CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP023519	Burkholderia cepacia strain FDAARGOS_388 plasmid unnamed1, complete sequence	0 crisprs	PD-DExK	0	0
NZ_CP023521	Burkholderia cepacia strain FDAARGOS_388 chromosome 2, complete sequence	1 crisprs	WYL,csa3,DinG,cas3,Cas14u_CAS-V	2	1
NZ_CP023518	Burkholderia cepacia strain FDAARGOS_388 chromosome 1, complete sequence	1 crisprs	DEDDh,WYL,cas3,csa3,RT	1	6
NZ_CP023520	Burkholderia cepacia strain FDAARGOS_388 chromosome 3, complete sequence	0 crisprs	RT	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023521_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023521_1

2472205-2472410

Orphan

Consensus_repeat	Method
GCGCCGCCGCCGAGGGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP023521_1

>merge|NZ_CP023521|1|2472205-2472410|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAGCAGGCCACCCGTGCGGCCGCCCATCGCGTTGCCTGCCGCGGTGCCTGCGCCGCCGCCGAGGGCGCCGCCGATGATCGCGCCGGTGCGCTCGCGACGGTTCGACGTCACCGCGCCACCCGCGCCGCCGCCGATGGCGCCGCCGATCACCGAGCCCGTGCTGCCGCCGAGCGCACCGCCGAC

>NZ_CP023521|1|1|2472205-2472410|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAG	CAGGCCACCCGTGCGGCCGCCCATCGCGTTGCCTGCCGCGGTGCCT
GCGCCGCCGCCGAGGGCGCCGCCGAT	GATCGCGCCGGTGCGCTCGCGACGGTTCGACGTC
ACCGCGCCACCCGCGCCGCCGCCGAT	GGCGCCGCCGATCACCGAGCCC
GTGCTGCCGCCGAGCGCACCGCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023521.1\|WP_027790398.1\|2470370_2471207_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP023521.1\|WP_027790405.1\|2462283_2463105_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP023521.1\|WP_027790402.1\|2464294_2466415_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP023521.1\|WP_027790391.1\|2480251_2481571_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187579
NZ_CP023521.1\|WP_027790404.1\|2463269_2463653_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|366361
NZ_CP023521.1\|WP_027790403.1\|2463674_2464286_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP023521.1\|WP_027790401.1\|2466652_2467447_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP023521.1\|WP_021159932.1\|2479784_2480255_-\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NZ_CP023521.1\|WP_027790400.1\|2467739_2469173_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143456
NZ_CP023521.1\|WP_027790395.1\|2475111_2476539_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP023521.1\|WP_027790399.1\|2469292_2470219_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
NZ_CP023521.1\|WP_027790396.1\|2472914_2473574_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP023521.1\|WP_027790406.1\|2461175_2462264_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223682
NZ_CP023521.1\|WP_006480371.1\|2481659_2482193_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP023521.1\|WP_027790407.1\|2460242_2461160_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP023521.1\|WP_021159927.1\|2474151_2474571_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP023521.1\|WP_027790394.1\|2476620_2477244_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP023521.1\|WP_162836114.1\|2473730_2473895_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023521.1\|WP_027790393.1\|2477316_2478816_-\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|273800
NZ_CP023521.1\|WP_027790392.1\|2478812_2479688_-\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|367833

Protein	Function_ID	Function_description	E-value
NZ_CP023521.1\|WP_027790398.1\|2470370_2471207_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP023521.1\|WP_027790405.1\|2462283_2463105_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	6.60555e-169
NZ_CP023521.1\|WP_027790402.1\|2464294_2466415_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP023521.1\|WP_027790391.1\|2480251_2481571_-\|SDR-family-oxidoreductase	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.57378e-51
NZ_CP023521.1\|WP_027790404.1\|2463269_2463653_+\|lactoylglutathione-lyase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	3.8052e-05
NZ_CP023521.1\|WP_027790403.1\|2463674_2464286_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.79533e-62
NZ_CP023521.1\|WP_027790401.1\|2466652_2467447_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	2.77814e-81
NZ_CP023521.1\|WP_027790400.1\|2467739_2469173_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143456	cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD.	0
NZ_CP023521.1\|WP_027790395.1\|2475111_2476539_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	4.75002e-40
NZ_CP023521.1\|WP_027790399.1\|2469292_2470219_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.59179e-94
NZ_CP023521.1\|WP_027790396.1\|2472914_2473574_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	7.27223e-26
NZ_CP023521.1\|WP_027790406.1\|2461175_2462264_+\|iron-ABC-transporter-permease	gnl\|CDD\|223682	COG0609, FepD, ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].	1.44611e-80
NZ_CP023521.1\|WP_006480371.1\|2481659_2482193_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	9.65607e-41
NZ_CP023521.1\|WP_027790407.1\|2460242_2461160_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	2.55928e-77
NZ_CP023521.1\|WP_021159927.1\|2474151_2474571_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	1.81872e-48
NZ_CP023521.1\|WP_027790394.1\|2476620_2477244_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	2.53869e-48
NZ_CP023521.1\|WP_021159932.1\|2479784_2480255_-\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	6.15816e-57
NZ_CP023521.1\|WP_027790393.1\|2477316_2478816_-\|TIGR01777-family-protein	gnl\|CDD\|273800	TIGR01777, Hypothetical_UPF0105_protein_Rv2216/MT2273/Mb2239., TIGR01777 family protein. This model represents a clade of proteins of unknown function including the E. coli yfcH protein. [Hypothetical proteins, Conserved].	2.229e-106
NZ_CP023521.1\|WP_027790392.1\|2478812_2479688_-\|DUF393-domain-containing-protein	gnl\|CDD\|367833	pfam04134, DUF393, Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown.	1.60244e-18

>NZ_CP023521.1|WP_027790398.1|2470370_2471207_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTNTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGTKHVLKPGGYAFIPPGADWTLHNVSDAAVRFHWVRKHYQAVDGIPLPDAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP023521.1|WP_027790399.1|2469292_2470219_+|LysR-family-transcriptional-regulator
MHRTGMTELEVVLAVARRSSFRGAALELGMSTTAVSSAVAGLEARLKVRLFNRSTRSVSLTDAGQRYVERIAPALAEIRSAGEDAAAGPDTPSGTLRINAPQGAAHLLLGPLFHPYAQRYPNVRIDIVSESRLIDIVAEGFDAGIRLAEAVPQDMIAVALSRDIRMLVVATPEYLKRHGTPRHPRDLLKHQSIGMRMAHGGIYHWELERNGQKLQMDLPVRFALNELAAIKQAILFGLGIGFISEWFIGEELKSGALVPVLAPWCPSFGGLRLYYSGHRFVPARLRALIDLAHELRLTDAPLSVGRKE
>NZ_CP023521.1|WP_027790400.1|2467739_2469173_-|aldehyde-dehydrogenase-family-protein
MQRIEQIYIDGEFVTPHGDEWFDLHDPSTERVIGQVRLGDEQDAERAIAAAKAAFPGWSRTTREERIAALERMRDAVVAREDDLMEAVVTEYGAPVERGRWMATYPADAIRQAIAALETFAFEEQAGSARVIMTPVGVAGLITPWNSDAGFICNKLATALAAGCTAVIKPSEMSAMQTQVVTEALHAAGLPKGVFNIVNGRGDVVGDAISRSPDVAKISFTGSSAVGQHLVSAGAATMKRVTLELGGKSPTVVLDDADFASIMPLVLQAGFMNSGQACIAGTRVLVPRHRLAEFEDAISQAVARVRSGDPRDAGTDIGPMVSAKQWERVQHYIRIGQEEGAVLLAGGEGRPDGLQAGWFVKPTVFSRANNRMRIAQEEIFGPVLTLIPYEDDADAIAIANDTRYGLSAMVLGKDPERCERVALQIDSGRVLVNTLAHEPLAPFGGFKHSGLGREMGRWGIGAYLEPKTLIGSASRGA
>NZ_CP023521.1|WP_027790401.1|2466652_2467447_+|3'-kinase
MFDRYLGLWGLVPDGGPILTASGGLLPVLWQARPAMLKVATCDEERRGNALMTWWNGHGAAQVWQHDSDAILLERAQPAPSLAKLSASGHDDDTMRIACGVVARLHAHRAPEPVSVVPLRDWFRSLLSDDVGNDVLRCSATIARELLAGPPVDEVVLHGDIHHDNILHFGDRGWLAIDPKGLRGDRAFDYANLFCNPAHEIAADPARFTQRVVCVADAARLDRRRLLKWILAWAGLSAVWLMEDDLLPETRLAVAQLAAHALGL
>NZ_CP023521.1|WP_027790402.1|2464294_2466415_-|PBP1A-family-penicillin-binding-protein
MTDHTASPPPPPVPPPRRRRAWRTLAGALLGLTLACAGIGAWTINRIWTQLPSVEHLAVYRPALPLRIFSRDGDLLAEYGVERREFVPLERIPPLMRHALLAAEDAKFYQHGAVDVGGLARATFANVVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMAAKLEREYSKDKLLELYMNEIYLGERAYGFAAAANVYFGKPLDALNAGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMHALGQLDDATYRAAVDAPIALATTPPPGIVAAPYVAERARRMMVERFHDDAYTLGLDVTTTISMRDQRAAEAALQRTLSRQPGAKRDARNGLEGALVSLDAATGDMLALVGGADFNRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTHEETGARPWRPRNFGNRYEGFIPVRRGLVRSKNLVAVSLMQATDARYVQQHAVHFGFDAQRNPASLPLALGAGAVTPLELASAYSVFANGGTRMEPRLILSVKQRHGGAMYEATTPEGARVVSARNAFLMDSMLRDVVKAGTARGALALRRDDAAGKTGTSNGSKDVWFAGYSSGVVAVAWLGYDTPRPMGRATGATLALPVWLDYMKTAVDGRTPVDATPPQDVALVDGDFVYAEYTRGTCTADVPPYIRSRFACGGAAAQDASDAPAGSGKPDEPMPAAVDAAERERVLDLFRTDD
>NZ_CP023521.1|WP_027790403.1|2463674_2464286_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPEYLVITLAAATVASWAARHVARMKTLFVTVDAIGLAAFTIIGCDIGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILREELYASVAFVTGALYVGMQHLGIDAGAATVVALAAGFSMRMLAVRLGWKMRTFGAADVGH
>NZ_CP023521.1|WP_027790404.1|2463269_2463653_+|lactoylglutathione-lyase
MPLPMTRIILYVQDVTLLKAFYQRHFDLPVIEEIDGEWAVLDAGAIELALHLAGPAFRDAAAPSNANPATNNVKLVFRIDADIDAHRDRLARDGVTVRDVKRFDGFPYRLLDGIDPEGNVFQVMQPD
>NZ_CP023521.1|WP_027790405.1|2462283_2463105_+|heme-ABC-transporter-ATP-binding-protein
MLTAHHLDVARRHNAILRDLSLSIEPGRVTALLGRNGAGKSTLLKTFAGELTGSVAPNGVRVTGDITLNGEPLARIDAPRLACLRAVLPQAAQPAFPFSVDEIVLLGRYPHARRSGATSHHDRDIAWRALERAGADALVGRDVTTLSGGELARVQFARVLAQLWPDEEATESGPRYLLLDEPTAALDLAHQHRLLDTVRSVAREWRLGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPRDVMTPAHIAQCYGFSVKMVETGDGATPVMVPA
>NZ_CP023521.1|WP_027790406.1|2461175_2462264_+|iron-ABC-transporter-permease
MPAHASPFPAPSPASRSGAARMGMSRRFAPFALAALAVLVCAMSVVALCVGAYRIPLTEAWAALTGDAAAQQARAVLLDIRAPRVALALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATTMIVLGPALFAAHVGAAALPVAAFAGALAVAALVYRLAASRGRLALPLLLLAGIAINALAGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSALAAVAPCVAIGCVLLARERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIIGFIGLVAPHCVRLACGPDQRVVLPGAALLGALLTLAADLAARTVAAPAEIPLGVLTALLGAPFFLALLWKSRGALGG
>NZ_CP023521.1|WP_027790407.1|2460242_2461160_+|ABC-transporter-substrate-binding-protein
MSARPFDPRRRVMLAGAAAGALAGALPGSVLAQAAPAAPKRVVVIGGALAETAFALGGAETPRYRLVGADTTCTYPDAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPTAIAQVKGAGVAVTTFDERHDVESVRAKITGVALALDVRDAGAALLQRFDRDWQAARDAVAARAPGGAQPPRVLFVLNHTGNQALVAGQRTAADAMIRYAGARNAMQGFDHYKPLTTEALAAAAPDVVLISDEGLAAVGGRTALLATPGFGATPAGRAQRVVSLDALFLLGFGPRLPLAVTTLHRRLSDALA
>NZ_CP023521.1|WP_027790396.1|2472914_2473574_-|isoprenylcysteine-carboxylmethyltransferase-family-protein
MTVTRKVAALSGISTLVYLGLAVLGSGGFAAFFSHPPLIVVVVATLAMAVAAMFTEGNLSSGERENRDNRWVLAAFGVSGFLLAYLPALTDRLDFWTFGGDAVRWAGVALYIAGGVLRIWPVFVLGKRFSGLVAIQPGHTLVTDGIYRRIRNPSYLGLLVNSVGWALAFRSGVGVLLVVLTMIPLVARIRSEEALLRAQFGAEYDAYCARTWRLLPGVY
>NZ_CP023521.1|WP_162836114.1|2473730_2473895_-|hypothetical-protein
MSRLLITLALIGGLSGCYVAPPYGYAPAPAYYGYAPAYYAPPVSVGIGGNFRIR
>NZ_CP023521.1|WP_021159927.1|2474151_2474571_-|HIT-family-protein
MSYDNNNPFARILRGELPCVKVAEDDTTLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAAGIRMTQRVAAAVRAALEPDGVFIGQFNGAAAGQTVPHVHFHVIPRWEGAELRMHAREIADAATLEALAQRIRARFV
>NZ_CP023521.1|WP_027790395.1|2475111_2476539_+|serine-hydrolase
MTIPFKKPILRGVALAAVAAIGYTGYMLSRLAPVATGYAAKALCSGVYVSGRPAASVIDVDIMAGVHPLLKLVRPSIDPDHHRAVATFAGFAGREADFRPGLGCTLAIGPSPGALPAALPPLPDPPPAPPAPPAQPAPAAPATPPAGIDARKLQTALDRAFDEPDPARPRRTRAVVVMWRGQVIAERYAPGFTADTPLPGWSMTKTVTAALVGALVAQHKLSPDASALLPEWRGSGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVALMLFTQPDTARFASAKPLAATPGTQWSYSSGTSAIVARVMREALGGSGDDYLAFPRRALFAPLGMRSAVFEPDVSGTLVSPSYMYASARDWARFGQLLLQDGVWDGQRLLPDGWVRYLTRATPQSSRQEYGAQLWVKVPEPFNDRDPHAVAMPADAFHAVGHEGQFVSVVPSRQLVVVRLGLSRPESAWNHEAFLARVLDALPAPGA
>NZ_CP023521.1|WP_027790394.1|2476620_2477244_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEQEDWGAGFRTTNDPAYLALNPNALVPVIKDDDFVLWESNTIIRYLANRYGGDALYPAEPQARARVDQWIDWQGADLNRSWVGAFLGLVRKSPDHQDPAGIAQSIAGWTKHMQVLNAQLEKTGAYVAGNTFTLADIPIGLSVNRWFGTPFEHPELPAVSRYIERLATREGFKQYAGSANP
>NZ_CP023521.1|WP_027790393.1|2477316_2478816_-|TIGR01777-family-protein
MNTLPAYDWALNLLIVQGAMGAFDTLYHHELTQDLPHSPRARLELGIHAVRSVLYGLVFASIANVAFHGAWVAALAAVVVVEVVLTLWDFVVEDQSRKLPATERVLHTLLAVNGGALFGMIAMQLAVWAHEPTALQVLDLGWRGGLLSVFAVGVAVSGIRDGIAACRIAQRAPAANPFAGQPPGNVLVTGGTGFIGETLVNHLLDAGHTVTLLARDPLRAAYQFQGRVRSVTSAGQLQPHERFDTVINLAGAPVLGARWSKRRQAVLLASRVGVTESLMRWVETAEVKPRTWIQASAIGYYGVRPSDERLDERSSAGTGFMSGLCRQWEQSAQALERHGVRSVVLRLGLVFGPGGALRPMLMPHYFGMGGRFGDGTQVMSWIHRDDVLRIIARAMSNPGMHGVYNAVAPAPLTQREFVQVVSKVLRRPAFLHVPAAPLRVAMGEMAALLLDGQRVMPARLHQDGFMFRFPTAEHALRDLTNRPHADFPRTACRLPRRRV
>NZ_CP023521.1|WP_027790392.1|2478812_2479688_-|DUF393-domain-containing-protein
MESSELVLYFDGRCPLCVAQIRRLGARDAQQRLAFVDIAGPGFDPAPLGVGLPALNRELHARLPDGRMLTGVDGILAAHALTGRGWLVRLLRVPVVRGVLAPLYRRFARNRHAVSRSLGYRAEAACDGPACGSDRAAEPAEPAADRPARDDMRRIVVTWMYGAALAHLLVGIAVPWVAGTPWLDAYHRVIELHFWAGTAPGPARAQQVWWMSLIGATVQCASVWMLALVHLGNRLRRREVWGWLLAGLAIWAPQDMLFSLQARVSGHVAIDAAALVAMVPPLVWLWRRDTP
>NZ_CP023521.1|WP_021159932.1|2479784_2480255_-|DUF2269-domain-containing-protein
MNTYLVIKALHILSSVLLVGTGFGTAFYLFFANRTQSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHTAGWPWHTPWLLASIVLYAIAGACWLPVVWLQLELASMAKLAHANGDAALPERYWRYAKRWELLGYPAFFAMLSVYFLMVLKPM
>NZ_CP023521.1|WP_027790391.1|2480251_2481571_-|SDR-family-oxidoreductase
MNAVLPSTCPQGRTGARRMTVLVCGANGFIGRALCAQLEAGGHRVLRGVRHATGPCDVAIDFAADIDPDAWLARLKGVDVVINAVGILADRRGATLDAVHRAAPCALFTACCRAGVRRVIQISALGVERGGTRYFASKLAADRFLQTLPIDFRIVRPALVYGTDGASARFFRMLASLPVQVLPAGGRQRLRPVHVDDLAEVVARLVVQPGDATAAGRAVIDVVGNDEVEYREMLARYRAALGFAPAARVTLPGPLAGAAAALLGTLPGAMFTRDTWTMLRGGNTGDPAAVTTMLGRPPRGIDGFIGTEAAALRRDALAMWRRPLLRGALAIVWIWTAIASAFIHPLPASLALLAPAHLTGLPALIALYAASALDFAFGIATVAAPSRRLWAAQAALIVAYSAVIAVTMPALLAEPFGPVLKNVPILAILLILFSEEEQA
>NZ_CP023521.1|WP_006480371.1|2481659_2482193_-|MarR-family-transcriptional-regulator
MELTPIAERFILHWGEMGSRWGVNRTVSQIHALLYLAGRPVAADEIAETLNVARSNVSTSLKELQAWRLAKVVHVLGDRRDHFETSTDIWELFKLIVEGRRQREIEPTLTVLRDCLTNPEIANESRETEQRIRDTLQFVETLTTWSDEMLRLKPDTLMKALGIGAKISQTVRRKPSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	CP047036	Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence	28933-28954	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP047042	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence	28906-28927	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP047900	Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence	72688-72709	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	36889-36910	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	146015-146036	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	36896-36917	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	146039-146060	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	80206-80227	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	124016-124037	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	21990-22011	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	498979-499000	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	36199-36220	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	145343-145364	2	0.909
NZ_CP023521_1	1.3\|2472363\|22\|NZ_CP023521\|CRISPRCasFinder	2472363-2472384	22	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	515843-515864	3	0.864
NZ_CP023521_1	1.2\|2472303\|34\|NZ_CP023521\|CRISPRCasFinder	2472303-2472336	34	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	350060-350093	8	0.765

1. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to CP047036 (Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

2. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP047042 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

3. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP047900 (Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcgccgagccg	Protospacer
*************.*******

4. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

5. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

6. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

7. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

8. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

9. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

10. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgctcaccgagccg	Protospacer
********** **********

11. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgtgccg	Protospacer
***************** ***

12. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

13. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

14. spacer 1.3|2472363|22|NZ_CP023521|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgagttg	Protospacer
*******************..

15. spacer 1.2|2472303|34|NZ_CP023521|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 8, identity: 0.765

gatcgcgccggtgcgctcgcgacgg-----ttcgacgtc	CRISPR spacer
catcgcgcgggtgcgctcgcggcggcggccttcg-----	Protospacer
 ******* ************.***     ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1741302 : 1750284

Burkholderia_virus(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027790966.1\|1741302_1741713_-	TIGR02594 family protein	A0A249Y3Q7	Serratia_phage	4.9e-28	41.0
WP_021157316.1\|1742034_1742259_-	hypothetical protein	NA	NA	NA	NA
WP_027790965.1\|1742539_1742743_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.4e-20	70.1
WP_027790964.1\|1743119_1744031_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.5e-72	46.8
WP_027790963.1\|1744154_1745471_+	MFS transporter	Q6JIH2	Burkholderia_virus	6.9e-132	56.6
WP_027790962.1\|1745484_1746726_+	amidohydrolase family protein	NA	NA	NA	NA
WP_027787261.1\|1746916_1748176_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-43	45.5
WP_021157319.1\|1748421_1750284_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-07	48.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP023518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023518_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023518_1

992508-992580

Orphan

Consensus_repeat	Method
GCTGAAGCGCCAACGGCGGTCGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023518_1

>merge|NZ_CP023518|1|992508-992580|CRISPRCasFinder
GCTGAAGCGCCAACGGCGGTCGACCGCCTTGCATGGGACCGCCCTAAGCGCTGAAGCGCCAAGGGCGGTCGAC

>NZ_CP023518|1|1|992508-992580|CRISPRCasFinder
GCTGAAGCGCCAACGGCGGTCGAC	CGCCTTGCATGGGACCGCCCTAAGC
GCTGAAGCGCCAAGGGCGGTCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023518.1\|WP_027789289.1\|984574_985282_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP023518.1\|WP_027789288.1\|985368_986580_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP023518.1\|WP_027789284.1\|992592_993351_+\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|187629
NZ_CP023518.1\|WP_027789283.1\|993421_994264_-\|SirB1-family-protein	unknown	unknown	gnl\|CDD\|225464
NZ_CP023518.1\|WP_027789281.1\|997290_998220_+\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|234835
NZ_CP023518.1\|WP_027789291.1\|982929_983976_-\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|236193
NZ_CP023518.1\|WP_011352986.1\|986686_987265_-\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|182534
NZ_CP023518.1\|WP_027789280.1\|998310_999360_-\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|234593
NZ_CP023518.1\|WP_027789279.1\|1000062_1000701_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	unknown	unknown	gnl\|CDD\|234691
NZ_CP023518.1\|WP_006482216.1\|990320_990515_+\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP023518.1\|WP_027789285.1\|990635_991427_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|235473
NZ_CP023518.1\|WP_027789278.1\|1000815_1001307_-\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
NZ_CP023518.1\|WP_021162571.1\|991635_992298_+\|adenylate-kinase	unknown	unknown	gnl\|CDD\|234711
NZ_CP023518.1\|WP_006482211.1\|996127_996400_+\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|178943
NZ_CP023518.1\|WP_027789287.1\|987478_988861_-\|exodeoxyribonuclease-VII-large-subunit	unknown	unknown	gnl\|CDD\|234714
NZ_CP023518.1\|WP_021162564.1\|999497_999983_+\|YajQ-family-cyclic-di-GMP-binding-protein	unknown	unknown	gnl\|CDD\|180061
NZ_CP023518.1\|WP_027789290.1\|983968_984493_-\|DUF962-domain-containing-protein	unknown	unknown	gnl\|CDD\|226914
NZ_CP023518.1\|WP_021162567.1\|996556_996877_-\|DUF3579-domain-containing-protein	unknown	unknown	gnl\|CDD\|371904
NZ_CP023518.1\|WP_027789282.1\|994272_995823_-\|murein-biosynthesis-integral-membrane-protein-MurJ	unknown	unknown	gnl\|CDD\|223800
NZ_CP023518.1\|WP_027789286.1\|989311_990340_+\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|179349

Protein	Function_ID	Function_description	E-value
NZ_CP023518.1\|WP_027789289.1\|984574_985282_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	3.48096e-42
NZ_CP023518.1\|WP_027789288.1\|985368_986580_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	2.95611e-81
NZ_CP023518.1\|WP_027789284.1\|992592_993351_+\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	7.10874e-127
NZ_CP023518.1\|WP_027789283.1\|993421_994264_-\|SirB1-family-protein	gnl\|CDD\|225464	COG2912, COG2912, Uncharacterized conserved protein [Function unknown].	9.99259e-73
NZ_CP023518.1\|WP_027789281.1\|997290_998220_+\|ornithine-carbamoyltransferase	gnl\|CDD\|234835	PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional.	0
NZ_CP023518.1\|WP_027789291.1\|982929_983976_-\|2-dehydropantoate-2-reductase	gnl\|CDD\|236193	PRK08229, PRK08229, 2-dehydropantoate 2-reductase; Provisional.	0
NZ_CP023518.1\|WP_011352986.1\|986686_987265_-\|superoxide-dismutase	gnl\|CDD\|182534	PRK10543, PRK10543, superoxide dismutase [Fe].	7.07483e-106
NZ_CP023518.1\|WP_027789280.1\|998310_999360_-\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|234593	PRK00046, murB, UDP-N-acetylmuramate dehydrogenase.	0
NZ_CP023518.1\|WP_027789279.1\|1000062_1000701_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	gnl\|CDD\|234691	PRK00220, PRK00220, glycerol-3-phosphate 1-O-acyltransferase PlsY.	6.69227e-92
NZ_CP023518.1\|WP_006482216.1\|990320_990515_+\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	3.55653e-25
NZ_CP023518.1\|WP_027789285.1\|990635_991427_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	gnl\|CDD\|235473	PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional.	4.14176e-141
NZ_CP023518.1\|WP_027789278.1\|1000815_1001307_-\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	5.80998e-62
NZ_CP023518.1\|WP_021162571.1\|991635_992298_+\|adenylate-kinase	gnl\|CDD\|234711	PRK00279, adk, adenylate kinase; Reviewed.	1.11294e-137
NZ_CP023518.1\|WP_006482211.1\|996127_996400_+\|30S-ribosomal-protein-S20	gnl\|CDD\|178943	PRK00239, rpsT, 30S ribosomal protein S20; Reviewed.	5.46541e-19
NZ_CP023518.1\|WP_027789287.1\|987478_988861_-\|exodeoxyribonuclease-VII-large-subunit	gnl\|CDD\|234714	PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed.	0
NZ_CP023518.1\|WP_021162564.1\|999497_999983_+\|YajQ-family-cyclic-di-GMP-binding-protein	gnl\|CDD\|180061	PRK05412, PRK05412, putative nucleotide-binding protein; Reviewed.	1.64307e-87
NZ_CP023518.1\|WP_027789290.1\|983968_984493_-\|DUF962-domain-containing-protein	gnl\|CDD\|226914	COG4539, COG4539, Predicted membrane protein [Function unknown].	6.57016e-63
NZ_CP023518.1\|WP_021162567.1\|996556_996877_-\|DUF3579-domain-containing-protein	gnl\|CDD\|371904	pfam12112, DUF3579, Protein of unknown function (DUF3579). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 98 to 126 amino acids in length. This protein has a conserved FRP sequence motif.	4.44957e-55
NZ_CP023518.1\|WP_027789282.1\|994272_995823_-\|murein-biosynthesis-integral-membrane-protein-MurJ	gnl\|CDD\|223800	COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only].	1.05828e-147
NZ_CP023518.1\|WP_027789286.1\|989311_990340_+\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|179349	PRK01906, PRK01906, tetraacyldisaccharide 4'-kinase; Provisional.	0

>NZ_CP023518.1|WP_021162571.1|991635_992298_+|adenylate-kinase
MRLILLGAPGAGKGTQANFIKEKFGIPQISTGDMLRAAVKAGTPLGVEAKGYMDAGKLVPDALIIGLVKERLKEADCANGYLFDGFPRTIAQADAMKEAGVAIDYVLEIDVPFSEIIERMSGRRTHPASGRTYHVKFNPPKVEGHDDVTGEPLIQRDDDKEETVKKRLEVYEAQTKPLITYYGDWAQRGEENGLKAPQYRKISGLGAVEEIRERAFDALK
>NZ_CP023518.1|WP_027789285.1|990635_991427_+|3-deoxy-manno-octulosonate-cytidylyltransferase
MTHPQPFIAVIPARLASTRLPNKPLADLGGKPMVVRVAERAREAGAQQVLVASDAQSVLDAARDHGFEAVLTRADHPSGTDRLAEVAATFGWSDDTVVVNVQGDEPLIDPVLVRDVASHLAAHPACAIATAAHPIHDAADVFNPNVVKVALDAQSVALYFSRAPIPWSRDAYQPHWPDVAAMPAPAFPVYRHIGLYAYRARFLRTYPTLAQAPIEQAEQLEQLRALWHGERIAVLITESAPEAGIDTPADLARVQALFQPGPK
>NZ_CP023518.1|WP_006482216.1|990320_990515_+|Trm112-family-protein
MDARLLEIIVCPICKGPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQTVEGTPVDPAGR
>NZ_CP023518.1|WP_027789286.1|989311_990340_+|tetraacyldisaccharide-4'-kinase
MSAPDGPLARLEARLTREWQRRGALAWALTPFACMFGLCAALRRTAYAQGWKKPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTPGIVSRGYGANVKAPTAVTAASRAGAGGDEPLLIARRTGAPVWVCPDRVAAAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHRLGGNGFLLPAGPLREPLSRHRDATLVNDPYSGALPPWPDTYSLALTPGAAWHLDQPALRRPLSQFANERVLAAAGIGAPERFFATLRAAGLAPATRALPDHYAFADNPFVDDAVDAILITEKDAVKLGASWRDARLWVVPVEAALDPRLIALVVEKLRGRSPA
>NZ_CP023518.1|WP_027789287.1|987478_988861_-|exodeoxyribonuclease-VII-large-subunit
MPSDSPFAAPGATRGGDEVIPVSALNRAISTMLERSFPLLWISGEVSNFTRAASGHWYFSIKDQQAQMRCVMFRGRAQYAEFTPREGDRIEVRAVVTMYEPRGEVQLNVEAVRRTGQGRLYEAFLRLKAQLEGEGLFAPERKRPLPAHPRAIGIVTSLQAAALRDVLTTLARRAPHIPVIVYPAPVQGAGSAEKLVAAVETANARREVDVLLVCRGGGSIEDLWSFNDEALARVIAASELPVVSGVGHETDFTIADFAADLRAPTPTGAAELASPQRALLLREVGERQRALARGMERRLEQRAQQLDWLARRLVSPAERLQRQRTHVEQLAVRLASAASRPVRDARARFALAQLRWQRARPDPSQARQALAGLSQRLALALQRRHERDTARVSACAARLEVLSPQRTLERGYAALIDAQTGRAVRTPNALKPQRRLTVHLAEGSADVSLADVQPRLADTI
>NZ_CP023518.1|WP_011352986.1|986686_987265_-|superoxide-dismutase
MAHTLPPLPYAEDALAPTISLETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKSSGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSYDAFKEAFTKAAVGTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVEAFWNIVNWDFAAKNFA
>NZ_CP023518.1|WP_027789288.1|985368_986580_+|chromate-efflux-transporter
MSTSTASAPSLHPWPVFIAFLRLGLTSFGGPVAHLGYFRTEFVTRRAWLTERTYADLVGLCQFLPGPASSQVGMAIGLARAGYAGMFAAWLGFTLPSALLMMLFALGVHATGAPIEAGALHGLRIVSVAVIAQAVWGMARTLCPDARRVTLMAAAASVALLAPAAWTQIAVIVAAGLAGLVLLPQPARGTHDPLPLHVSPRAGALWLALFAALLVVLPLAARALRSDTLAVVDAFFRTGALVFGSGHVVLPLLQAAVVAPGWVGDAAFLAGYGVAQAVPGPLFTFSAFLGASLRQAPTGWLGGTIALVSIFAPSFLLVAGTAPFWERLRRSTRMQAALAGVNAAVVGLLLAALYHPVWTDTIMAPRDLAAALVAFVALVFWRVPPWAVVIASAALGWGLGLLA
>NZ_CP023518.1|WP_027789289.1|984574_985282_+|Crp/Fnr-family-transcriptional-regulator
MPSSLAPYLPQIEANPWFAALPPALRADLLARAALRRLPAGHALFRRGDPPCGLYAVLAGSLTIGAVDPQGKEALLTVAEPVTWFGEIALFDGQPRTHDAIALDDALLLHVPQAALLAILDATPQYWRQFALLMAQKLRLSFLTVESMSVMPAAQRLAARLLMIADGYGGISAGRTRIRLSQEKLAAMLSLTRQTTNQLLKALQADGVVRLHVGEIELVDVDALRRASGLPDGMR
>NZ_CP023518.1|WP_027789290.1|983968_984493_-|DUF962-domain-containing-protein
MKTLEDHLSQYAAYHRDARNIATHLVGIPMIVFAVEVLLSRPALGMPAGVALSPALLLAVAFAAFYLRLDLRFGIVMTALFALSLWAAQALALLPTAQWLATGIGAFVVGWIVQFVGHWFEGRKPAFVDDLVGLVVGPLFVVAEVAFFAGLRGEVRREVERRAGPVHGGAHSHV
>NZ_CP023518.1|WP_027789291.1|982929_983976_-|2-dehydropantoate-2-reductase
MSDAPVCVFGAGAVGCYLGGRLAAAGAKVTLVGRARIGDAIRRHGLTLTDRRGYRATLAPADVVFTTDPAAAAAARLVLVAVKSAATREAAAQLAGVLRPGTVVISFQNGLHNADVLREALPQATVLAGMVPFNVIERGPGAFHQGSAGALAADASPALQPFADAFARAGLPLELHRDMRAVQWAKLLLNLNNAVNALANLPLRDELAQRAYRRCVALAQREALHCLALAAIRPARLTPLPAAWIPAVLDLPDFAFRVLGGRMLAIDPLARSSMSDDLAAQRATEVEWINGEVVRLAARVGAQAPVNARLCALVHDAERAAARPAWRGDALWAELTAQAVRAGDVRAA
>NZ_CP023518.1|WP_027789284.1|992592_993351_+|3-hydroxyacyl-CoA-dehydrogenase
MEIRGNVFLITGGASGLGAGTARMLAQAGGTVVLADLNDTAGTALAAELGGIFVHCDVSSETDAQSAVDAATRAGTLRGLVNCAGIAPAAKTVGKDGAHPLDVFAKTINVNLIGTFNMIRLAAAAMAATAPTAEGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRNGIRVMTIAPGLFETPMLLGMPQDVQDALGAMVPFPPRLGKPAEYALLVRQIVENPMLNGEVIRLDGAIRMQPK
>NZ_CP023518.1|WP_027789283.1|993421_994264_-|SirB1-family-protein
MTRVLDYFSTLVADDDSLPVTEAALSLAQDAYPDLDLQGTLAELDMLAARLRRRLADDTDLKGRVAALNDFFFRELGFACNHNDYYDPDNSHLNAVLKRRRGIPISLSVLYLELAEQIGVPARGVSFPGHFLLRVTLPDGDLIIDPANGHSLSEAEMVEMLEPYVARAAGAVDSALRALLQPATSREIIARMLRNLKTIYLQTERWQRLLAVQQRLVILLPEHLDEVRDRGFAYARLDYLRPALEDLEQYLGERPDADDATVVESQVTELRQRMQRDGED
>NZ_CP023518.1|WP_027789282.1|994272_995823_-|murein-biosynthesis-integral-membrane-protein-MurJ
MNLFRALLTVSGFTLLSRVTGLARETLIARAFGASQYTDAFYVAFRIPNLLRRLSAEGAFSQAFVPILAEFKNQQGHDATKALVDAMSTVLAWALAVLSVFGIAGASWVVFAVASGLHTDGQAFPLAVTMTRIMFPYIVFISLTTLASGVLNTYKSFSLPAFAPVLLNVAFIAAAVFVAPHLKVPVFALAWAVIVGGVLQFLVQLPGLKKIDMVPLIGLNPLRALRHPGVKRVLAKMVPATFAVSVAQLSLIINTNIASRLGQGAVSWINYADRLMEFPTALLGVALGTILLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDGHTVTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQISNYVFVPLIGHAGLTLSIGVGACLNSLLLFLGLRKRGIYQPSPGWLRFFVQLIGAALVLAGLMHWLSISFDWTGMRTQPLDRIALMAACLVLFAALYFGMLWVMGFKYAYFRRRAK
>NZ_CP023518.1|WP_006482211.1|996127_996400_+|30S-ribosomal-protein-S20
MANSAQARKRARQAAKANSHNSALRSKFRTAIKSVRKAVEAGDQAKAAELFKAAVKTIDTIADKKIVHKNKAARSKSRLAAAVKGLQAAA
>NZ_CP023518.1|WP_021162567.1|996556_996877_-|DUF3579-domain-containing-protein
MAETPPTEFFIQGITKDGKKFRPSDWSERLAGVMACFGPGASGPNARLKYSLYVRPTMLGDLKCVILDSRLRDVEPMAFDFVLNFAKDNNLVVTEACELPDYDAKK
>NZ_CP023518.1|WP_027789281.1|997290_998220_+|ornithine-carbamoyltransferase
MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEIIQRFADNSRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFKLRLSTPPGYALDMKLVSPDSAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEARKQAFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALMEFLLLGRLKH
>NZ_CP023518.1|WP_027789280.1|998310_999360_-|UDP-N-acetylmuramate-dehydrogenase
MPMPPDDSALSLFPDHPLAAHNTFGIAATARLAARVTHASQFEALHRDPRVANLPRLVLGGGSNVVFTRDFDGIVLLDEIKGRRVVREDDDAWYVEAGGGENWHAFVAWTLEHGMPGLENLALIPGTVGAAPIQNIGAYGLEMKVYFDSLVAVELATGRSERFDAARCAFGYRDSFFKREGAGRFAIVSVTFRLPKQWAPRLGYADVTRELDARGIAPDAAAPRDVFDAVVAIRRAKLPDPLVLGNAGSFFKNPVIDAAQFEALRARAPEIVSYPQPDGQVKLAAGWLIDRCGWKGRVLGAAAVHDRQALVLVNRGGATGADVLALARAIQADVRAHFGVELEPEPVCL
>NZ_CP023518.1|WP_021162564.1|999497_999983_+|YajQ-family-cyclic-di-GMP-binding-protein
MPSFDVVSEANMIEVKNAIEQSNKEISTRFDFKGSDARVEQKERELTLFADDDFKLGQVKDVLIGKLAKRNVDVRFLDYGKVEKIGGDKVKQIVTVKKGVTGDLAKKIVRLVKDSKIKVQASIQGDAVRVSGTKRDDLQSTIAMLRKDVTDTPLDFNNFRD
>NZ_CP023518.1|WP_027789279.1|1000062_1000701_-|glycerol-3-phosphate-1-O-acyltransferase-PlsY
MQILLAALVAYLIGSVSFAVVVSGAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGDAFKGWIAVWLARRFGLPDVAVAWVAIAVFLGHLYPVFFRFQGGKGVATAAGVLLAVHPVLGLATALTWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTGHNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIGDKKKAAADGGAQDGGKA
>NZ_CP023518.1|WP_027789278.1|1000815_1001307_-|Cys-tRNA(Pro)-deacylase
MSKSRHVSETPATQLLRRHGVAFGEHPYDYVEHGGTGESARQLGVDEHSVVKTLVMEDEHAKPLIVLMHGDRTVSTKNLARQIGAKRVEPCKPEVANRHSGYLVGGTSPFGTRKTMPVYVEATILELPTIYLNGGRRGYLVSLAPAVLTSLLGAQPVQCASVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP023518_1	1.1\|992532\|25\|NZ_CP023518\|CRISPRCasFinder	992532-992556	25	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1258766-1258790	3	0.88
NZ_CP023518_1	1.1\|992532\|25\|NZ_CP023518\|CRISPRCasFinder	992532-992556	25	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1263435-1263459	3	0.88

1. spacer 1.1|992532|25|NZ_CP023518|CRISPRCasFinder matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 3, identity: 0.88

cgccttgcatgggaccgccctaagc	CRISPR spacer
agccttgcatgggaccggactaagc	Protospacer
 ****************  ******

2. spacer 1.1|992532|25|NZ_CP023518|CRISPRCasFinder matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 3, identity: 0.88

cgccttgcatgggaccgccctaagc	CRISPR spacer
agccttgcatgggaccggactaagc	Protospacer
 ****************  ******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

63934 : 103639

Leptospira_phage(16.67%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088611350.1\|63934_65034_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-35	36.3
WP_138143282.1\|65710_68200_-	hypothetical protein	NA	NA	NA	NA
WP_088611304.1\|68610_69820_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.0e-97	62.4
WP_027787261.1\|70173_71433_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-43	45.5
WP_138143283.1\|72270_72684_-	hypothetical protein	NA	NA	NA	NA
WP_027787260.1\|72694_73582_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_027787258.1\|73602_74490_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_027787257.1\|74491_75829_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027787256.1\|75825_76929_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_027787255.1\|76925_78278_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_080982084.1\|78274_79024_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_027787253.1\|79533_79788_+	hypothetical protein	NA	NA	NA	NA
WP_080982120.1\|79726_80128_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_027787252.1\|80352_81198_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_006485265.1\|81611_82178_-	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_006491801.1\|82297_83038_-	3-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_027787251.1\|83172_84354_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_027787250.1\|84453_86319_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_027787249.1\|86678_87518_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_027787248.1\|87524_88733_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_021163132.1\|88774_89599_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_027787247.1\|89703_91950_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	4.8e-77	29.3
WP_006478692.1\|92005_92221_-	YdcH family protein	NA	NA	NA	NA
WP_027787246.1\|92298_93051_-	hypothetical protein	NA	NA	NA	NA
WP_027787245.1\|93211_95536_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_034195767.1\|95952_96981_+	sesquiterpene cyclase	NA	NA	NA	NA
WP_027787243.1\|97003_98920_-	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	1.1e-77	32.7
WP_021163124.1\|99196_99793_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_011352252.1\|99799_101146_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	2.6e-70	36.6
WP_027787242.1\|101259_102408_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_011352254.1\|102511_102703_-	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_027787241.1\|102739_103639_-\|protease	protease modulator HflC	NA	NA	NA	NA

DBSCAN-SWA_2

380698 : 472634

uncultured_Caudovirales_phage(25.0%)

portal,protease,integrase,capsid,holin,transposase,terminase,plate,tRNA,head,tail

attL 417104:417126|attR 460904:460926

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027787063.1\|380698_382108_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_027787062.1\|382388_383315_+	patatin-like phospholipase family protein	A0A1V0SKV5	Klosneuvirus	1.7e-07	27.2
WP_027787061.1\|383459_384134_-	C40 family peptidase	A0A217EQL1	Bacillus_phage	1.2e-20	40.8
WP_027787060.1\|384262_385885_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-20	32.7
WP_021162484.1\|385881_386979_-	ABC transporter permease	NA	NA	NA	NA
WP_027787059.1\|387027_388071_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_148668953.1\|388121_388805_-	hypothetical protein	NA	NA	NA	NA
WP_148668954.1\|389589_389814_+	hypothetical protein	NA	NA	NA	NA
WP_027787057.1\|390129_390495_-	hypothetical protein	NA	NA	NA	NA
WP_011352504.1\|390824_391157_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_021162482.1\|391157_391766_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_021162481.1\|391765_393772_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_027787056.1\|393775_394663_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_027787055.1\|394933_396463_-	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_138143286.1\|397057_397435_+	hypothetical protein	NA	NA	NA	NA
WP_027787053.1\|397832_398231_-	heme-binding protein	NA	NA	NA	NA
WP_027787052.1\|398223_399000_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_034195760.1\|399068_400001_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_027787050.1\|400623_401877_-	aspartate kinase	NA	NA	NA	NA
WP_027787049.1\|402220_403642_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_006478433.1\|403688_404660_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_027787048.1\|404763_405591_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_027787047.1\|405634_407032_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	4.1e-42	30.9
WP_027787046.1\|407266_407989_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_021162660.1\|408028_408610_+	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.2e-11	38.5
WP_006751616.1\|408698_409190_+	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	1.7e-06	29.6
WP_027787045.1\|409217_410018_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_021162662.1\|410076_410850_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_027787044.1\|411157_411982_-	RNA methyltransferase	NA	NA	NA	NA
WP_027787043.1\|412262_413066_+	inositol monophosphatase	NA	NA	NA	NA
WP_027787042.1\|413391_415014_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_100199223.1\|415167_415911_-	AAA family ATPase	NA	NA	NA	NA
417104:417126	attL	NA	NA	NA	NA
WP_027787040.1\|417285_418002_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_049096236.1\|418222_419173_+	hypothetical protein	NA	NA	NA	NA
WP_027787038.1\|419366_420845_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.5e-15	35.8
WP_081040819.1\|421069_421393_-	immunity 52 family protein	A4PE26	Ralstonia_virus	1.4e-17	48.0
WP_059633410.1\|421798_422410_-	hypothetical protein	NA	NA	NA	NA
WP_080982199.1\|422297_422768_-	hypothetical protein	NA	NA	NA	NA
WP_027787035.1\|422757_423255_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_158605805.1\|423261_423645_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_027787034.1\|423866_424652_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	9.7e-134	83.2
WP_027787033.1\|424822_425317_-	DUF2514 family protein	C7BGD9	Burkholderia_phage	2.0e-39	59.5
WP_027787032.1\|425313_425808_-	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	7.6e-76	86.6
WP_027787031.1\|425810_426095_-\|holin	phage holin family protein	C7BGD7	Burkholderia_phage	3.8e-40	95.7
WP_027787030.1\|426171_427221_-	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	3.6e-83	47.5
WP_027789299.1\|427230_427437_-\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.5e-14	58.2
WP_027787029.1\|427411_428290_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	8.9e-35	37.5
WP_027787028.1\|428300_430742_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	3.5e-57	38.1
WP_027787027.1\|430822_431125_-\|tail	phage tail assembly protein	A0A1B2LRV6	Wolbachia_phage	2.7e-07	39.0
WP_027787026.1\|431221_431725_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	2.1e-44	54.3
WP_027787025.1\|431735_432905_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	2.5e-157	71.8
WP_027787024.1\|432989_433769_-\|tail	tail assembly chaperone	E5E3Q6	Burkholderia_phage	1.2e-56	57.1
WP_174543632.1\|433784_435185_-\|tail	tail fiber protein	E5E3V2	Burkholderia_phage	2.2e-104	53.8
WP_088611304.1\|435360_436570_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.0e-97	62.4
WP_034195755.1\|437110_437689_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	5.6e-30	44.1
WP_027787018.1\|437678_438575_-\|plate	baseplate J/gp47 family protein	A0A218M4K5	Erwinia_phage	3.9e-46	41.0
WP_034195754.1\|438571_438907_-	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.9e-23	48.1
WP_027787016.1\|438906_439107_-	hypothetical protein	NA	NA	NA	NA
WP_027787015.1\|439166_439847_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	4.9e-17	28.5
WP_027787014.1\|439850_440375_-	hypothetical protein	Q75QM3	Wolbachia_phage	1.1e-24	41.2
WP_027787013.1\|440364_440895_-\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	9.2e-11	31.0
WP_027787012.1\|440897_441185_-	hypothetical protein	NA	NA	NA	NA
WP_027787011.1\|441186_442182_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	7.3e-118	62.7
WP_027787010.1\|442255_442600_-\|head	head decoration protein	NA	NA	NA	NA
WP_027787009.1\|442630_443707_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.4e-52	38.5
WP_027787008.1\|443703_445197_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	5.8e-135	51.4
WP_027787007.1\|445193_445400_-	hypothetical protein	A0A219Y8X9	Aeromonas_phage	8.5e-05	52.1
WP_027787006.1\|445413_447399_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.0e-179	53.4
WP_172535148.1\|447400_447931_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_174543642.1\|448396_449056_-	hypothetical protein	NA	NA	NA	NA
WP_027787004.1\|449065_449908_-	DUF4747 family protein	NA	NA	NA	NA
WP_027787003.1\|450273_450861_-	hypothetical protein	NA	NA	NA	NA
WP_027787002.1\|451081_453589_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	4.9e-94	39.8
WP_099318678.1\|453638_454124_-	hypothetical protein	K7ZPX8	Xanthomonas_citri_phage	2.1e-09	33.5
WP_027787000.1\|454401_454785_-	hypothetical protein	NA	NA	NA	NA
WP_027786999.1\|454786_455314_-	hypothetical protein	C7BGG0	Burkholderia_phage	2.0e-29	47.1
WP_080982019.1\|455703_456132_+	transcriptional regulator	A0A0P0J076	Acinetobacter_phage	3.4e-16	63.5
WP_027786997.1\|456589_456808_+	hypothetical protein	NA	NA	NA	NA
WP_027786996.1\|456858_457221_+	hypothetical protein	NA	NA	NA	NA
WP_027786995.1\|457220_458705_+	hypothetical protein	NA	NA	NA	NA
WP_027786994.1\|458701_459169_+	hypothetical protein	NA	NA	NA	NA
WP_080982086.1\|459177_459420_+	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	4.9e-20	63.2
WP_027786993.1\|459397_460672_-\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	1.6e-146	57.8
WP_049098137.1\|460831_463522_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	4.8e-23	23.6
460904:460926	attR	NA	NA	NA	NA
WP_034195751.1\|463502_464774_+	membrane protein	NA	NA	NA	NA
WP_027786990.1\|464753_465296_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_027786989.1\|465328_466549_+	cupin domain-containing protein	NA	NA	NA	NA
WP_034195863.1\|466780_467044_+	hypothetical protein	NA	NA	NA	NA
WP_027786988.1\|467157_467934_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_027786987.1\|467938_469084_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_027786986.1\|469195_470101_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_027786985.1\|470149_470752_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011352534.1\|470760_471963_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_027786984.1\|471971_472634_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_3

2125291 : 2163795

Burkholderia_phage(50.0%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027788532.1\|2125291_2125819_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.7e-21	52.0
WP_080981881.1\|2126122_2126368_+	helix-turn-helix transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	1.5e-32	90.1
WP_138143304.1\|2126971_2128369_-	hypothetical protein	NA	NA	NA	NA
WP_080981880.1\|2128613_2128745_+	AlpA family phage regulatory protein	E5E3Y1	Burkholderia_phage	8.2e-14	88.1
WP_027788530.1\|2128939_2129674_-	response regulator transcription factor	NA	NA	NA	NA
WP_080981879.1\|2129675_2130761_-	histidine kinase	NA	NA	NA	NA
WP_027788528.1\|2131175_2131718_+	hypothetical protein	NA	NA	NA	NA
WP_027788527.1\|2132072_2132276_+	hypothetical protein	NA	NA	NA	NA
WP_027788526.1\|2132335_2133136_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_027788525.1\|2133969_2134278_+	hypothetical protein	NA	NA	NA	NA
WP_138143305.1\|2134955_2135297_+	hypothetical protein	NA	NA	NA	NA
WP_027788523.1\|2135558_2135882_+	hypothetical protein	NA	NA	NA	NA
WP_027788522.1\|2136169_2136751_+	hypothetical protein	NA	NA	NA	NA
WP_027788521.1\|2136854_2137343_+	DUF4265 domain-containing protein	NA	NA	NA	NA
WP_049096227.1\|2137396_2137849_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_027788519.1\|2137838_2138198_+	hypothetical protein	NA	NA	NA	NA
WP_049096226.1\|2138194_2138890_+	hypothetical protein	NA	NA	NA	NA
WP_027788517.1\|2138982_2139765_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_011350756.1\|2139761_2141108_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027788516.1\|2141210_2141822_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_027788515.1\|2142195_2142834_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_027788514.1\|2142878_2143394_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006477094.1\|2143409_2144900_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006477093.1\|2144970_2145474_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_021161818.1\|2145818_2146304_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_027788513.1\|2146381_2148217_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_027788512.1\|2148180_2149281_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_027788511.1\|2149607_2152277_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	3.5e-90	31.8
WP_027788510.1\|2152316_2153438_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_027788509.1\|2153523_2154453_-	OmpA family protein	NA	NA	NA	NA
WP_027788508.1\|2154457_2155447_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_027788507.1\|2155443_2159388_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_021161809.1\|2159689_2160535_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_027788506.1\|2160656_2161616_+	hypothetical protein	NA	NA	NA	NA
WP_027788505.1\|2161822_2162848_+	transporter	NA	NA	NA	NA
WP_027788504.1\|2162844_2163795_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

2815913 : 2824203

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027788058.1\|2815913_2817314_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.8e-77	38.3
WP_051363294.1\|2817321_2818272_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	7.6e-16	27.5
WP_027788057.1\|2818335_2819328_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.5e-27	30.9
WP_021157453.1\|2819401_2819749_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_027788056.1\|2819963_2820866_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.7e-52	40.2
WP_080982007.1\|2820944_2822288_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_021157450.1\|2822331_2823255_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	6.7e-41	34.9
WP_027788054.1\|2823282_2824203_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	8.7e-17	27.2

DBSCAN-SWA_5

3428235 : 3437473

Pseudomonas_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027787629.1\|3428235_3429195_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.0e-28	37.6
WP_006476104.1\|3429252_3429468_+	TOBE domain-containing protein	NA	NA	NA	NA
WP_027787628.1\|3429607_3429805_+	hypothetical protein	NA	NA	NA	NA
WP_027787627.1\|3429859_3430105_+	hypothetical protein	NA	NA	NA	NA
WP_027787626.1\|3430329_3430599_-	pyocin activator PrtN family protein	I6NSR8	Burkholderia_phage	1.3e-21	61.4
WP_027787625.1\|3430595_3431378_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	4.9e-37	40.4
WP_027787624.1\|3431374_3431863_-	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	1.6e-38	50.6
WP_027787623.1\|3431859_3432297_-	hypothetical protein	A0A097EYP5	Mycobacterium_phage	6.8e-20	48.1
WP_138143316.1\|3432702_3432990_-	hypothetical protein	NA	NA	NA	NA
WP_027787622.1\|3432986_3434066_-	hypothetical protein	NA	NA	NA	NA
WP_027787621.1\|3434058_3434826_-	hypothetical protein	A0A1J0GVP2	Pseudoalteromonas_phage	1.9e-65	45.1
WP_027787620.1\|3434889_3435645_-	hypothetical protein	A0A1R3Y5Q7	Salmonella_virus	4.7e-69	53.0
WP_174543627.1\|3435641_3435989_-	hypothetical protein	NA	NA	NA	NA
WP_027787619.1\|3436070_3436460_-	hypothetical protein	A0A1S6L2W9	Erwinia_phage	2.7e-44	73.7
WP_027787618.1\|3436477_3437473_-	RNA-directed DNA polymerase	H7BVN7	unidentified_phage	3.2e-41	35.7

DBSCAN-SWA_6

3441186 : 3519432

108

Burkholderia_phage(38.1%)

tRNA,integrase,capsid,terminase,plate,portal,head,tail

attL 3481345:3481393|attR 3526370:3526418

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158605810.1\|3441186_3441933_-	hypothetical protein	K7PK07	Enterobacteria_phage	2.9e-18	35.0
WP_063623143.1\|3442078_3442396_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034195786.1\|3443167_3443467_+	hypothetical protein	NA	NA	NA	NA
WP_027787610.1\|3443837_3444692_+	hypothetical protein	Q8W6P2	Burkholderia_virus	5.5e-90	65.9
WP_081040784.1\|3444688_3445774_+	helix-turn-helix domain-containing protein	A4JX55	Burkholderia_virus	1.5e-63	48.6
WP_027787607.1\|3445770_3446316_+	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	2.6e-29	46.0
WP_099318686.1\|3446327_3446720_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_027787606.1\|3446716_3446983_+	hypothetical protein	NA	NA	NA	NA
WP_027787605.1\|3446979_3447423_+	DUF1364 family protein	Q3HR02	Burkholderia_phage	9.2e-73	87.8
WP_027787604.1\|3447425_3447758_+	hypothetical protein	A4JX59	Burkholderia_virus	2.6e-40	70.0
WP_051363288.1\|3447754_3447994_+	hypothetical protein	A4JX60	Burkholderia_virus	3.7e-12	42.3
WP_051363303.1\|3448280_3448490_+	hypothetical protein	NA	NA	NA	NA
WP_081040786.1\|3448953_3449388_+	DUF4406 domain-containing protein	L7TKQ2	Pseudomonas_virus	4.5e-24	56.2
WP_027787599.1\|3449384_3449705_+	hypothetical protein	NA	NA	NA	NA
WP_081040814.1\|3449779_3450088_+	hypothetical protein	A0A1L7N0Z9	Ralstonia_phage	5.5e-24	49.5
WP_027787597.1\|3450112_3450337_+	hypothetical protein	NA	NA	NA	NA
WP_027787596.1\|3450333_3450702_+	DUF2591 family protein	F8TVJ2	EBPR_siphovirus	5.4e-10	38.4
WP_027787595.1\|3450710_3450947_+	hypothetical protein	NA	NA	NA	NA
WP_057056459.1\|3450974_3451547_+	hypothetical protein	NA	NA	NA	NA
WP_027787593.1\|3451824_3452127_+	hypothetical protein	NA	NA	NA	NA
WP_027787592.1\|3452128_3452707_+\|tail	phage tail protein	A0A067ZG41	Vibrio_phage	1.0e-10	32.1
WP_027787591.1\|3452911_3453505_+	hypothetical protein	NA	NA	NA	NA
WP_081040788.1\|3453557_3455594_+\|terminase	phage terminase large subunit family protein	A0A2K9V3X4	Faecalibacterium_phage	5.5e-96	35.7
WP_027787589.1\|3455601_3455847_+	hypothetical protein	NA	NA	NA	NA
WP_027787588.1\|3455846_3457517_+\|portal	phage portal protein	V5Q9Y6	Xylella_phage	1.1e-73	35.8
WP_027787587.1\|3457513_3458380_+	S49 family peptidase	G8DCP1	Silicibacter_phage	1.6e-49	52.1
WP_051363286.1\|3458408_3459029_+	hypothetical protein	NA	NA	NA	NA
WP_051363285.1\|3459071_3460004_+\|head	head decoration protein	NA	NA	NA	NA
WP_027787586.1\|3460112_3461177_+\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	1.8e-53	37.5
WP_027787585.1\|3461177_3461510_+	hypothetical protein	NA	NA	NA	NA
WP_027787584.1\|3461506_3462064_+	hypothetical protein	NA	NA	NA	NA
WP_027787583.1\|3462075_3462273_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_027787582.1\|3462269_3463772_+\|tail	phage tail sheath subtilisin-like domain-containing protein	B5TK67	Pseudomonas_phage	3.9e-107	46.5
WP_034195783.1\|3463835_3464207_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_051363284.1\|3464209_3464497_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_027787579.1\|3464642_3466400_+	hypothetical protein	NA	NA	NA	NA
WP_027787578.1\|3466403_3467861_+	DNA circularization N-terminal domain-containing protein	A0A2P9JZK2	Alteromonadaceae_phage	2.1e-12	24.4
WP_027787577.1\|3467864_3468947_+	hypothetical protein	B5TK72	Pseudomonas_phage	1.7e-43	32.9
WP_027787576.1\|3468943_3469546_+\|plate	phage baseplate assembly protein V	A0A192Y8K5	Salmonella_phage	2.3e-10	31.9
WP_034195782.1\|3469542_3469992_+	phage GP46 family protein	B5TAA8	Burkholderia_phage	1.3e-10	31.3
WP_081040790.1\|3469992_3471105_+\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	1.0e-19	26.9
WP_081040791.1\|3471116_3471758_+	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_138143318.1\|3471770_3472682_+	hypothetical protein	O22004	Shigella_phage	1.8e-06	46.2
WP_051363283.1\|3472697_3473234_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_099318693.1\|3475136_3475841_+	lysozyme	A0A059VA40	Pseudomonas_phage	2.6e-29	42.2
WP_027787569.1\|3475918_3476554_+	hypothetical protein	NA	NA	NA	NA
WP_034195779.1\|3476556_3476751_+	hypothetical protein	NA	NA	NA	NA
WP_027787568.1\|3476793_3477477_+	hypothetical protein	NA	NA	NA	NA
WP_027787567.1\|3477473_3477782_+	hypothetical protein	A0A1B2IBL3	Erwinia_phage	6.7e-22	54.4
WP_027787566.1\|3477778_3478378_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_027787565.1\|3478396_3478612_-	hypothetical protein	NA	NA	NA	NA
WP_027787564.1\|3479019_3480099_-\|integrase	tyrosine-type recombinase/integrase	I6NSG1	Burkholderia_phage	2.1e-110	54.5
WP_081040793.1\|3480219_3481260_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
3481345:3481393	attL	NA	NA	NA	NA
WP_080981894.1\|3481480_3482575_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_027787562.1\|3482502_3482709_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_027787561.1\|3482711_3483725_-	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	1.6e-117	62.5
WP_111946790.1\|3483721_3484480_-	hypothetical protein	Q8W6Q9	Burkholderia_virus	1.5e-30	52.9
WP_027787560.1\|3484476_3484872_-	hypothetical protein	Q6JII6	Burkholderia_virus	1.7e-46	70.2
WP_027787559.1\|3484882_3485878_-	RNA-directed DNA polymerase	A0A0N7AE80	Bacillus_phage	1.7e-45	34.6
WP_027787558.1\|3486221_3486578_-	four helix bundle protein	NA	NA	NA	NA
WP_027787557.1\|3486592_3487057_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_027787556.1\|3487087_3487450_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_027787555.1\|3487539_3488163_-	hypothetical protein	A9YX18	Burkholderia_phage	3.7e-19	92.6
WP_027787554.1\|3488159_3489926_-	AAA family ATPase	J7HXJ7	Pseudomonas_phage	3.0e-74	35.8
WP_027787553.1\|3489938_3490997_-	hypothetical protein	H2BD49	Pseudomonas_phage	1.1e-76	54.9
WP_027787552.1\|3491011_3491821_-	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	6.1e-91	61.3
WP_167562609.1\|3491820_3491985_-	hypothetical protein	NA	NA	NA	NA
WP_027787551.1\|3491981_3492164_-	hypothetical protein	A9YWW6	Burkholderia_phage	1.0e-06	73.0
WP_027787550.1\|3492163_3492493_-	hypothetical protein	NA	NA	NA	NA
WP_034195891.1\|3492627_3493053_-	hypothetical protein	NA	NA	NA	NA
WP_027787548.1\|3493086_3493467_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_081040797.1\|3494300_3494699_-	hypothetical protein	C7BGF7	Burkholderia_phage	6.8e-51	76.5
WP_027787547.1\|3494783_3495038_+	Cro/Cl family transcriptional regulator	C7BGF8	Burkholderia_phage	8.8e-20	60.0
WP_027787546.1\|3495034_3495262_+	hypothetical protein	NA	NA	NA	NA
WP_138143319.1\|3495261_3495552_+	hypothetical protein	NA	NA	NA	NA
WP_027787544.1\|3495663_3495888_+	hypothetical protein	NA	NA	NA	NA
WP_027787543.1\|3495884_3496097_+	hypothetical protein	NA	NA	NA	NA
WP_080981926.1\|3496159_3497209_+	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	4.4e-33	59.0
WP_027787542.1\|3497205_3497571_+	hypothetical protein	Q3HQZ9	Burkholderia_phage	4.8e-51	80.5
WP_027787541.1\|3497670_3498000_+	hypothetical protein	A9YWZ0	Burkholderia_phage	1.9e-22	64.9
WP_027787540.1\|3497996_3498590_+	hypothetical protein	A9YWZ1	Burkholderia_phage	6.1e-80	77.4
WP_027787539.1\|3498697_3498877_+	hypothetical protein	NA	NA	NA	NA
WP_027787538.1\|3498873_3499527_+	hypothetical protein	A9YWZ4	Burkholderia_phage	2.1e-105	85.9
WP_027787537.1\|3499547_3500027_+	DUF2280 domain-containing protein	A9YWZ5	Burkholderia_phage	3.3e-68	83.6
WP_027787536.1\|3500028_3501630_+	bacteriophage TerL protein	A9YWZ6	Burkholderia_phage	1.7e-289	89.6
WP_027787535.1\|3501626_3503210_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	4.6e-151	61.0
WP_138143324.1\|3503193_3503790_+\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	1.5e-81	77.2
WP_027787533.1\|3503791_3505096_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	1.6e-72	47.3
WP_027787532.1\|3505108_3505597_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	4.7e-38	56.8
WP_027787531.1\|3505607_3506645_+	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	1.1e-124	67.7
WP_027787530.1\|3506654_3507092_+	hypothetical protein	NA	NA	NA	NA
WP_027787529.1\|3507147_3507531_+	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	1.2e-52	75.6
WP_027787528.1\|3507559_3508042_+	hypothetical protein	A9YX26	Burkholderia_phage	1.6e-70	84.9
WP_027787527.1\|3508045_3508417_+	hypothetical protein	A9YX28	Burkholderia_phage	2.2e-59	87.0
WP_027787526.1\|3508421_3509012_+	hypothetical protein	A9YX29	Burkholderia_phage	2.8e-85	79.0
WP_027787525.1\|3509021_3510833_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	4.6e-94	38.8
WP_027787524.1\|3510848_3511289_+	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	4.9e-42	58.2
WP_034195778.1\|3511291_3511825_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.8e-22	40.0
WP_034195777.1\|3511821_3512007_+	hypothetical protein	NA	NA	NA	NA
WP_027787522.1\|3511999_3513856_+	glucosaminidase domain-containing protein	A0A0M4REK7	Salmonella_phage	1.6e-38	41.4
WP_027787521.1\|3513852_3514452_+	hypothetical protein	A0A2H4J1B3	uncultured_Caudovirales_phage	3.1e-23	40.1
WP_027787520.1\|3514451_3514766_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	1.6e-18	47.0
WP_027787519.1\|3514765_3515758_+	hypothetical protein	A9YX04	Burkholderia_phage	3.6e-101	67.3
WP_155253125.1\|3515754_3516330_-	hypothetical protein	NA	NA	NA	NA
WP_027787517.1\|3516423_3517167_+	hypothetical protein	A9YX06	Burkholderia_phage	6.4e-103	78.1
WP_027787516.1\|3517175_3517529_+	hypothetical protein	A9YX11	Burkholderia_phage	1.6e-40	72.6
WP_027787515.1\|3517525_3518713_+\|plate	baseplate J/gp47 family protein	A9YX12	Burkholderia_phage	3.4e-146	70.4
WP_027787514.1\|3518715_3519432_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	8.7e-81	68.2
3526370:3526418	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP023521

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP023518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection