CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP010775	Phaeobacter piscinae strain P13 plasmid pP13_h, complete sequence	0 crisprs	NA	2
NZ_CP010772	Phaeobacter piscinae strain P13 plasmid pP13_e, complete sequence	0 crisprs	csa3	0
NZ_CP010769	Phaeobacter piscinae strain P13 plasmid pP13_b, complete sequence	0 crisprs	NA	1
NZ_CP010773	Phaeobacter piscinae strain P13 plasmid pP13_f, complete sequence	0 crisprs	NA	0
NZ_CP010770	Phaeobacter piscinae strain P13 plasmid pP13_c, complete sequence	0 crisprs	NA	0
NZ_CP010767	Phaeobacter piscinae strain P13 chromosome, complete genome	1 crisprs	cas3,WYL,csa3,DEDDh	2
NZ_CP010768	Phaeobacter piscinae strain P13 plasmid pP13_a, complete sequence	0 crisprs	NA	0
NZ_CP010771	Phaeobacter piscinae strain P13 plasmid pP13_d, complete sequence	0 crisprs	NA	0
NZ_CP010774	Phaeobacter piscinae strain P13 plasmid pP13_g, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6385 : 16626

Streptococcus_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096873665.1\|6385_7495_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	8.9e-08	32.5
WP_000480968.1\|7647_8484_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|8483_9287_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_000904906.1\|9352_9967_-	recombinase family protein	E5FFF9	Burkholderia_phage	2.3e-37	48.6
WP_096873666.1\|10087_12979_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-185	38.7
WP_096873665.1\|13058_14168_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	8.9e-08	32.5
WP_065335167.1\|14665_15241_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	1.3e-26	38.9
WP_065335168.1\|15369_15705_-	hypothetical protein	NA	NA	NA	NA
WP_096873667.1\|15762_16626_-	class A beta-lactamase	A0A077SL40	Escherichia_phage	4.4e-71	50.7

DBSCAN-SWA_2

19795 : 29071

Clostridioides_phage(16.67%)

transposase,integrase

attL 26137:26167|attR 29572:29602

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096873670.1\|19795_22063_+	N-6 DNA methylase	A0A2R2ZGH5	Clostridioides_phage	1.5e-102	35.0
WP_078527637.1\|22254_23610_-\|transposase	IS1380-like element IS1247 family transposase	A0A1X9I6F6	Streptococcus_phage	5.0e-45	29.7
WP_096873671.1\|23697_24660_+	hypothetical protein	Q8V6N5	Halorubrum_phage	5.7e-11	26.6
WP_071974167.1\|24902_25655_+	Bro-N domain-containing protein	A0A290FZK7	Caldibacillus_phage	4.8e-29	52.8
26137:26167	attL	NA	NA	NA	NA
WP_024096534.1\|26223_27222_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	3.3e-17	28.3
WP_024096535.1\|27218_28163_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_036563100.1\|28159_29071_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	5.4e-11	27.2
29572:29602	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010769

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19687 : 75605

Bacillus_phage(25.0%)

protease,transposase,integrase

attL 10000:10016|attR 80481:80497

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
10000:10016	attL	NA	NA	NA	NA
WP_024096534.1\|19687_20686_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	3.3e-17	28.3
WP_024096535.1\|20682_21627_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_036563100.1\|21623_22535_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	5.4e-11	27.2
WP_096873423.1\|23461_23851_+	DUF3768 domain-containing protein	NA	NA	NA	NA
WP_096873424.1\|24009_25992_+	ParB/RepB/Spo0J family partition protein	A0A0F7L836	uncultured_marine_virus	5.1e-06	33.5
WP_096873425.1\|26066_26660_+	regulator	NA	NA	NA	NA
WP_096873426.1\|27544_27871_+	type II toxin-antitoxin system PrlF family antitoxin	NA	NA	NA	NA
WP_096873427.1\|27867_28386_+	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_096873428.1\|28533_28686_+	StaA	NA	NA	NA	NA
WP_192870624.1\|30134_30413_+	hypothetical protein	A0A1B1IUL8	uncultured_Mediterranean_phage	1.0e-08	48.6
WP_096873431.1\|30513_30819_+	hypothetical protein	NA	NA	NA	NA
WP_096873507.1\|30944_31673_+	DUF736 family protein	NA	NA	NA	NA
WP_096873508.1\|31956_32364_+	hypothetical protein	NA	NA	NA	NA
WP_096873432.1\|32512_33094_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_096873433.1\|33211_37057_-	hypothetical protein	NA	NA	NA	NA
WP_096873434.1\|37913_38843_+	DUF2493 domain-containing protein	A0A291L9X7	Bordetella_phage	6.3e-07	33.9
WP_096873436.1\|39378_39585_+	hypothetical protein	NA	NA	NA	NA
WP_096873437.1\|40148_40742_+\|transposase	transposase	NA	NA	NA	NA
WP_096873438.1\|40728_43080_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_096873439.1\|43088_45071_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_096873440.1\|45111_45366_+	hypothetical protein	NA	NA	NA	NA
WP_096873441.1\|45553_46123_+	hypothetical protein	NA	NA	NA	NA
WP_096873442.1\|46156_47329_+	TMEM43 family protein	NA	NA	NA	NA
WP_096873443.1\|47362_47830_+	hypothetical protein	NA	NA	NA	NA
WP_096873444.1\|47841_48663_+	hypothetical protein	NA	NA	NA	NA
WP_096873445.1\|48673_49282_+	DUF4453 domain-containing protein	NA	NA	NA	NA
WP_096873446.1\|49290_49707_+	hypothetical protein	NA	NA	NA	NA
WP_096873447.1\|49709_50618_+	hypothetical protein	NA	NA	NA	NA
WP_096873448.1\|50623_51667_+	hypothetical protein	NA	NA	NA	NA
WP_096873509.1\|51741_52500_+	hypothetical protein	NA	NA	NA	NA
WP_096873449.1\|52800_53601_+	autoinducer binding domain-containing protein	NA	NA	NA	NA
WP_096873450.1\|54593_55670_-	type IV secretion system protein	NA	NA	NA	NA
WP_096873451.1\|55682_56096_-	hypothetical protein	NA	NA	NA	NA
WP_009807516.1\|56092_56287_-	hypothetical protein	NA	NA	NA	NA
WP_096873452.1\|56283_57270_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_096873453.1\|57274_58654_-	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_067294495.1\|58650_59346_-	TrbG/VirB9 family P-type conjugative transfer protein	NA	NA	NA	NA
WP_096873454.1\|59348_60005_-	type IV secretion system protein	NA	NA	NA	NA
WP_096873455.1\|60019_60829_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_192870623.1\|60828_61983_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	1.2e-26	57.0
WP_096873457.1\|62136_64500_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_008327373.1\|64489_64768_-	VirB3 family type IV secretion system protein	NA	NA	NA	NA
WP_096873510.1\|64760_65045_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_096873458.1\|65152_65773_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	2.0e-20	53.5
WP_012187165.1\|65816_66170_-	hypothetical protein	NA	NA	NA	NA
WP_096873459.1\|66373_66634_+	hypothetical protein	NA	NA	NA	NA
WP_096873460.1\|66758_67016_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_096873462.1\|67736_69707_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_096873463.1\|69822_70299_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_096873464.1\|70311_70935_-	glutathione S-transferase	NA	NA	NA	NA
WP_096873465.1\|71043_71958_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096873466.1\|71983_72886_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096873467.1\|73032_73419_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_096873468.1\|73490_73925_+	hypothetical protein	NA	NA	NA	NA
WP_102898455.1\|73950_74337_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_040180999.1\|74972_75605_-\|integrase	tyrosine-type recombinase/integrase	A3F636	Streptococcus_phage	7.1e-10	27.1
80481:80497	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP010767

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010767_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010767_1

1858097-1858176

Orphan

Consensus_repeat	Method
CCATCTCCACTATTTGGAGTTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010767_1

>merge|NZ_CP010767|1|1858097-1858176|CRISPRCasFinder
CCATCTCCACTATTTGGAGTTGGTGCGCCGGTTTGTTCCGGTTTTGATCCCCTTCTGCCATCTCCACTATTTGGAGATGG

>NZ_CP010767|1|1|1858097-1858176|CRISPRCasFinder
CCATCTCCACTATTTGGAGTTGG	TGCGCCGGTTTGTTCCGGTTTTGATCCCCTTCTG
CCATCTCCACTATTTGGAGATGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010767.1\|WP_096871500.1\|1859358_1859682_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871499.1\|1858855_1859350_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871496.1\|1856202_1857249_-\|DUF2312-domain-containing-protein	unknown	unknown	gnl\|CDD\|370805
NZ_CP010767.1\|WP_096871489.1\|1849010_1849469_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871491.1\|1850782_1851250_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
NZ_CP010767.1\|WP_096871505.1\|1862023_1862227_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP010767.1\|WP_096871493.1\|1853138_1853924_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_027247879.1\|1848413_1848650_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871507.1\|1863518_1865204_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP010767.1\|WP_096871506.1\|1862220_1863222_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271181
NZ_CP010767.1\|WP_014874894.1\|1865396_1865735_+\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|223424
NZ_CP010767.1\|WP_096871495.1\|1855776_1856193_-\|DUF1064-domain-containing-protein	unknown	unknown	gnl\|CDD\|283910
NZ_CP010767.1\|WP_096871504.1\|1861298_1861991_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871490.1\|1849593_1850412_-\|DUF3800-domain-containing-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_037302281.1\|1859997_1860300_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_145958076.1\|1860944_1861154_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871494.1\|1855200_1855767_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_158524473.1\|1851833_1852784_+\|DUF4238-domain-containing-protein	unknown	unknown	gnl\|CDD\|379425
NZ_CP010767.1\|WP_096871502.1\|1860530_1860800_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010767.1\|WP_096871497.1\|1857241_1857556_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010767.1\|WP_096871495.1\|1855776_1856193_-\|DUF1064-domain-containing-protein	gnl\|CDD\|283910	pfam06356, DUF1064, Protein of unknown function (DUF1064). This family consists of several phage and bacterial proteins of unknown function.	4.35151e-08
NZ_CP010767.1\|WP_096871505.1\|1862023_1862227_+\|hypothetical-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00483804
NZ_CP010767.1\|WP_096871496.1\|1856202_1857249_-\|DUF2312-domain-containing-protein	gnl\|CDD\|370805	pfam10073, DUF2312, Uncharacterized protein conserved in bacteria (DUF2312). Members of this family of hypothetical bacterial proteins have no known function. Structural modelling suggests this domain may bind nucleic acids.	2.02374e-32
NZ_CP010767.1\|WP_014874894.1\|1865396_1865735_+\|P-II-family-nitrogen-regulator	gnl\|CDD\|223424	COG0347, GlnK, Nitrogen regulatory protein PII [Amino acid transport and metabolism].	7.50466e-58
NZ_CP010767.1\|WP_096871491.1\|1850782_1851250_-\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	5.79412e-58
NZ_CP010767.1\|WP_096871506.1\|1862220_1863222_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271181	cd00800, INT_Lambda_C, C-terminal catalytic domain of Lambda integrase, a tyrosine-based site-specific recombinase. Lambda-type integrases catalyze site-specific integration and excision of temperate bacteriophages and other mobile genetic elements to and from the bacterial host chromosome. They are tyrosine-based site-specific recombinase and belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The phage lambda integrase can bridge two different and well-separated DNA sequences called arm- and core-sites. The C-terminal domain binds, cleaves and re-ligates DNA strands at the core-sites, while the N-terminal domain is largely responsible for high-affinity binding to the arm-type sites.	2.71283e-20
NZ_CP010767.1\|WP_158524473.1\|1851833_1852784_+\|DUF4238-domain-containing-protein	gnl\|CDD\|379425	pfam14022, DUF4238, Protein of unknown function (DUF4238). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 274 and 374 amino acids in length.	1.26581e-39
NZ_CP010767.1\|WP_096871507.1\|1863518_1865204_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	3.416e-74

>NZ_CP010767.1|WP_096871497.1|1857241_1857556_-|hypothetical-protein
MSPHSDPETHGVQFGRVVVTVDAALGDCIVIAPQPGPICTSPKRMRLNSLDEIRGAYRTQSRLAARVPDQYPHAKDIAAALEFAGKTLSAAQGAKHQTKGQSNA
>NZ_CP010767.1|WP_096871496.1|1856202_1857249_-|DUF2312-domain-containing-protein
MLDQQEPSNAQIERATEIWDNVTGASSKAIAARVTGEGEQSGDYPLDSGDFGRCERLLDAVPGLRNQLPMMTDVNAYWAALVKRWDDIRSADDQTALIKEIVTPIQKTDPGHVSRGEGVSMRVGPNTFQGVDTSANEGPLKSDGDALYFRAAAIVVSEGKASTSFVQRKLAIGYNKAARLIERMEEAGIVSAPDNVGKREVATIETIRSALSLQSAIPDDADRETVVKMLTAACDDIGGQQLKAKHAEQRKASGKPPMKADPDFDNAADTTYRVTAGELRQFIERFERLDAEKKDLADQQKEVMAEAKARGYDTKVIRKVIALRKRDKDDIAEEEAVLEMYKEALGMG
>NZ_CP010767.1|WP_096871495.1|1855776_1856193_-|DUF1064-domain-containing-protein
MERMTAADYNKAQRAAEGQGEDRRRVRGTQRTTTADGITHDSKTEAQRWEELKLLQASGAICGLRRQAPIPLIGRDGPIMTDSGNQQRVYKADFVYVDNALGIMVVEDRKGHETDKFKLVKSVLAAQGIELLITRAKG
>NZ_CP010767.1|WP_096871494.1|1855200_1855767_-|hypothetical-protein
MGVEEDLKHELANMRKLLDQAQRAGRSAPSRASPAVVAQQLQLPNVVRFPLAQFAAGRGRKVPLPELVQEIAEVVGRENAVKLVEGTRQRGARRWRRHLYIPSDIPENHRIVSLIGWDAAQALSFSHANSVLELPSCHGLRKAYLADVAIRLAGQGADQAEIASELGVERKTVANLLDLADYWAPRLV
>NZ_CP010767.1|WP_096871493.1|1853138_1853924_+|hypothetical-protein
MTERYTLKQSLYVRASMFTADELRRQKRLGLDEVNENVLEGLVNQRAKLEGRQDKLIRSLTISLFLAFVAWSGGNIQIPGTSASLVEIPSFLELSLIASSLSVLLITYTFLSLQLYDAVIAAVARDVLAKNKLDPDLFAAAHTPTWLFVKYSKMAPVDGRTPGFKISTLGRVFYGVLVGFLSVIVLGLWFLVISSILYIGHSGLSDDVAGWVVYATCIAIILASFVSMAANIVEFTHEMDFSVLEKMETDRGDLGNQSVVE
>NZ_CP010767.1|WP_158524473.1|1851833_1852784_+|DUF4238-domain-containing-protein
MATKANHHFIPQFYLRGFADGVGRKARVFTFDSETRTTFKTLVRNVGSRRHFFRVEADGVDPNYVEDAMAKIEGEIALHLADVIQTKSFPTPEHFNSVMNLLANVSVRNPRLRGNMSQFHKDIVQRMTHLSLSSKEVWEGQVDQIREEGIPLKDDISYEDIKRFIESSDYEIVIDQTYLIGLELQMIEPVLECSARRNWCFVAAPEGHQYICSDDPVVLSWIDDRKTGPYSPGHGVGGTLVTFPLSPELLLVGTFEELPEHLKHAPVQVTSVNTRTARYSTKQIYARDGSFLIDLHDRPEVRGEDLPHFYDKQLPA
>NZ_CP010767.1|WP_096871491.1|1850782_1851250_-|RidA-family-protein
MKSVSQNIEALGLVIPDAPKPLGNFAPYLLDAGYLYISGQISIDANGDVIRGKLGQDIDLEGGIAAARCCGIGILARAQAAVGDLEKIAKLVKLGAFVNAVPNFSDHPKVVNGASDLMVEVFGPEIADHVRFAVGSSSLPANAAVEIEAVFRVDA
>NZ_CP010767.1|WP_096871490.1|1849593_1850412_-|DUF3800-domain-containing-protein
MRFIYVDEAGTSKNEPYFIACGVISDPDECYLSVRQYYFDLSNDLFPEWEGFGDSVIFHAKDIWHGAGHWDRKKWPKRERMNILKRLVQVPVLFQLPLCFGILEKAGVAESLQVAPDTTAKQREKLLARSIYSHGIHGMLQVADWWMAKNCPSELAQVVAEDISDVKGAMAMFFSGLQKQDHDIAEDLAAASEPDWFVTERFIDTINYVAKSKSPMLQVADTFAFLVRRMLGGCAEAASLIEPASSWFVTPTNLNLRTARLIIPVDQVRPVD
>NZ_CP010767.1|WP_096871489.1|1849010_1849469_+|hypothetical-protein
MQLIDWQDCRGAFYVDGSLRDIYIQDTTAADWDVFLDAISSKIITTFVDGEPHPLPKQASEIFERNGDTSFLLEVTLGQLKMNCHFFTEEEIELDIDPSEVTSQAELDAIIEVLSLLGSALGRDVILTDENMPTSIWIVFDAIKADVHFVAD
>NZ_CP010767.1|WP_027247879.1|1848413_1848650_-|hypothetical-protein
MTLIERIEQASTGIAVTAMTAAASGAVWLVRRIFTNQKQIEILQQSLEARDKQRDEDREALSDVRTDVREIREFLHRR
>NZ_CP010767.1|WP_096871499.1|1858855_1859350_+|hypothetical-protein
MGITLDTAKAALDLTSSGAMTIQAIMGTIRALEKTSQSPQATPEPEIAGALETLRTQVLEAQEQNISLRKAILELEQECLDLKRATDKFAGYTLWETPAGHLVYRSGAGIDPIHYLCPSCHDADIKSILHGNGALKACKHNPRHGSFRFEPRKPNSGWAAKRRR
>NZ_CP010767.1|WP_096871500.1|1859358_1859682_-|hypothetical-protein
MNRPRLTLIVNNAVPCSDDARGAGQMSWSNKFDPYALKVSAADLWSSYFKSRFNSPREVALFCDVSFQTALNWWGAVTAPASHISLLVMLTDPGAPEFFGQSMEVAA
>NZ_CP010767.1|WP_037302281.1|1859997_1860300_+|hypothetical-protein
MDIEQKEQLALTGDVSPEAIRRRMLAARRSIGMQQLDVAKELGLKKTTFHSQESRGAPAIKTMRYYYRQHRIDFNFILHGDFAQLPQDVQDRLFGALQSE
>NZ_CP010767.1|WP_096871502.1|1860530_1860800_+|hypothetical-protein
MQDITQTARQIAGSPEDHLDEIHLFTSAWATMKAARGQGFNPARLRPQHLIDRPAPTPEPTEMVLDRVGDKVRAIMESRDLTASGKKAA
>NZ_CP010767.1|WP_145958076.1|1860944_1861154_+|hypothetical-protein
MQQYQDERLTSDDQLRALASNDPTRMLATMSDAELAAQARHLLPDIAGELLAHRLLERSHGFTKNTPPC
>NZ_CP010767.1|WP_096871504.1|1861298_1861991_+|hypothetical-protein
MKPLRILIGCETSGIARRAFDTLGHDVWSCDIEPAEDGSNRHIRCDIRDGILNDGWDLLAVMHPPCTRLCRSGRRWMSGPGKWTPPKQLPKGRSLESMRAEFEEGVSIFTACWSAPIERVAIENPEMNDLAQDRMPQDLPRPQMVQPFWFGEPTYKATGWYLRGLSPLKETNRLAEPERGTDEWKKWNRIHRMPPSAERARLRSRSFPGMMNAAAHQWIDQAVRNRATAA
>NZ_CP010767.1|WP_096871505.1|1862023_1862227_+|hypothetical-protein
MGHIAPIAVAERTAAKMMDMAPSDFRRLVQSGSLPSPVRISGLERWRVSDLESVLNGNAMNEDEFTW
>NZ_CP010767.1|WP_096871506.1|1862220_1863222_+|tyrosine-type-recombinase/integrase
MVKKLERKYVTTKTVKGRVYYYFRRGETYQRLPNDPDSQEFDAAYWAIRSGRAQKKTKTTFEALIVSYYQTPEFRDRKPRVQQEYRRTLELIREKNGPKDFTKLRRRDVIAARDAYADTWRKANAMVEMISILSRHAIDLEWITANPASGVKKLKGGEYQPWPAAKLRAFEAYCESGSLEWELTAYMLGIGTGQRIGDVIGMEWAHYDGQFISVVQEKTAARLWVACPEFLRKYLDNLPRRGRFIISQSLHKGVAKRTIQQRVMAVREKIGAQAFVIHGWRYTAAVHLAEAGASDSEIQAVTGHKTLEMVKKYRSQANQKRLSQAAQARRTRT
>NZ_CP010767.1|WP_096871507.1|1863518_1865204_-|NAD(P)H-hydrate-dehydratase
MTELLTAAQMRAIEQAAIAAGEVTGLELMERAGQGVVAAIFEEWPELDADIGCQAGEAAPRPQASPGDISGQKMGGEAFRRAVVLCGPGNNGGDGFVVARLLKERGWDIEVFLYGAPDKLPPDAKVNYERWLELGRVKDITHYGRKDGWLCDVLVDALFGTGLTRSLTDLGDLFWNMEDMVDCFEIEFGHKRGRPAIVAVDIPSGICSDSGKEFPHEADYFRFSATAHLTVSFHRHKQGHFLAEGPDHCGKTVVKEIGLKEGKNWCKENRKSLCSLATRLHPSWARKDRDGHKYSHGHALVLSGGHGRTGAARLAARGALRIGAGLVTVGAPRAAMMEHACQLTAIMLRQMDGADELRRLLQDSRFNAVCLGPGLGLAADREGLVLEVLQANRATVLDADALTQFEDRAEALFEVLHENCVITPHGGEFSRLFPDLAEKLNAPATTGPAYSKVDATREAAKRAGCVVLFKGPDTVIAAPNGLCSVNSAHYDRSAPWLATAGSGDVLAGFITGLMARGFDPMQAAETAAYLHVECALNFGPGLIAEDLPEQIPAVLRKLDIF
>NZ_CP010767.1|WP_014874894.1|1865396_1865735_+|P-II-family-nitrogen-regulator
MKKIEAIIKPFKLDEVKEALQDVGVQGLSVIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVLDDDQVDAAIEAIVAAAKTDKIGDGKIFVSPVEQAIRIRTGETGSDAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1747861 : 1892057

150

Escherichia_phage(23.91%)

transposase,protease,head,integrase,tail,tRNA,capsid,portal,plate,terminase

attL 1826008:1826063|attR 1863318:1863373

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096871411.1\|1747861_1748932_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_096871412.1\|1749036_1752765_-	DUF3971 domain-containing protein	NA	NA	NA	NA
WP_096871413.1\|1752865_1753327_+	peroxiredoxin	NA	NA	NA	NA
WP_096871414.1\|1753468_1754350_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_096871415.1\|1754755_1756087_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	2.5e-17	45.0
WP_040169361.1\|1756076_1756619_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_096871416.1\|1756880_1758125_+	calcium-binding protein	NA	NA	NA	NA
WP_096871417.1\|1758368_1759865_+	calcium-binding protein	NA	NA	NA	NA
WP_096871418.1\|1759952_1760960_-	DUF3179 domain-containing protein	NA	NA	NA	NA
WP_040178650.1\|1761160_1761712_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	9.8e-40	57.1
WP_096871419.1\|1761704_1762211_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.3e-42	55.0
WP_096873140.1\|1762392_1763583_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_014880143.1\|1763860_1764160_+	septum formation initiator family protein	NA	NA	NA	NA
WP_040178651.1\|1764462_1765476_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_096871420.1\|1765492_1766878_+	pyruvate dehydrogenase complex E1 component subunit beta	NA	NA	NA	NA
WP_096871421.1\|1766890_1768228_+	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_096871422.1\|1768410_1769298_-	sulfotransferase domain-containing protein	NA	NA	NA	NA
WP_040169387.1\|1769508_1770324_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_096871423.1\|1770591_1770912_-	hypothetical protein	NA	NA	NA	NA
WP_096871424.1\|1770924_1774881_-	glycoside hydrolase TIM-barrel-like domain-containing protein	A0A0B5A7K5	Paracoccus_phage	7.1e-225	37.9
WP_096871425.1\|1774880_1775351_-	C40 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	1.0e-29	49.3
WP_096871426.1\|1775347_1776298_-	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	1.5e-51	35.5
WP_096871427.1\|1776297_1776930_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	5.9e-49	45.7
WP_096871428.1\|1776945_1777602_-\|tail	phage tail tape measure protein	D6PFD6	uncultured_phage	1.3e-14	37.2
WP_096871429.1\|1777594_1777852_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_096871430.1\|1777848_1778202_-	gene transfer agent family protein	NA	NA	NA	NA
WP_014880167.1\|1778216_1778630_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_096871431.1\|1778736_1779150_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_040169406.1\|1779146_1779518_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_192870590.1\|1779514_1780162_-	hypothetical protein	NA	NA	NA	NA
WP_096871432.1\|1780347_1781532_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	2.0e-61	41.7
WP_096873142.1\|1781580_1782198_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	3.8e-32	53.3
WP_096871433.1\|1782233_1782452_-	hypothetical protein	NA	NA	NA	NA
WP_096871434.1\|1782444_1783638_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.1e-59	36.1
WP_096871435.1\|1783842_1785135_-	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	9.9e-75	43.3
WP_040169417.1\|1785106_1785448_-	recombinase	NA	NA	NA	NA
WP_096706488.1\|1785739_1786894_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_096871436.1\|1786893_1788159_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_096871437.1\|1788420_1789434_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_096871438.1\|1789726_1790470_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	NA	NA	NA	NA
WP_005982462.1\|1790634_1790868_-	acyl carrier protein	A0A2C9CX86	Yersinia_phage	7.3e-05	52.1
WP_040169440.1\|1791548_1792286_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_096871439.1\|1792371_1793304_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_096871440.1\|1793489_1794791_+	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_096871441.1\|1795115_1795649_+	VOC family protein	NA	NA	NA	NA
WP_096871442.1\|1795871_1796447_-	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_096871443.1\|1796683_1797280_-	hypothetical protein	NA	NA	NA	NA
WP_123619046.1\|1797545_1797785_+	hypothetical protein	NA	NA	NA	NA
WP_014874885.1\|1797849_1798203_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_005982441.1\|1798231_1798459_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_040169455.1\|1798471_1799086_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_040169456.1\|1799318_1799501_+	hypothetical protein	NA	NA	NA	NA
WP_096871445.1\|1799822_1800293_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_096873143.1\|1800441_1802400_+	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase	NA	NA	NA	NA
WP_096871446.1\|1802698_1803967_+	hypothetical protein	M4SNJ8	Pseudoalteromonas_phage	2.8e-05	26.5
WP_096873144.1\|1804183_1805515_-	trigger factor	NA	NA	NA	NA
WP_096871447.1\|1805782_1806913_-	porin	NA	NA	NA	NA
WP_096871448.1\|1807266_1809471_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.4e-14	28.6
WP_192870560.1\|1809816_1810275_+	hypothetical protein	NA	NA	NA	NA
WP_145958079.1\|1810328_1811627_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_096871449.1\|1811669_1813490_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_096871450.1\|1813580_1813859_+	hypothetical protein	NA	NA	NA	NA
WP_096871451.1\|1813855_1814389_+	hypothetical protein	NA	NA	NA	NA
WP_096871452.1\|1814571_1815504_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.3e-46	36.4
WP_096871453.1\|1815833_1816076_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_158524830.1\|1816065_1816386_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_096871455.1\|1816382_1816811_-	hypothetical protein	NA	NA	NA	NA
WP_096871456.1\|1816821_1817331_-	antirestriction protein ArdA	NA	NA	NA	NA
WP_145958069.1\|1817522_1818308_-	hypothetical protein	NA	NA	NA	NA
WP_145958070.1\|1818356_1818584_-	hypothetical protein	NA	NA	NA	NA
WP_145958071.1\|1818607_1819012_-	hypothetical protein	NA	NA	NA	NA
WP_096871460.1\|1819219_1819840_+	recombinase family protein	A0A1S6L009	Salmonella_phage	1.1e-34	51.9
WP_096871461.1\|1819887_1822176_+	AAA family ATPase	NA	NA	NA	NA
WP_096871462.1\|1822385_1822688_-	hypothetical protein	NA	NA	NA	NA
WP_096871463.1\|1822726_1823509_-	hypothetical protein	NA	NA	NA	NA
WP_145958073.1\|1823693_1823876_+	hypothetical protein	NA	NA	NA	NA
WP_145958074.1\|1824095_1824464_+	hypothetical protein	NA	NA	NA	NA
WP_096871465.1\|1824460_1826029_+	recombinase family protein	NA	NA	NA	NA
1826008:1826063	attL	NA	NA	NA	NA
WP_096873145.1\|1826465_1826906_+	hypothetical protein	NA	NA	NA	NA
WP_096871466.1\|1827242_1828250_-	late control protein D	A0A088FRU7	Escherichia_phage	2.9e-74	44.8
WP_072504833.1\|1828240_1828462_-\|tail	tail protein X	A0A1W6JT40	Escherichia_phage	9.7e-15	56.1
WP_096873146.1\|1828430_1828841_-\|tail	phage tail protein	A0A193GYE0	Enterobacter_phage	8.1e-31	53.7
WP_096871467.1\|1828840_1831336_-\|tail	phage tail tape measure protein	A0A0U2BXT9	Paracoccus_phage	8.1e-25	30.1
WP_052463898.1\|1831450_1831744_-\|tail	phage tail assembly protein	K4I007	Acidithiobacillus_phage	8.9e-08	51.6
WP_096871468.1\|1831753_1832260_-\|tail	phage major tail tube protein	A0A088FRU2	Escherichia_phage	3.8e-46	53.6
WP_096871469.1\|1832259_1833477_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A088FVH5	Escherichia_phage	3.4e-133	54.3
WP_096871470.1\|1833543_1833993_-	hypothetical protein	NA	NA	NA	NA
WP_096871471.1\|1833993_1834404_-	hypothetical protein	NA	NA	NA	NA
WP_096871472.1\|1834428_1835586_-	hypothetical protein	NA	NA	NA	NA
WP_096871473.1\|1835585_1836143_-	hypothetical protein	NA	NA	NA	NA
WP_096871474.1\|1836135_1836738_-\|tail	phage tail protein I	A0A088FVH1	Escherichia_phage	3.3e-25	39.3
WP_096871475.1\|1836730_1837630_-\|plate	baseplate J/gp47 family protein	D5LGZ3	Escherichia_phage	7.3e-85	57.6
WP_096871476.1\|1837629_1837968_-	GPW/gp25 family protein	A0A088FV58	Escherichia_phage	8.4e-34	64.0
WP_096871478.1\|1838307_1838733_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_096871479.1\|1838729_1839263_-	hypothetical protein	D5LGZ6	Escherichia_phage	2.9e-33	44.2
WP_096871480.1\|1839266_1839860_-\|tail	phage tail protein	A0A193GYC6	Enterobacter_phage	3.7e-37	46.4
WP_096871481.1\|1839819_1840131_-	hypothetical protein	A0A193GYM3	Enterobacter_phage	2.7e-18	42.9
WP_096871482.1\|1840130_1840361_-	hypothetical protein	NA	NA	NA	NA
WP_096871483.1\|1840435_1842466_-\|capsid	phage major capsid protein	V5YSS9	Pseudomonas_phage	8.8e-171	50.1
WP_096873147.1\|1842458_1843985_-\|portal	phage portal protein	A0A088FVG5	Escherichia_phage	4.2e-133	50.8
WP_096871484.1\|1844050_1844581_-	hypothetical protein	A0A1W6JT65	Escherichia_phage	2.6e-34	45.1
WP_096871485.1\|1844590_1846540_-\|terminase	phage terminase large subunit family protein	A0A088FQV3	Escherichia_phage	1.2e-225	63.0
WP_096871486.1\|1846536_1847088_-\|terminase	terminase small subunit	A0A193GYK5	Enterobacter_phage	5.6e-35	50.8
WP_096871487.1\|1847203_1847644_-	bacteriophage spanin2 family protein	NA	NA	NA	NA
WP_096871488.1\|1847643_1848372_-	lysozyme	A0A0K1LL70	Rhodobacter_phage	7.9e-29	42.8
WP_027247879.1\|1848413_1848650_-	hypothetical protein	NA	NA	NA	NA
WP_096871489.1\|1849010_1849469_+	hypothetical protein	NA	NA	NA	NA
WP_096871490.1\|1849593_1850412_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_096871491.1\|1850782_1851250_-	RidA family protein	NA	NA	NA	NA
WP_158524473.1\|1851833_1852784_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_096871493.1\|1853138_1853924_+	hypothetical protein	NA	NA	NA	NA
WP_096871494.1\|1855200_1855767_-	hypothetical protein	NA	NA	NA	NA
WP_096871495.1\|1855776_1856193_-	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.8e-07	41.8
WP_096871496.1\|1856202_1857249_-	DUF2312 domain-containing protein	A0A1X9HX62	Ruegeria_phage	9.7e-97	58.3
WP_096871497.1\|1857241_1857556_-	hypothetical protein	NA	NA	NA	NA
WP_096871498.1\|1857555_1858470_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_096871499.1\|1858855_1859350_+	hypothetical protein	NA	NA	NA	NA
WP_096871500.1\|1859358_1859682_-	hypothetical protein	NA	NA	NA	NA
WP_037302281.1\|1859997_1860300_+	hypothetical protein	NA	NA	NA	NA
WP_096871502.1\|1860530_1860800_+	hypothetical protein	NA	NA	NA	NA
WP_145958076.1\|1860944_1861154_+	hypothetical protein	NA	NA	NA	NA
WP_096871504.1\|1861298_1861991_+	hypothetical protein	A0A0U2BXK1	Paracoccus_phage	9.9e-98	75.8
WP_096871505.1\|1862023_1862227_+	hypothetical protein	NA	NA	NA	NA
WP_096871506.1\|1862220_1863222_+\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	2.6e-06	23.8
WP_096871507.1\|1863518_1865204_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
1863318:1863373	attR	NA	NA	NA	NA
WP_014874894.1\|1865396_1865735_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_096871508.1\|1865828_1867235_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_096871509.1\|1867752_1868778_+	hypothetical protein	NA	NA	NA	NA
WP_096871510.1\|1868795_1869560_-	DUF3445 domain-containing protein	NA	NA	NA	NA
WP_096873148.1\|1869747_1871091_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_096871511.1\|1871168_1871729_-	NUDIX hydrolase	NA	NA	NA	NA
WP_096871512.1\|1871824_1873081_+	OsmC family protein	NA	NA	NA	NA
WP_040178692.1\|1873359_1874664_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	6.6e-18	30.2
WP_096871513.1\|1874852_1875458_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_096871514.1\|1875534_1876737_+	flagellar motor switch protein FliG	NA	NA	NA	NA
WP_096871515.1\|1877121_1878057_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_096871516.1\|1878071_1878803_-	DUF1223 domain-containing protein	NA	NA	NA	NA
WP_096871517.1\|1879048_1881736_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_096873149.1\|1881974_1882310_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_096871518.1\|1882387_1882927_-	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_040169641.1\|1882919_1883090_-	heme exporter protein CcmD	NA	NA	NA	NA
WP_014874910.1\|1883089_1883821_-	heme ABC transporter permease	NA	NA	NA	NA
WP_040169525.1\|1883866_1884523_-	heme exporter protein CcmB	NA	NA	NA	NA
WP_096871519.1\|1884519_1885146_-	heme ABC exporter ATP-binding protein CcmA	G9BWD6	Planktothrix_phage	1.3e-08	30.2
WP_096871520.1\|1885242_1885596_-	Mth938-like domain-containing protein	NA	NA	NA	NA
WP_096871521.1\|1885764_1886733_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.8e-60	48.1
WP_096871522.1\|1886734_1888396_-	protein translocase subunit SecD	A0A1B1IVP7	uncultured_Mediterranean_phage	1.6e-05	24.0
WP_040169532.1\|1888430_1888715_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.2e-20	53.8
WP_158524831.1\|1889137_1890655_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_096871524.1\|1890764_1892057_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.8e-84	47.2

DBSCAN-SWA_2

2389207 : 2456470

Acinetobacter_phage(18.18%)

transposase,protease,integrase

attL 2431471:2431490|attR 2462540:2462559

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040173890.1\|2389207_2391529_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-171	43.5
WP_096871966.1\|2391533_2392499_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_096871968.1\|2392686_2393271_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_096871970.1\|2393281_2395249_-	peptidoglycan -binding protein	NA	NA	NA	NA
WP_096871971.1\|2395252_2396434_-	biopolymer transporter ExbB	NA	NA	NA	NA
WP_024096351.1\|2396512_2397043_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_096871972.1\|2397107_2398112_+	DUF2125 domain-containing protein	NA	NA	NA	NA
WP_096871974.1\|2398108_2398972_-	extensin family protein	NA	NA	NA	NA
WP_096871976.1\|2398968_2399889_-	prephenate/arogenate dehydrogenase family protein	NA	NA	NA	NA
WP_096871978.1\|2399885_2400971_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	3.5e-17	25.7
WP_014875429.1\|2401127_2401589_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_082035080.1\|2401631_2402204_-	hypothetical protein	NA	NA	NA	NA
WP_014875431.1\|2402411_2403032_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_096871980.1\|2403279_2404356_-	Hint domain-containing protein	NA	NA	NA	NA
WP_096871982.1\|2404490_2405635_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_096871983.1\|2406942_2407611_-	response regulator transcription factor	NA	NA	NA	NA
WP_096871985.1\|2407607_2408849_-	histidine kinase	NA	NA	NA	NA
WP_158524835.1\|2408881_2410000_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_096871988.1\|2409996_2413041_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_096871989.1\|2414628_2415291_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_096871992.1\|2415378_2416437_-	siderophore-interacting protein	NA	NA	NA	NA
WP_096871994.1\|2416558_2417311_-	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-11	27.2
WP_096871996.1\|2417317_2418373_-	iron ABC transporter permease	NA	NA	NA	NA
WP_158524836.1\|2418372_2419113_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096872000.1\|2419350_2421381_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.9e-08	29.3
WP_123618689.1\|2423867_2424167_+	hypothetical protein	NA	NA	NA	NA
WP_096872002.1\|2424150_2424555_+	hypothetical protein	NA	NA	NA	NA
WP_096872004.1\|2424551_2425175_+	DedA family protein	NA	NA	NA	NA
WP_096872006.1\|2425238_2425898_+	response regulator transcription factor	NA	NA	NA	NA
WP_096872007.1\|2425878_2427222_+	hypothetical protein	A0A2K9L5I4	Tupanvirus	8.6e-05	22.9
WP_096872009.1\|2427394_2429683_+	ABC transporter ATP-binding protein/permease	A0A285PWH2	Cedratvirus	2.7e-14	32.0
2431471:2431490	attL	NA	NA	NA	NA
WP_096872013.1\|2431519_2432698_+\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	3.6e-55	35.4
WP_096872015.1\|2432923_2433643_+	hypothetical protein	NA	NA	NA	NA
WP_096790296.1\|2433741_2433975_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_039982563.1\|2434094_2434313_+	hypothetical protein	NA	NA	NA	NA
WP_096872017.1\|2434493_2435642_+	hypothetical protein	NA	NA	NA	NA
WP_096872020.1\|2436183_2436693_+	hypothetical protein	NA	NA	NA	NA
WP_096872022.1\|2437333_2438824_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_096872024.1\|2438820_2440461_-	amidohydrolase	NA	NA	NA	NA
WP_096872026.1\|2440471_2441401_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.8e-09	30.9
WP_096872029.1\|2441397_2442375_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-13	23.4
WP_096872030.1\|2442371_2443250_-	ABC transporter permease	NA	NA	NA	NA
WP_096872032.1\|2443263_2444202_-	ABC transporter permease	NA	NA	NA	NA
WP_096872034.1\|2444220_2445783_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096872036.1\|2445805_2447830_-	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_096872038.1\|2447895_2448687_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_096872040.1\|2448981_2449278_+\|transposase	transposase	NA	NA	NA	NA
WP_096872042.1\|2449754_2450174_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-28	46.0
WP_096872045.1\|2451057_2451960_-	DMT family transporter	NA	NA	NA	NA
WP_096872047.1\|2452043_2452748_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_096873180.1\|2452849_2453722_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158524837.1\|2454901_2455438_-	hypothetical protein	NA	NA	NA	NA
WP_040180999.1\|2455837_2456470_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WF93	Clostridium_phage	1.5e-07	28.3
2462540:2462559	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010769

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP010767

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection