	NA	NA
WP_024099716.1\|33851_34631_-	site-specific DNA-methyltransferase	M4R187	Loktanella_phage	7.9e-19	32.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010588

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

2. NZ_CP010594

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection