CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022320	Bacillus altitudinis strain SGAir0031 plasmid pSGAir0031, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP022319	Bacillus altitudinis strain SGAir0031 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,DinG,cas3	0	2	12	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022319_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022319_1

755121-755343

Orphan

Consensus_repeat	Method
AGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP022319_1

>merge|NZ_CP022319|1|755121-755343|PILER-CR
ACCGGAGCCACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGGCGCCACGGGAGCAACCGGTGCAACAGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGGCGCCACGGGAGCAACCGGTGCAACAGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG

>NZ_CP022319|1|1|755121-755343|PILER-CR
ACCGGAGCCACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGG	CGCCACGGGAGCAACCGGTGCAACAGGCGCC
ACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGG	CGCCACGGGAGCAACCGGTGCAACAGGCGCC
ACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022319.1\|WP_047946766.1\|765155_765581_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022319.1\|WP_039962563.1\|765595_765868_-\|acylphosphatase	unknown	unknown	gnl\|CDD\|237710
NZ_CP022319.1\|WP_096881115.1\|741118_742261_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP022319.1\|WP_096881119.1\|756033_757629_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
NZ_CP022319.1\|WP_047946802.1\|743423_743801_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|288356
NZ_CP022319.1\|WP_096881117.1\|751662_752745_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	unknown	unknown	gnl\|CDD\|273015
NZ_CP022319.1\|WP_007496775.1\|744023_744371_+\|general-stress-protein	unknown	unknown	gnl\|CDD\|378584
NZ_CP022319.1\|WP_024719341.1\|759502_760801_+\|citrate-transporter	unknown	unknown	gnl\|CDD\|162036
NZ_CP022319.1\|WP_008341777.1\|762687_763173_-\|phenolic-acid-decarboxylase	unknown	unknown	gnl\|CDD\|368644
NZ_CP022319.1\|WP_024719344.1\|763286_763844_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP022319.1\|WP_096881121.1\|760982_762614_+\|peptidase-M14	unknown	unknown	gnl\|CDD\|349461
NZ_CP022319.1\|WP_017360404.1\|746479_747205_+\|GTP-cyclohydrolase-II-RibA	unknown	unknown	gnl\|CDD\|238348
NZ_CP022319.1\|WP_008343184.1\|745305_745962_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP022319.1\|WP_096881116.1\|742297_743302_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190
NZ_CP022319.1\|WP_056705585.1\|747237_748041_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|335469
NZ_CP022319.1\|WP_096881120.1\|758333_759311_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP022319.1\|WP_024718588.1\|748045_749803_+\|WD40-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|238121
NZ_CP022319.1\|WP_024719345.1\|763948_765055_+\|nitric-oxide-synthase	unknown	unknown	gnl\|CDD\|376957
NZ_CP022319.1\|WP_041506621.1\|757632_758331_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
NZ_CP022319.1\|WP_045035328.1\|750158_751511_+\|transposase	unknown	unknown	gnl\|CDD\|372705

Protein	Function_ID	Function_description	E-value
NZ_CP022319.1\|WP_039962563.1\|765595_765868_-\|acylphosphatase	gnl\|CDD\|237710	PRK14420, PRK14420, acylphosphatase; Provisional.	3.48726e-30
NZ_CP022319.1\|WP_096881115.1\|741118_742261_+\|ATP-dependent-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	5.095e-106
NZ_CP022319.1\|WP_096881119.1\|756033_757629_+\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	1.14612e-153
NZ_CP022319.1\|WP_047946802.1\|743423_743801_-\|hypothetical-protein	gnl\|CDD\|288356	pfam11486, DUF3212, Protein of unknown function (DUF3212). Members in this family of proteins are annotated as YfmB however currently no function for this protein is known.	1.50272e-66
NZ_CP022319.1\|WP_096881117.1\|751662_752745_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	gnl\|CDD\|273015	TIGR00326, eubact_ribD, riboflavin biosynthesis protein RibD. This model describes the ribD protein as found in Escherichia coli. The N-terminal domain includes the conserved zinc-binding site region captured in the model dCMP_cyt_deam and shared by proteins such as cytosine deaminase, mammalian apolipoprotein B mRNA editing protein, blasticidin-S deaminase, and Bacillus subtilis competence protein comEB. The C-terminal domain is homologous to the full length of yeast HTP reductase, a protein required for riboflavin biosynthesis. A number of archaeal proteins believed related to riboflavin biosynthesis contain only this C-terminal domain and are not found as full-length matches to this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Riboflavin, FMN, and FAD].	1.10221e-126
NZ_CP022319.1\|WP_007496775.1\|744023_744371_+\|general-stress-protein	gnl\|CDD\|378584	pfam11181, YflT, Heat induced stress protein YflT. YflT is a heat induced protein.	9.52497e-34
NZ_CP022319.1\|WP_024719341.1\|759502_760801_+\|citrate-transporter	gnl\|CDD\|162036	TIGR00784, Mg2+/citrate_complex_secondary_transporter, citrate transporter, CitMHS family. This family includes two characterized citrate/proton symporters from Bacillus subtilis. CitM transports citrate complexed to Mg2+, while the CitH apparently transports citrate without Mg2+. The family also includes uncharacterized transporters, including a third paralog in Bacillus subtilis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	0
NZ_CP022319.1\|WP_008341777.1\|762687_763173_-\|phenolic-acid-decarboxylase	gnl\|CDD\|368644	pfam05870, PA_decarbox, Phenolic acid decarboxylase (PAD). This family consists of several bacterial phenolic acid decarboxylase proteins. Phenolic acids, also called substituted cinnamic acids, are important lignin-related aromatic acids and natural constituents of plant cell walls. These acids (particularly ferulic, p-coumaric, and caffeic acids) bind the complex lignin polymer to the hemicellulose and cellulose in plants. The Phenolic acid decarboxylase (PAD) gene (pad) is transcriptionally regulated by p-coumaric, ferulic, or caffeic acid; these three acids are the three substrates of PAD.	4.54686e-102
NZ_CP022319.1\|WP_024719344.1\|763286_763844_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	6.11698e-22
NZ_CP022319.1\|WP_096881121.1\|760982_762614_+\|peptidase-M14	gnl\|CDD\|349461	cd06242, M14-like, Peptidase M14-like domain; uncharacterized subgroup. Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	1.04179e-84
NZ_CP022319.1\|WP_017360404.1\|746479_747205_+\|GTP-cyclohydrolase-II-RibA	gnl\|CDD\|238348	cd00641, GTP_cyclohydro2, GTP cyclohydrolase II (RibA). GTP cyclohydrolase II catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5' phosphate, formate, pyrophosphate (APy), and GMP in the biosynthetic pathway of riboflavin. Riboflavin is the precursor molecule for the synthesis of the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) which are essential to cell metabolism. The enzyme is present in plants and numerous pathogenic bacteria, especially gram negative organisms, who are dependent on endogenous synthesis of the vitamin because they lack an appropriate uptake system. For animals and humans, which lack this biosynthetic pathway, riboflavin is the essential vitamin B2. GTP cyclohydrolase II requires magnesium ions for activity and has a bound catalytic zinc. The functionally active form is thought to be a homodimer. A paralogous protein is encoded in the genome of Streptomyces coelicolor, which converts GTP to 2-amino-5-formylamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (FAPy), an activity that has otherwise been reported for unrelated GTP cyclohydrolases III.	2.51622e-69
NZ_CP022319.1\|WP_008343184.1\|745305_745962_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.73069e-16
NZ_CP022319.1\|WP_096881116.1\|742297_743302_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	0
NZ_CP022319.1\|WP_056705585.1\|747237_748041_+\|serine/threonine-protein-kinase	gnl\|CDD\|335469	pfam03781, FGE-sulfatase, Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.	3.33657e-35
NZ_CP022319.1\|WP_096881120.1\|758333_759311_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	1.11777e-63
NZ_CP022319.1\|WP_024718588.1\|748045_749803_+\|WD40-repeat-domain-containing-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	2.2197e-51
NZ_CP022319.1\|WP_024719345.1\|763948_765055_+\|nitric-oxide-synthase	gnl\|CDD\|376957	pfam02898, NO_synthase, Nitric oxide synthase, oxygenase domain.	0
NZ_CP022319.1\|WP_041506621.1\|757632_758331_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	1.37571e-88
NZ_CP022319.1\|WP_045035328.1\|750158_751511_+\|transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	9.79976e-29

>NZ_CP022319.1|WP_096881117.1|751662_752745_+|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD
MKDDVFYMKLAIANAKAMKGQTSPNPLVGAVIVQSGEIVGIGAHMKAGEPHAEIHALQMAGEKAKGADMYVTLEPCTHHGKTGPCTEAIIKSGVKKVLIATQDPNPVVAGKGIAFLKKAGIEVEQGICKQEADRLNAPFFHLMQTNLPYVILKSAISIDGKIATADQESKWITGIEARTEVQRLRQEVDAVLTGVETIIQDDAGLIVKDSFNHQPIRVILDSTLRIPLHAKCLTDHRAETIICTSQNYDHQKYQQLIQKGHQVFVTSGEQRTDLQDVLHLLKKRSVMSVLVEAGGSVSASFLEASLVNEAVIYMAPLLIGGKDAPTFFEGEGVKKLKKAIRPADIEYSMVGKDLKMTMTF
>NZ_CP022319.1|WP_045035328.1|750158_751511_+|transposase
MFHTRNSSQHEAEFVLLDQLVEEDHLLRKIDQYIDFSFIIDKVKPYYSENKGRPSLDPLILFKMMFIGYLYGIRSERQLEKEIYYNMAYRWFLGLNINDPVPHHSTISWNRRTRFKDTTIFQDIFDEIVLQAINHDMVGGRVLFTDSTHLKANANKHKYTRKTIEQDTQNYINDLEEAIQEDRVAHGKKPLKVKEEVKTEKDIRQSTTDPESGYLYRENKPEGFFYLDHRTTDMKYNIITDAHITPGNVHDSVPYLDRLDHQIARFGFQVEAVALDSGYLTTPICKGLSDRRIFGVIAHRRFHPTRGLFEKWKFKYDSEHDHYICPNGEKLLYTTTDRKGYRFYKSDPKKCTSCPFLERCTRSKNHQKVISRHIWEEHKEKIRQNRLSVSGKELYKKRKEKIERSFADSKQLHGLRYCRLRGKQNVSEQVLLTAACQNMKKIATHLAKLG
>NZ_CP022319.1|WP_024718588.1|748045_749803_+|WD40-repeat-domain-containing-protein
MHRGPITSVLSTQHDQIVYTGGYDRCIYKWDRATGEGTFIGSHEHIINSLSLSENGTYLASASSDYTIQLYDTSTHTKIRTLYGHADDVEAVAFAKQDTLLVSVSRDRRCLVWDIETGAILREFHGHSKDVLAVWIHEDKAYTTGDDGYVLVWLYETGEIVGEIGPFDYELDTISGSNQKEVFALGRDDGTVIIYDAATLQEKKIIKAHLQGVKRVNFSPSGNYLLTAGYDHLIKLWNYETGDLIDTLLPHKYQWERSLVWTEDEQAILGASFGKTYCEWSIQEGKVISDEQELATPSINDIALTEAGDIITASDDGKFRKNGIEIAKSTGVLTNGVAVARDGSYYAWGDHASQVHIVHESLQQMVSFDLNTGPVNSVYFHEEDRQFYIGTYGGYVHVISTEHLKEIGRSKAHDCAVKALKVEGDHIITAAVEGTICLLDKKSLSLTAEYIGATELLNDVFIDSKRDRIAIVSRDKNVRLFDLHTGRILNQHNEHQYSIKSITVTDSGYIVSGDYWGYIVVWNPELDVNTGPIRIAKNGISAIRQLGNDVYASSYDGGIYHIREDGTHTEVLRLFEQFPKEVISH
>NZ_CP022319.1|WP_056705585.1|747237_748041_+|serine/threonine-protein-kinase
MKPDINWIQIPSGYATIGSNEEDMKKASEFWKDKLLNPAYGREKKFQKWLYKEFPSYQPYINEFFISDTVVTNEWYQSYCDETGKPYPESLTNLELGGGKDHPAWGMDIEEAFSFCQWLSGKLGYEVSIPTEEEWEYAARGNTRHQYPWGDEFDPSYCNTHESNIEKTTPVRHYEKGRSLFGLYDMGGNVEEWVNTKYHIYEGGIEVVDDLTETLGSDYYILKGGSFARGGDLCRVARRHGKHPDPVFRFTGFRVVTRQKQHIKVGV
>NZ_CP022319.1|WP_017360404.1|746479_747205_+|GTP-cyclohydrolase-II-RibA
MNKFVAELQSMIHHFTFQEKHYLLVGPVNLPISIEHEEVQFTWYAFASVEADTTPTVESIVQMSTEQQTFSSCLLFGDFENEVPPLVRIHSVCQTGDVFGSLKCDCGPQLASSLKKITDYGKGMLVYMANQEGRSIGLMAKAFTYKLQEMKLDTFEANRLIGCGDDDRHYEEAAAVLHYLNKGKPLHLLTNNPDKVDSIAAYGLPVLRFDHTVEASLYNEAYLKAKAASGHMVDEKKLINQ
>NZ_CP022319.1|WP_008343184.1|745305_745962_+|methyltransferase-domain-containing-protein
MKKALYHEDSGLYLEKMRMAFQEHYEQRTDMWSTDPSLTDAAVMSLKAWRSREKDALASVLDIGCGNGRALEHLQGLSAYTGIDLYEHEEWQGLKKRKEVPVHFYHQDFMSWSMNQGRELTFDLILDHGCFHHQHPDDHERYLKQISSLLHEGGVFSLVVWGEEWKTGLIGEDGRFHFSFSDTQLGEKICTSGLELVSITPLQAKAGISQHHVIAVKI
>NZ_CP022319.1|WP_007496775.1|744023_744371_+|general-stress-protein
MKPVVREYSNDETLQRDVEQLKQLGVAREDIYVLSHDDDRTERIASNADANTIGPKEVGLKHAVGNIFSKKGDELRNKIHEIGFSKEEAETFEEHLDEGKVLLFVTDHEKVKNWA
>NZ_CP022319.1|WP_047946802.1|743423_743801_-|hypothetical-protein
MYYFSAEQQFNAWVISDLVKQLFQKWNPEESKAKPLTLFAEQHFHICIDYLFSIIINIGDIESIEQDPQDLLSSYLNILFPFVTHDMMKASMQNANEYLLKERDADEYQLFGCLPPLLSVSLQKK
>NZ_CP022319.1|WP_096881116.1|742297_743302_-|NADP-dependent-oxidoreductase
MSQQKQIQLAKRPKGLPTKDVFHFETVDIPTPQDGEVLIQTKYVSVDPYMRGRMQDTKSYTPPFKLNEVIQGGVVGEVVESKSPQFEKGDFVLGFLGWQEYSTAKAESLTKIDPSIAPLSYYLGILGMPGQTAYFGLLAIGQPKEGETVVISGAAGAVGSVVGQIAKIKGAHVVGIAGSDDKLAYLKELGFDETINYKTTNDLDDAIAKACPNGVDVYFDNVGGEISDAVMNHLNRFARIPVCGAISSYNISASEDIGPRVQTKLIKTSALMQGFIVANYSDRFEEAAKDLAQWVKEDKLTYKETIIEGFDHIPDAFLGLFKGENVGKQLVKVS
>NZ_CP022319.1|WP_096881115.1|741118_742261_+|ATP-dependent-helicase
MTENWAFLKEAKPFIQKNFEAAGFEKPTAIQEQTAEWITEKRDVIAESPTGTGKTLAYVLPLLNKIDVSIKHPQVLILAPSRELVMQIFDVVQEFKQGSDIKAISLIGGANIKKQQEKLKKHPNIVVATPGRVQELIKIKKLKMHEVKTIVLDEADQLLVPEHMKTIQAIIKSTLKERQILCFSATLKEETVQMIKDIASEPEVLRISRSQEEAQKVGHYYLLCDQRDKVKLLQKLSRLEDMQALVFVRDITNLSIYAEKLAYHHVDLGVLHSEAKKAERAIILKEFEQREFPLLLATDIAARGIDIDDLPYVIHADLPNEEGYIHRSGRTGRAGKEGAVISLVTSQEHSMLKKMAKKLNLSLQEIVYKQGQLHLAPKQA
>NZ_CP022319.1|WP_096881119.1|756033_757629_+|sensor-histidine-kinase
MGKRKVTLQTKILGLIIGLLLVVIALLTICFGFLQTSERQSQAEQLAVQTARTISYMPPIKTSVATGDSQNEEQAVLEQMKEQVRAHAIFITNQKGKVLFHTNHEDVGKTISVSEGRSTLLFGGTSISTGDSDGETVVRGSAPIMKETGSYEEIIGTVSVEFLKRDIDQATAHQLFKLSYIALLVLLPGVFGAIFLTRSIRKDILGLEPHEIASLYREREAMLHAIKEGIIAFDRKGAITMMNTSAEQMLRVSSTLPLHIDQVLPNANLLFYLKVETIEPNIESVVNDKTFVLNVKKVVQDNRVFGGIVSFREKTELTKLLDTLTEVSQYSEDLRAQTHEFSNKLYAILGLLELKQVDEAIELIKEEYTLQNRQHDLLMKQIRSPKIQAILLGKLGKASEKKVHFHIDENSSLEPLPAHLSLSHFITIIGNLVDNAFEAVLNKEKREVSLFITDIGFDIIIEVSDSGDGVDEGAISQLFTRGHSSKGEGRGYGLANVKEVLDELGGWIEVANQKEGGAIFTVYIPKGTKGE
>NZ_CP022319.1|WP_041506621.1|757632_758331_+|response-regulator
MIKVLIAEDDFRIAAIHESYIQKVQGFQVAGKAKSAKDLWEALQKEQVDLILLDVYMPDELGTNLLPLLRERHPEVDVIIITAATETMLLRDALHYGVVHYLIKPVTAQKFTQVLTEYKEKRELINSKDEVNQTMIDLFFGQIQEESQQKDERDLPTGINSLTLDKVKTFMAAEMNGITAEELGEKMGASRTTARRYVEYLVTTGECRAELAYGIIGRPERKYYPAKKQTES
>NZ_CP022319.1|WP_096881120.1|758333_759311_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKGILLLILVCLCTTLTFNEKTAKDSFLKHSPLYIVVSGVPDGGFDQTAQVMKTVLEQEKLVKEPVHILYQRGGTVDKGWTYMMERDANYISLNSSLLLSRNLLGSSNVTMNDVTPLAILAEEWQVVAVPVDSPFSNGKELLHALKKKPDSLKIGFAPDFGNDDQISFARAAEMAGIDPYRIQFLKFDSADDLFQALIDHEVDAATTTITEVRHDYEKKRLKLVATTTNQRLEGFKDVPTWKEQGIPLTFSHWRGVMGPKQMNQHDIRAWDQLLQKTTQTKSWKKQLKQKGWTGRYMNSKEAKVFMEEQLRRYEQFIQGEQAVK
>NZ_CP022319.1|WP_024719341.1|759502_760801_+|citrate-transporter
MLAILGFLMMVVFMVLIMTKRMSVLTALVLTPIAFALIAGFHFTEISDMIVKGVQQVAPTAVMIMFAILYFGIMIDAGLFDPMVAKILNIVKGDPLKIVVGTAVLTMLVALDGDGTTTYMITTTAMLPLFTLLGIRPIILAGIAGVGMGIMNTIPWGGATPRAASALGVDPSLLFGPMIPVIGAGVLSMIVVAYFLGKSERKRLGVIELEQPIHANEMAAALQDDIKRPKLWWFNLTLTLLLVLLLVSGKVSLTVLFVLAFCVAIIVNYPNLEQQRERIAAHSTNVLAIASMIFAAGVFTGILTGTKMVDEMAISIVSAIPEQLGGFIPVIVALTSGIFTFFMPNDAYFYGVLPILSETAAAYGVDKIEIARASIIGQPIHMLSPLVPSTHLLVGLVGVSLDQHQKFGMKWAVLAVVAMTVMAVLIGAISIW
>NZ_CP022319.1|WP_096881121.1|760982_762614_+|peptidase-M14
MSKQKSTILFAAVCLMAGSLSMVIPASANAETPYYGKSYEQPASVQKLYPEPDETFDTPAFQKKGKAFTTQEELQDFLRDIVSKSPYATQKQIGTSIEGRSIPGLYFTKDRHISPLSKKPTIWLQAQIHGNEPASGESALVIAKRLAGDEGERILSHVNVIIVPRINPDGSYAFDRRLANGMDGNRDHMTLESPELTALHQEFNRYAPEVVIDAHEYDVGQKQFEDIGASGALKYHDLLILSGKNLNIPESIRFTSNELYVNGVRETLTNKGFSNDLYYTNTRGKDGKIDLYEGGTDARIGRNALALSPALSFLVESRGIGIGREDFTRRVAAQVTTHEKIIETTVKHAKQVKQQMVTERLKLVKKGLQSNDDDQVVIQDAFKAPVNDSLEMVDIEKGQTTNVPVRFHSASDAVPVLTRERPTAYLILPGHEGVDRKLRTLGLKSVTLPVGMKVPVQAYEVTKRVETSKTDIQLETRLVEKKRQLPKGTKVYVTAQPETNLLSLALEPESKDSYMSSGFIASKVGDELPVYRFLLSQKTLGMK
>NZ_CP022319.1|WP_008341777.1|762687_763173_-|phenolic-acid-decarboxylase
MDQFVGLHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQEVNIVKLTKGVYKVSWTEPTGTDVSLNFMPEEKRMHGVIFFPKWVHERPDITVCYQNDYIDLMKESREKYETYPKYVVPEFADITYIHHAGVNDETIIAEAPYEGMTDEIRAGRK
>NZ_CP022319.1|WP_024719344.1|763286_763844_+|PadR-family-transcriptional-regulator
MRVLKYAILGLLDQRELTGYDMKKHFEDSLGQFWSAKHSQIYPELKRLTEEGFIEFDIHIQGKKLEKKVYQITDAGKRELHEWLRKKGPIPDTTKDEFMLKTFFISSMDQKEAAGLFSHQLLERTKKVEMLEQKLNVLTEEDPSAQSLHSTQFGHYLVLTRAIEREKGYVRWLQKTLEVIDSSIV
>NZ_CP022319.1|WP_024719345.1|763948_765055_+|nitric-oxide-synthase
MSNQEALWNEAEAFISVCYEELGKSNEEKAARLHEIKKEIESDGMYTHTQEELAHGAKMAWRNSNRCIGRLFWSTLHVHDCRHVTTEDEVKEALFHHIEYATNGGKIKPSITIFPPENKGRKEVVIYNHQLVRYAGYESEYGIIGDEASLELTKLCEAHGWKGEGTHFDLLPLMFQLKDQPPVLYDLPKEIVQEVEITHPEYDGFGDLGLKWYAVPIIADMKLEIGGIHYNAAPFNGWYMGTEIGARNLADENRYNMLKKVASILGLDTTKNASLWKDKAIVELNVAVLHSYREAGVTIVDHHTAAHQFKQFEKQEEKADRKLTGDWTWLIPPVSPAATHIFHRHYDNTIVKPNYFYQEKPYHGTERA
>NZ_CP022319.1|WP_047946766.1|765155_765581_+|hypothetical-protein
MKKMTLLIFLAVFSFNGFLPLGDERAKATTGTMVQNVIDLKVTTDRSTYTSLHPQVNVNMTATTNETLYYTAAIRKLTFPVTPVFTHEGSISGQNAFAAPTRLLLPNSGSANYDVHVSLYKDVSRTTLIGYYVANPFTVVK
>NZ_CP022319.1|WP_039962563.1|765595_765868_-|acylphosphatase
MVHYHAIVKGRVQGVGFRYFVQGEAVNRGIKGWVRNTDEGHVELKVEGEQQEVFDFLETVRKGSPFSKVTHLDMEPLTKFAHYQDFRIRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531071-531101	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531179-531209	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531287-531317	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531503-531533	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	126-156	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553196-553226	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648033-648063	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531071-531101	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531179-531209	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531287-531317	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531503-531533	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	126-156	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553196-553226	6	0.806
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648033-648063	6	0.806
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	MN694114	Marine virus AFVG_250M252, complete genome	19687-19717	7	0.774
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	MN694114	Marine virus AFVG_250M252, complete genome	19687-19717	7	0.774
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1409-1439	9	0.71
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	63973-64003	9	0.71
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	294972-295002	9	0.71
NZ_CP022319_1	1.1\|755177\|31\|NZ_CP022319\|PILER-CR	755177-755207	31	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	27600-27630	9	0.71
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1409-1439	9	0.71
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	63973-64003	9	0.71
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	294972-295002	9	0.71
NZ_CP022319_1	1.2\|755264\|31\|NZ_CP022319\|PILER-CR	755264-755294	31	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	27600-27630	9	0.71

1. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

2. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

3. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

4. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

5. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

6. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

7. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

8. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

9. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

10. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

11. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

12. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

13. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

14. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

15. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 7, identity: 0.774

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgcagggcgcaacgggagcaaccggcgcaac	Protospacer
 .  .***** **************.*****

16. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 7, identity: 0.774

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgcagggcgcaacgggagcaaccggcgcaac	Protospacer
 .  .***** **************.*****

17. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tctccggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

18. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

19. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

20. spacer 1.1|755177|31|NZ_CP022319|PILER-CR matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

21. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tctccggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

22. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

23. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

24. spacer 1.2|755264|31|NZ_CP022319|PILER-CR matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22161 : 30875

uncultured_Mediterranean_phage(16.67%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096880875.1\|22161_23436_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.3e-95	51.1
WP_008342025.1\|23537_24365_+	chemotaxis sensory transducer	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-10	54.4
WP_024719578.1\|24674_25334_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.1e-21	33.2
WP_017366700.1\|25330_25954_-	deoxyguanosine kinase	A0A1G5SAJ8	Enterococcus_phage	2.0e-12	28.8
WP_024719579.1\|26033_27335_-	LysM peptidoglycan-binding domain-containing protein	A0A2P1CIG4	Microbacterium_phage	1.4e-07	34.8
WP_024719580.1\|27380_27935_-	cysteine hydrolase	NA	NA	NA	NA
WP_008342015.1\|28014_28491_+	nucleoside deaminase	NA	NA	NA	NA
WP_008342013.1\|29162_30875_+	DNA polymerase III subunit gamma/tau	D9ZNI9	Clostridium_phage	6.8e-55	34.4

DBSCAN-SWA_2

657525 : 667421

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007496902.1\|657525_658821_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.9e-18	26.9
WP_007496901.1\|658893_659616_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.8e-46	43.7
WP_008344293.1\|659608_659863_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FKD5	Synechococcus_phage	1.6e-05	33.3
WP_008344292.1\|659859_660543_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_096881090.1\|660526_662758_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.5e-159	41.8
WP_017359819.1\|662733_664164_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.3e-51	32.9
WP_017366751.1\|664260_665301_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.1e-65	43.8
WP_008344288.1\|665297_665867_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.9e-31	39.5
WP_008344287.1\|665882_667421_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.8e-76	51.8

DBSCAN-SWA_3

1130357 : 1184420

Bacillus_phage(11.11%)

tRNA,coat,integrase

attL 1147254:1147269|attR 1183007:1183022

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008348488.1\|1130357_1131353_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_007499024.1\|1132107_1133745_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007499022.1\|1133861_1134806_+	ABC transporter permease	NA	NA	NA	NA
WP_017360167.1\|1134809_1135727_+	ABC transporter permease	NA	NA	NA	NA
WP_089374143.1\|1135730_1136819_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-14	28.5
WP_007499016.1\|1136820_1137738_+	ABC transporter ATP-binding protein	M1IB70	Acanthocystis_turfacea_Chlorella_virus	2.1e-07	26.1
WP_058337480.1\|1137843_1138131_+	hypothetical protein	NA	NA	NA	NA
WP_047945540.1\|1138268_1138847_+	N-acetyltransferase	NA	NA	NA	NA
WP_003211421.1\|1139040_1139436_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_007499010.1\|1139476_1140142_-	membrane protein	W8EBD0	Pseudomonas_phage	1.9e-29	37.5
WP_008348474.1\|1140406_1141072_+	adaptor protein MecA	NA	NA	NA	NA
WP_024720122.1\|1141157_1142678_+	cardiolipin synthase	NA	NA	NA	NA
WP_096882155.1\|1142840_1144001_+	competence protein	NA	NA	NA	NA
WP_089374144.1\|1144038_1146042_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	2.4e-59	25.5
WP_080770810.1\|1146024_1146204_-	hypothetical protein	NA	NA	NA	NA
WP_008348466.1\|1146269_1146443_-	hypothetical protein	NA	NA	NA	NA
WP_007499002.1\|1146739_1147651_-	DsbA family protein	NA	NA	NA	NA
1147254:1147269	attL	NA	NA	NA	NA
WP_007499001.1\|1147647_1148046_-	thiol management oxidoreductase	NA	NA	NA	NA
WP_008348461.1\|1148323_1149088_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	1.1e-36	68.1
WP_041092056.1\|1149113_1149689_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_008348459.1\|1149906_1150272_+	hypothetical protein	NA	NA	NA	NA
WP_008348457.1\|1150305_1150935_+	GTP pyrophosphokinase	NA	NA	NA	NA
WP_008355343.1\|1151000_1151801_+	NAD kinase	NA	NA	NA	NA
WP_096881233.1\|1151809_1152712_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_096881234.1\|1152752_1153496_-	hypothetical protein	S4TT53	Salmonella_phage	1.7e-07	24.0
WP_024720127.1\|1153656_1155504_+	sodium:proton antiporter	NA	NA	NA	NA
WP_017367022.1\|1155745_1156456_+	thiaminase II	NA	NA	NA	NA
WP_096881235.1\|1156430_1157048_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_096881236.1\|1157031_1158144_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_008348442.1\|1158140_1158344_+	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
WP_007498979.1\|1158348_1159116_+	thiazole synthase	NA	NA	NA	NA
WP_058337476.1\|1159112_1160126_+	thiamine biosynthesis protein MoeB	NA	NA	NA	NA
WP_047945548.1\|1160143_1160950_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003211867.1\|1161099_1161876_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
WP_041092047.1\|1161989_1162565_+\|coat	spore coat protein	NA	NA	NA	NA
WP_008348434.1\|1162602_1163046_-\|coat	spore coat protein	NA	NA	NA	NA
WP_008348432.1\|1163258_1163750_-\|coat	spore coat protein	NA	NA	NA	NA
WP_008348431.1\|1163897_1164383_-\|coat	spore coat protein	NA	NA	NA	NA
WP_024720135.1\|1164471_1164807_-	hypothetical protein	NA	NA	NA	NA
WP_007498962.1\|1164851_1165238_-\|coat	spore coat protein v	NA	NA	NA	NA
WP_035700339.1\|1165415_1165766_+	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_008348420.1\|1166050_1166272_+	hypothetical protein	NA	NA	NA	NA
WP_008348419.1\|1166356_1166494_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_008348417.1\|1166630_1166888_+	sporulation protein	NA	NA	NA	NA
WP_096881237.1\|1166904_1169214_-	ATP-dependent helicase	G3MA40	Bacillus_virus	6.3e-80	34.3
WP_008348414.1\|1169340_1169598_+	hypothetical protein	NA	NA	NA	NA
WP_008348412.1\|1169681_1170116_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_096881238.1\|1170122_1170638_-	hypothetical protein	NA	NA	NA	NA
WP_096881239.1\|1170690_1171431_-	esterase family protein	NA	NA	NA	NA
WP_072367633.1\|1171852_1172971_+	aminotransferase class V-fold PLP-dependent enzyme	A0A0B5JD48	Pandoravirus	1.2e-15	25.6
WP_017359653.1\|1172967_1174146_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_096881240.1\|1174441_1175677_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	6.5e-108	49.8
WP_096881241.1\|1175669_1176173_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.4e-23	34.4
WP_096881242.1\|1176270_1176876_-	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_096882156.1\|1176949_1177312_-	XRE family transcriptional regulator	A8ATX5	Listeria_phage	1.0e-08	42.9
WP_046343209.1\|1177482_1177680_+	XRE family transcriptional regulator	A8ATX6	Listeria_phage	2.3e-12	54.7
WP_096881243.1\|1177725_1177920_+	DNA-binding protein	U5P0W4	Brevibacillus_phage	4.8e-10	54.2
WP_034667563.1\|1178022_1178274_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_096881244.1\|1178276_1178546_+	hypothetical protein	NA	NA	NA	NA
WP_096881245.1\|1178906_1179098_+	hypothetical protein	NA	NA	NA	NA
WP_061419716.1\|1179130_1179352_+	hypothetical protein	NA	NA	NA	NA
WP_096881246.1\|1179462_1180374_+	hypothetical protein	A0A0A7RUE9	Clostridium_phage	2.3e-86	62.0
WP_096881247.1\|1180333_1181134_+	hypothetical protein	A0A0A7RUC1	Clostridium_phage	3.3e-60	46.3
WP_096881248.1\|1181133_1181319_+	hypothetical protein	NA	NA	NA	NA
WP_096881249.1\|1181347_1182208_+	hypothetical protein	I1W658	Staphylococcus_phage	4.1e-08	32.0
WP_073979814.1\|1182213_1182501_+	hypothetical protein	NA	NA	NA	NA
WP_096881250.1\|1182472_1183765_+	replicative DNA helicase	D2XR44	Bacillus_phage	3.0e-95	44.2
1183007:1183022	attR	NA	NA	NA	NA
WP_096882157.1\|1183779_1183974_+	hypothetical protein	NA	NA	NA	NA
WP_096881251.1\|1183970_1184420_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	2.5e-49	65.2

DBSCAN-SWA_4

1191451 : 1220730

Bacillus_phage(28.0%)

portal,capsid,holin,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881260.1\|1191451_1191796_+	structural protein	Q38579	Bacillus_phage	3.2e-25	54.4
WP_096881261.1\|1191863_1192328_+	hypothetical protein	NA	NA	NA	NA
WP_096881262.1\|1192380_1193658_+	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	1.7e-82	41.7
WP_096881263.1\|1193798_1194047_+	hypothetical protein	NA	NA	NA	NA
WP_096881264.1\|1194115_1194412_+	hypothetical protein	NA	NA	NA	NA
WP_096881265.1\|1194515_1195400_+\|terminase	terminase	D2IZ90	Enterococcus_phage	4.7e-28	37.2
WP_096881266.1\|1195396_1196704_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	3.7e-154	67.0
WP_096881267.1\|1196703_1198224_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.1e-138	50.8
WP_096881268.1\|1198220_1199123_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.3e-46	37.9
WP_096881269.1\|1199170_1200433_+	hypothetical protein	NA	NA	NA	NA
WP_096881270.1\|1200468_1201629_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	1.3e-81	51.9
WP_096881271.1\|1201652_1202582_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	7.0e-107	65.5
WP_096881272.1\|1202587_1202974_+	hypothetical protein	NA	NA	NA	NA
WP_096881273.1\|1202979_1203372_+	DUF3199 domain-containing protein	NA	NA	NA	NA
WP_096881274.1\|1203368_1203725_+	DUF3599 domain-containing protein	NA	NA	NA	NA
WP_096881275.1\|1203721_1204228_+\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	4.8e-41	48.8
WP_096881276.1\|1204232_1204688_+\|portal	phage portal protein	NA	NA	NA	NA
WP_073979156.1\|1204698_1204896_+	hypothetical protein	NA	NA	NA	NA
WP_096881277.1\|1204898_1206245_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	8.4e-85	41.9
WP_034282378.1\|1206246_1206690_+\|portal	phage portal protein	A0A0A7RVP1	Clostridium_phage	1.3e-26	45.8
WP_082136068.1\|1206999_1207182_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_096881278.1\|1207241_1207691_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	35.8
WP_008361258.1\|1207714_1207867_+	hypothetical protein	NA	NA	NA	NA
WP_096881279.1\|1207870_1212835_+	transglycosylase	A0A1L2JY60	Aeribacillus_phage	5.9e-43	41.3
WP_096881280.1\|1212827_1213490_+	LysM peptidoglycan-binding domain-containing protein	A0A0K2SUI2	Clostridium_phage	1.9e-26	32.1
WP_096881281.1\|1213501_1214599_+\|portal	phage portal protein	H7BV96	unidentified_phage	5.3e-37	28.6
WP_003212795.1\|1214595_1214877_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	5.9e-09	40.4
WP_096881282.1\|1214876_1215305_+	DUF2634 domain-containing protein	A0A0A7RTU4	Clostridium_phage	3.3e-11	33.3
WP_096881283.1\|1215297_1216344_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.4e-58	38.4
WP_096881284.1\|1216330_1217254_+	DUF2313 domain-containing protein	A0A0A7RTT8	Clostridium_phage	5.5e-11	27.7
WP_096881285.1\|1217266_1217650_+	hypothetical protein	NA	NA	NA	NA
WP_096881286.1\|1217667_1218798_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	7.1e-37	61.7
WP_096881287.1\|1218803_1219178_+	hypothetical protein	M4ZR44	Bacillus_phage	2.1e-09	40.7
WP_081105476.1\|1219177_1219318_+	XkdX family protein	A0A2H4JD72	uncultured_Caudovirales_phage	3.6e-07	56.8
WP_034620157.1\|1219379_1219592_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.0e-13	56.5
WP_096881288.1\|1219607_1219871_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	8.8e-31	75.9
WP_096881289.1\|1219929_1220730_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	3.4e-65	70.1

DBSCAN-SWA_5

1752966 : 1759214

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017359034.1\|1752966_1753359_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	8.8e-27	56.5
WP_017359033.1\|1753318_1755421_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	82.8
WP_024720404.1\|1755438_1756419_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.4e-150	80.9
WP_058213759.1\|1756502_1757120_+	hypothetical protein	A0A127AYS1	Bacillus_phage	2.3e-45	45.3
WP_008344009.1\|1757175_1757934_-	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	8.7e-47	53.8
WP_008344008.1\|1758254_1759214_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.9e-52	39.6

DBSCAN-SWA_6

2100163 : 2107871

Ostreococcus_lucimarinus_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881578.1\|2100163_2101255_-	3-dehydroquinate synthase	E5ERI4	Ostreococcus_lucimarinus_virus	8.2e-22	27.6
WP_007500947.1\|2101254_2102427_-	chorismate synthase	A0A291AU41	Pandoravirus	5.9e-42	35.2
WP_008344547.1\|2102503_2103280_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_003216015.1\|2103424_2103871_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.5e-27	42.3
WP_007500951.1\|2104000_2104963_-	heptaprenyl diphosphate synthase component II	A0A1V0SE37	Indivirus	1.7e-07	26.0
WP_007500957.1\|2104987_2105692_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_024718505.1\|2105695_2106463_-	heptaprenyl diphosphate synthase	NA	NA	NA	NA
WP_008344541.1\|2106578_2106809_-	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_003215789.1\|2106832_2107402_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	1.8e-49	57.3
WP_003215863.1\|2107592_2107871_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	5.6e-28	74.2

DBSCAN-SWA_7

2145724 : 2153944

Staphylococcus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017367523.1\|2145724_2146876_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-24	37.7
WP_024718922.1\|2146986_2147466_-	DUF3907 domain-containing protein	NA	NA	NA	NA
WP_008344462.1\|2147579_2148173_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.0e-15	36.0
WP_007501021.1\|2148162_2148921_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	6.5e-10	36.8
WP_008359694.1\|2149131_2149224_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_045035328.1\|2149351_2150704_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.9e-89	42.4
WP_072367786.1\|2150887_2151412_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_017359785.1\|2151637_2151991_-	N-acetyltransferase	NA	NA	NA	NA
WP_007501031.1\|2152104_2152569_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.1e-43	66.0
WP_017359786.1\|2152595_2153219_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.6e-57	58.6
WP_096881586.1\|2153230_2153944_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	6.7e-41	40.8

DBSCAN-SWA_8

2513266 : 2573430

Moraxella_phage(18.18%)

tRNA,protease,coat,integrase,tail

attL 2557523:2557558|attR 2573562:2573597

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881693.1\|2513266_2514298_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_096881694.1\|2514335_2515580_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_073413820.1\|2515734_2515923_+	hypothetical protein	NA	NA	NA	NA
WP_008342821.1\|2515911_2517204_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
WP_096881695.1\|2517231_2518203_-	porphobilinogen synthase	NA	NA	NA	NA
WP_096881696.1\|2518199_2518991_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_047946283.1\|2518987_2519923_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_007501558.1\|2519960_2520791_-	hypothetical protein	NA	NA	NA	NA
WP_024718410.1\|2520798_2522166_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_024718411.1\|2522406_2522892_+	hypothetical protein	NA	NA	NA	NA
WP_007501562.1\|2522936_2523524_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_096881697.1\|2523520_2525845_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	8.3e-181	43.9
WP_007501566.1\|2526016_2527678_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	1.9e-17	26.9
WP_017358145.1\|2527816_2529082_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.2
WP_017358146.1\|2529333_2530608_-	trigger factor	NA	NA	NA	NA
WP_008342841.1\|2530848_2531856_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_008342843.1\|2531979_2532579_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_007501575.1\|2532594_2534010_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_039166990.1\|2534052_2535150_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_096881698.1\|2535168_2536722_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	7.1e-11	27.3
WP_007501581.1\|2536708_2537737_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_007501584.1\|2537755_2538274_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_008342854.1\|2538270_2539995_-	acetolactate synthase, large subunit, biosynthetic type	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	2.8e-64	31.0
WP_008342856.1\|2540373_2541288_-	branched-chain-amino-acid transaminase	NA	NA	NA	NA
WP_024718416.1\|2541720_2542764_+	lactonase family protein	NA	NA	NA	NA
WP_008342863.1\|2542959_2543379_-	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	1.2e-08	30.5
WP_024718418.1\|2543474_2544641_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003216498.1\|2544640_2544877_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
WP_017367738.1\|2544898_2546083_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.5e-16	27.9
WP_096881699.1\|2546079_2547585_-	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9L3I8	Tupanvirus	2.5e-45	29.9
WP_003216493.1\|2547599_2547743_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_096881700.1\|2548003_2549278_-	DUF1668 domain-containing protein	NA	NA	NA	NA
WP_017358156.1\|2550041_2550221_-	hypothetical protein	NA	NA	NA	NA
WP_096881701.1\|2550421_2550736_+	hypothetical protein	NA	NA	NA	NA
WP_096881702.1\|2551233_2551590_-	hypothetical protein	NA	NA	NA	NA
WP_096881703.1\|2551631_2552261_-	hypothetical protein	NA	NA	NA	NA
WP_096881704.1\|2552443_2552854_-	hypothetical protein	NA	NA	NA	NA
WP_096881705.1\|2552886_2553738_-	hypothetical protein	C9E2Q0	Enterococcus_phage	9.8e-31	33.6
WP_096882169.1\|2555330_2556209_-	amidinotransferase	NA	NA	NA	NA
WP_096881706.1\|2556494_2556878_-	ArpU family transcriptional regulator	NA	NA	NA	NA
2557523:2557558	attL	NA	NA	NA	NA
WP_024427813.1\|2557838_2558381_-	hypothetical protein	NA	NA	NA	NA
WP_096881707.1\|2558470_2561254_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	1.3e-92	41.5
WP_024427146.1\|2561250_2561478_-	hypothetical protein	NA	NA	NA	NA
WP_024427147.1\|2561537_2562248_-	hypothetical protein	NA	NA	NA	NA
WP_024427148.1\|2562272_2562602_-	hypothetical protein	NA	NA	NA	NA
WP_024427150.1\|2562801_2563134_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_024427151.1\|2563234_2564167_-	hypothetical protein	NA	NA	NA	NA
WP_041107140.1\|2564156_2564381_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_024427153.1\|2565944_2566481_-	hypothetical protein	NA	NA	NA	NA
WP_024427154.1\|2566477_2566825_-	hypothetical protein	NA	NA	NA	NA
WP_024427155.1\|2566933_2567149_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_024427156.1\|2567176_2567935_+	hypothetical protein	NA	NA	NA	NA
WP_024427157.1\|2568016_2568859_+	hypothetical protein	NA	NA	NA	NA
WP_096881708.1\|2569114_2569402_-	hypothetical protein	NA	NA	NA	NA
WP_096881709.1\|2570146_2570434_-	hypothetical protein	NA	NA	NA	NA
WP_096881710.1\|2570430_2570712_-	hypothetical protein	NA	NA	NA	NA
WP_024427161.1\|2570727_2571051_-	hypothetical protein	NA	NA	NA	NA
WP_024427162.1\|2571717_2572254_-\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	2.6e-37	47.5
WP_024427163.1\|2572434_2573430_-\|integrase	site-specific integrase	NA	NA	NA	NA
2573562:2573597	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2836376 : 2863870

Bacillus_phage(28.0%)

terminase,capsid,holin,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881775.1\|2836376_2837195_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	8.5e-64	52.5
WP_019743388.1\|2837214_2837478_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	7.7e-27	69.0
WP_017367922.1\|2837490_2837703_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	5.1e-13	53.6
WP_039170001.1\|2837739_2837880_-	XkdX family protein	NA	NA	NA	NA
WP_041507667.1\|2837879_2838200_-	hypothetical protein	O64053	Bacillus_phage	6.1e-18	45.2
WP_096881776.1\|2838213_2839599_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.7e-27	31.6
WP_096881777.1\|2839632_2840763_-	hypothetical protein	NA	NA	NA	NA
WP_096881778.1\|2840770_2840944_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.6e-07	46.9
WP_096881779.1\|2840940_2841270_-\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	2.0e-08	34.6
WP_096881780.1\|2841280_2842159_-	hypothetical protein	NA	NA	NA	NA
WP_017359000.1\|2842174_2842558_-	hypothetical protein	NA	NA	NA	NA
WP_096881781.1\|2842569_2843493_-	DUF2313 domain-containing protein	A0A0A7RTT8	Clostridium_phage	9.4e-11	28.5
WP_039169972.1\|2843479_2844526_-\|portal	phage portal protein	S6AVU3	Thermus_phage	1.9e-68	43.5
WP_024719684.1\|2844518_2844941_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_039169977.1\|2844955_2845222_-	DUF2577 domain-containing protein	S6C459	Thermus_phage	6.2e-08	37.5
WP_017367933.1\|2845218_2846229_-	hypothetical protein	H7BV96	unidentified_phage	1.0e-34	28.4
WP_007500584.1\|2846240_2846909_-	LysM peptidoglycan-binding domain-containing protein	A0A0K2SUI2	Clostridium_phage	2.9e-22	29.6
WP_096881782.1\|2846901_2850870_-	transglycosylase	A0A1L2JY60	Aeribacillus_phage	7.3e-44	45.3
WP_008344097.1\|2850925_2851063_-	hypothetical protein	NA	NA	NA	NA
WP_008344099.1\|2851104_2851545_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.7e-10	35.8
WP_096881783.1\|2851522_2851705_-	hypothetical protein	NA	NA	NA	NA
WP_074041930.1\|2851697_2851787_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_003213309.1\|2852063_2852507_-\|portal	phage portal protein	A0A0A7RVP1	Clostridium_phage	7.6e-27	46.5
WP_024719687.1\|2852508_2853855_-\|portal	phage portal protein	A0A0A7RTT5	Clostridium_phage	1.1e-76	40.3
WP_056702583.1\|2853858_2854071_-	hypothetical protein	NA	NA	NA	NA
WP_096881784.1\|2854057_2854513_-\|portal	phage portal protein	NA	NA	NA	NA
WP_025207873.1\|2854517_2855015_-\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	5.3e-37	46.2
WP_057079151.1\|2855011_2855368_-	DUF3599 domain-containing protein	NA	NA	NA	NA
WP_056702591.1\|2855364_2855748_-	DUF3199 domain-containing protein	NA	NA	NA	NA
WP_096881785.1\|2855761_2856685_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	4.4e-109	64.3
WP_096881786.1\|2856707_2857799_-\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	5.2e-61	40.9
WP_039169994.1\|2857833_2859291_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.9e-138	53.0
WP_096881787.1\|2859287_2860601_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	5.4e-153	62.2
WP_008344125.1\|2860597_2861245_-\|terminase	terminase	A0A2P1JTW4	Anoxybacillus_phage	2.5e-42	43.7
WP_096881788.1\|2861397_2861916_-	Fis family transcriptional regulator	A0A2H4J6J3	uncultured_Caudovirales_phage	5.8e-34	46.2
WP_008344129.1\|2862040_2862247_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	9.0e-15	68.5
WP_041507685.1\|2862243_2862648_-	Holliday junction DNA helicase	NA	NA	NA	NA
WP_017358978.1\|2862750_2862933_-	hypothetical protein	NA	NA	NA	NA
WP_017358976.1\|2863093_2863333_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_007500560.1\|2863492_2863870_+	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.6e-17	45.4

DBSCAN-SWA_10

3102952 : 3111710

Thermus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881864.1\|3102952_3104965_-	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	1.0e-25	26.9
WP_008347658.1\|3105797_3106268_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.4e-47	62.5
WP_096881865.1\|3106407_3108747_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.2e-91	41.2
WP_008347663.1\|3108766_3109513_-	carboxylesterase	NA	NA	NA	NA
WP_003212746.1\|3109636_3109870_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_008347666.1\|3110057_3110348_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	8.8e-08	47.5
WP_008347669.1\|3110385_3110619_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_007500204.1\|3110773_3111178_+	XRE family transcriptional regulator	S6C481	Thermus_phage	4.2e-16	43.3
WP_096881866.1\|3111308_3111710_+	transcriptional regulator	S6C481	Thermus_phage	7.6e-18	55.1

DBSCAN-SWA_11

3177449 : 3186453

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096881890.1\|3177449_3178430_+	D-glycerate dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	4.9e-18	26.9
WP_096881891.1\|3178582_3179098_+	ribonuclease	NA	NA	NA	NA
WP_096881892.1\|3179149_3179893_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_008348124.1\|3179932_3180190_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_096881893.1\|3180216_3181167_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	5.6e-51	38.1
WP_008348128.1\|3181184_3182144_-	YvcK family protein	A1IMD5	Streptococcus_phage	3.2e-62	40.4
WP_096881894.1\|3182144_3183068_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.5e-05	26.3
WP_008348133.1\|3183071_3183536_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_029575420.1\|3183894_3184845_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	6.3e-87	53.6
WP_041091649.1\|3185079_3186453_-	peptidase C40	A0A0A0RVE6	Bacillus_phage	8.1e-27	54.3

DBSCAN-SWA_12

3437272 : 3482765

Escherichia_phage(28.57%)

tRNA,protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008343507.1\|3437272_3438946_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_008343509.1\|3438942_3439365_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_096881978.1\|3439911_3440784_-	agmatinase	NA	NA	NA	NA
WP_096881979.1\|3440853_3441684_-	spermidine synthase	NA	NA	NA	NA
WP_096881980.1\|3441909_3443979_+	penicillin-binding protein	NA	NA	NA	NA
WP_007497712.1\|3444104_3444623_-	hypothetical protein	NA	NA	NA	NA
WP_034738184.1\|3444635_3445298_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_008343530.1\|3445405_3445591_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_024719439.1\|3445643_3446456_-	peptidase M84	NA	NA	NA	NA
WP_039165237.1\|3446830_3448159_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_096881981.1\|3448198_3449083_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096881982.1\|3449233_3449785_+	FMN reductase (NADPH)	NA	NA	NA	NA
WP_096881983.1\|3449768_3450794_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_056408369.1\|3450793_3451048_+	glutaredoxin family protein	NA	NA	NA	NA
WP_008343543.1\|3451082_3451646_+	N-acetyltransferase	NA	NA	NA	NA
WP_008343545.1\|3451659_3452421_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_096881984.1\|3452438_3453281_+	L-cystine-binding protein TcyK	NA	NA	NA	NA
WP_096881985.1\|3453297_3454008_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_096881986.1\|3454004_3454748_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-33	39.2
WP_024719448.1\|3454852_3455353_-	YwgA family protein	NA	NA	NA	NA
WP_007497716.1\|3455383_3456685_-	HD domain-containing protein	A0A1V0SGM3	Hokovirus	1.6e-24	30.3
WP_003215259.1\|3456855_3457077_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_096881987.1\|3457319_3458111_+	RsfA family transcriptional regulator	NA	NA	NA	NA
WP_008343557.1\|3458146_3458380_-	hypothetical protein	NA	NA	NA	NA
WP_096881988.1\|3458376_3460653_-	cellulose synthase	NA	NA	NA	NA
WP_096881989.1\|3460756_3461242_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_096881990.1\|3461277_3462123_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_096881991.1\|3462359_3462755_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_056704175.1\|3462920_3463361_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_096881992.1\|3463360_3465148_-\|transposase	transposase	NA	NA	NA	NA
WP_008343583.1\|3465159_3465438_-	hypothetical protein	NA	NA	NA	NA
WP_096881993.1\|3465442_3465841_-	DUF5082 domain-containing protein	NA	NA	NA	NA
WP_008343597.1\|3466022_3466994_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_024719459.1\|3467233_3468004_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_039165210.1\|3468071_3469232_+	MFS transporter	NA	NA	NA	NA
WP_056408380.1\|3469247_3469727_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_096881994.1\|3469872_3471105_+	MFS transporter	NA	NA	NA	NA
WP_024719463.1\|3471254_3471860_+	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
WP_096881995.1\|3471861_3472569_+	cupin domain-containing protein	NA	NA	NA	NA
WP_096881996.1\|3472565_3473327_+	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-25	33.5
WP_096881997.1\|3473342_3474764_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_080673841.1\|3474778_3475975_+	aspartate aminotransferase	NA	NA	NA	NA
WP_034647680.1\|3475990_3476788_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_008343612.1\|3476874_3477330_-\|coat	spore coat protein	NA	NA	NA	NA
WP_096881998.1\|3477322_3478177_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.2e-33	36.4
WP_050826716.1\|3478180_3479146_-	dTDP-glucose 4,6-dehydratase	K7QJG5	Escherichia_phage	3.2e-78	45.6
WP_047945793.1\|3479142_3479883_-	glucose-1-phosphate thymidylyltransferase	G3MA50	Bacillus_virus	2.7e-45	41.6
WP_096881999.1\|3479885_3480914_-\|coat	spore coat protein	NA	NA	NA	NA
WP_096882000.1\|3480910_3481651_-\|coat	spore coat protein	NA	NA	NA	NA
WP_096882001.1\|3481640_3482765_-\|coat	spore coat protein	A0A1B1IVE2	uncultured_Mediterranean_phage	5.8e-23	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage