CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP042274	Agrobacterium tumefaciens strain 186 chromosome Circular, complete sequence	1 crisprs	WYL,csa3,cas3,DEDDh	1	4
NZ_CP042277	Agrobacterium tumefaciens strain 186 plasmid pTi, complete sequence	0 crisprs	NA	0	0
NZ_CP042275	Agrobacterium tumefaciens strain 186 chromosome Linear, complete sequence	0 crisprs	DEDDh,csa3	0	1
NZ_CP042276	Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042274_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042274_1

1295439-1295524

Orphan

Consensus_repeat	Method
GCCTTCTTCTTGGCCGGAGCCTTCTTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042274_1

>merge|NZ_CP042274|1|1295439-1295524|CRISPRCasFinder
GCCTTCTTCTTGGCCGGAGCCTTCTTCTTCGGAGCGGCTTCTTCGCCTTCAGCGGCGTCGTCAGCCTTGGCAGCAGCCTTTTTCTT

>NZ_CP042274|1|1|1295439-1295524|CRISPRCasFinder
GCCTTCTTCTTGGCCGGAGCCTTCTTCTT	CGGAGCGGCTTCTTCGCCTTCAGCGGCG
TCGTCAGCCTTGGCAGCAGCCTTTTTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042274.1\|WP_003502985.1\|1292085_1293489_+\|Si-specific-NAD(P)(+)-transhydrogenase	unknown	unknown	gnl\|CDD\|235373
NZ_CP042274.1\|WP_099085379.1\|1285313_1286141_-\|TolB-family-protein	unknown	unknown	gnl\|CDD\|223893
NZ_CP042274.1\|WP_163117923.1\|1288806_1290747_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP042274.1\|WP_099085371.1\|1306053_1307586_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341246
NZ_CP042274.1\|WP_003495735.1\|1298491_1298635_+\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP042274.1\|WP_003502992.1\|1297885_1298032_+\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP042274.1\|WP_003503006.1\|1305793_1306057_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|223314
NZ_CP042274.1\|WP_162686123.1\|1299219_1300662_+\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	unknown	unknown	gnl\|CDD\|235416
NZ_CP042274.1\|WP_099085377.1\|1286904_1288584_-\|NAD+-synthase	unknown	unknown	gnl\|CDD\|237577
NZ_CP042274.1\|WP_003502986.1\|1293773_1294421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042274.1\|WP_163117924.1\|1304947_1305688_+\|DUF922-domain-containing-Zn-dependent-protease	unknown	unknown	unknown
NZ_CP042274.1\|WP_099085378.1\|1286333_1286711_+\|bleomycin-resistance-family-protein	unknown	unknown	gnl\|CDD\|319937
NZ_CP042274.1\|WP_099085374.1\|1301287_1301863_-\|pilus-assembly-protein-TadE	unknown	unknown	gnl\|CDD\|227296
NZ_CP042274.1\|WP_003503003.1\|1303533_1304661_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP042274.1\|WP_099086105.1\|1294642_1295203_-\|nucleoside-kinase	unknown	unknown	gnl\|CDD\|238835
NZ_CP042274.1\|WP_163117922.1\|1282986_1284093_+\|DUF2865-domain-containing-protein	unknown	unknown	gnl\|CDD\|371363
NZ_CP042274.1\|WP_099085380.1\|1284274_1284991_-\|5,6-dimethylbenzimidazole-synthase	unknown	unknown	gnl\|CDD\|380321
NZ_CP042274.1\|WP_060726292.1\|1300709_1301291_-\|pilus-assembly-protein-TadG	unknown	unknown	gnl\|CDD\|377921
NZ_CP042274.1\|WP_099085376.1\|1290863_1291397_+\|DUF1003-domain-containing-protein	unknown	unknown	gnl\|CDD\|226844
NZ_CP042274.1\|WP_099085373.1\|1301849_1303103_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296

Protein	Function_ID	Function_description	E-value
NZ_CP042274.1\|WP_003502985.1\|1292085_1293489_+\|Si-specific-NAD(P)(+)-transhydrogenase	gnl\|CDD\|235373	PRK05249, PRK05249, Si-specific NAD(P)(+) transhydrogenase.	0
NZ_CP042274.1\|WP_099085379.1\|1285313_1286141_-\|TolB-family-protein	gnl\|CDD\|223893	COG0823, TolB, Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion].	1.31527e-55
NZ_CP042274.1\|WP_163117923.1\|1288806_1290747_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	1.69082e-129
NZ_CP042274.1\|WP_099085371.1\|1306053_1307586_+\|AMP-binding-protein	gnl\|CDD\|341246	cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL). Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.	0
NZ_CP042274.1\|WP_003495735.1\|1298491_1298635_+\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	2.25674e-13
NZ_CP042274.1\|WP_003502992.1\|1297885_1298032_+\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	9.83257e-10
NZ_CP042274.1\|WP_003503006.1\|1305793_1306057_+\|acyl-carrier-protein	gnl\|CDD\|223314	COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	1.4639e-06
NZ_CP042274.1\|WP_162686123.1\|1299219_1300662_+\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	gnl\|CDD\|235416	PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed.	0
NZ_CP042274.1\|WP_099085377.1\|1286904_1288584_-\|NAD+-synthase	gnl\|CDD\|237577	PRK13981, PRK13981, NAD synthetase; Provisional.	0
NZ_CP042274.1\|WP_099085378.1\|1286333_1286711_+\|bleomycin-resistance-family-protein	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	1.59579e-23
NZ_CP042274.1\|WP_099085374.1\|1301287_1301863_-\|pilus-assembly-protein-TadE	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	3.79969e-07
NZ_CP042274.1\|WP_003503003.1\|1303533_1304661_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP042274.1\|WP_099086105.1\|1294642_1295203_-\|nucleoside-kinase	gnl\|CDD\|238835	cd01672, TMPK, Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).	1.26931e-05
NZ_CP042274.1\|WP_163117922.1\|1282986_1284093_+\|DUF2865-domain-containing-protein	gnl\|CDD\|371363	pfam11064, DUF2865, Protein of unknown function (DUF2865). This bacterial family of proteins has no known function.	3.35789e-30
NZ_CP042274.1\|WP_099085380.1\|1284274_1284991_-\|5,6-dimethylbenzimidazole-synthase	gnl\|CDD\|380321	cd02145, BluB, 5,6-dimethylbenzimidazole synthase. BluB catalyzes the O2-dependent conversion of FMNH2 to 5,6-dimethylbenzimidazole (DMB), a component of vitamin B12; is is a subfamily of the nitroreductase family; nitroreductases typically reduce their substrates by using NAD(P)H as electron donor and often use FMN as a cofactor.	2.83328e-110
NZ_CP042274.1\|WP_060726292.1\|1300709_1301291_-\|pilus-assembly-protein-TadG	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	1.51558e-07
NZ_CP042274.1\|WP_099085376.1\|1290863_1291397_+\|DUF1003-domain-containing-protein	gnl\|CDD\|226844	COG4420, COG4420, Predicted membrane protein [Function unknown].	7.09593e-71
NZ_CP042274.1\|WP_099085373.1\|1301849_1303103_-\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	3.97551e-10

>NZ_CP042274.1|WP_099086105.1|1294642_1295203_-|nucleoside-kinase
MGVRNYLIEGVSGTGKTSVATELQRRGYHVIHGDRELAYKGDPETGEPVDLSLFQGEGDIIYRHRRHIWDVEKVRALVTDRGHAITFFCGGSRNFGRFIDRFDQVFVLDIDVATLQRRLMERSEDEFGGKADEREFVLRLHATKEDLPASATVIDSSRPLDVVIDDILARCVGPTSGNEQHGDSSF
>NZ_CP042274.1|WP_003502986.1|1293773_1294421_-|hypothetical-protein
MSLRTGSALALSLFTAATAAHADEAGLIWKPVKNSDRSYTARIGAKLPVDTPIRAGLEMGMNASRTGQVVDTPVRLWGNVTLLAEQLPGVSLARDVGVIVNALTGSSSLSMTSQQKRIVTPELDIEANRNFTVRYDGTAQQWNGLDVSQSLRLSRSETGTAFVLTGASRNSFNEFSSGVAVEQKIGDNLTVRGTLDQGFADHFRPGVSARYSIRW
>NZ_CP042274.1|WP_003502985.1|1292085_1293489_+|Si-specific-NAD(P)(+)-transhydrogenase
MHQFDLIVVGSGPAGRRAAIQAAKLEKRVLVIEKGSRVGGVSVHTGTIPSKTLRETALNLTGWRERGFYGRAYRVKQEIDAEDLRRRLLITLDHEVEVLEHQFARNRVQHIRGTASFIDANTMKVVKSDGEIMTVTATSILLTIGTRPYRPPHIPFDGEAVLDSDEILEIKELPRSMIVVGAGVIGIEYATIFSALDTQVTVVEPRETMLEFIDKEIVEDFAYQLRDRNMKLIFGQKAEKVERDDSGKCLVSLGNGRVLKAETVLFAAGRVGATDTLNLSACGLEADSRGRLKVDPETFQTSVPNIYAAGDIIGFPSLASTSMEQGRIAARHAVGAPAGEPPQFFPYGIYAVPEISTCGLTEEEVIERAIPYECGIAHFRETSRGHIMGLDSGLLKMIFSLKTRRLLGVHIVGEGATELVHIGQAVLNLKGTVEYFVENTFNYPTLAEAYKIAGLDAWNRMGEIKKD
>NZ_CP042274.1|WP_099085376.1|1290863_1291397_+|DUF1003-domain-containing-protein
MSDISDYIVSHFKRSSREIGEVERRILELSHQKKLVSSDINAEFSAGASLGDRLADNIAKVGGSWGFILSFCFFLVVWAIVNTIVLTTRAFDPYPFIFLNLLLSMLAAIQAPIIMMSQNRQAARDRFEAAKDYEVNLKAELEVLSLHEKIDMKVLAELAALRQDLAVLHRHVTRKED
>NZ_CP042274.1|WP_163117923.1|1288806_1290747_+|LTA-synthase-family-protein
MGLRHSAPKTTASEKAGFVFSPAGIRSLSKLSGTAYTLANLTVASVVLVVVLEWIARGSLTDVGAFLTSSARPGMTTIAAVLALLVALDAILGRRYLSLIAIAPLCAMTGLISAQKQTYLSDPLYPSDLLFGRQILELLPTMLKAQPLTAALLGLGICAAIAALVALWLLARRHSPVLRWRERAAGLALALPLLAGLASLMDYSHYSWARDRLNIIPMMWDQQENYRHNGFLMAFAFNIPMANVSAPQGYGENSIADLTSKPAAFAANKGDYPDVIMLMSESLWDPARLDNVSLSADPIPTIRAKQSGNVFSPEFGGMTANVEFEALTGFSNAFLPYGSIPYQQYIRRPVPSLASFFRGEGYSAIAMHPFQEWFWNRKQVYRNFGFEEFRSEETLPAMEKRGNFASDDALMDEIMATADRTQNPLFLFAVTLQGHGPYEATRYAENTIGVEGDLSASASQALATYSQGVAEADEALLKLMRWAKKRDRETIIVLFGDHLPPLGQTFVESGYMPGMVASRRAPLEVMKKEHETPLVVWSSKKGVRKNIGTISPALLPYHVLKTAGFSDPFYTGTLGEVQKAFSVIDRHMLVATDGKALPDWSIAPNSIPDVVRDYRLLQFDMMFGQQYGRERFFPGFNWLHEGAPSV
>NZ_CP042274.1|WP_099085377.1|1286904_1288584_-|NAD+-synthase
MSDRHDIQNHLRIAVGQFNPTVGDVAGNFAKAREARADAATQGADLLLLTELFISGYPPEDLVLKPAFLKACLKAVEELAAETADGGPGVVIGFPRQGETGRHNSVALLDGGKIIALRDKIDLPNYGEFDEKRVFSEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLSESGAEILLVPNGSPYYRGKLDVRHQVALRQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMSQFEATLAVTDWKRTADGWRCESGPFSKIPEGEEADYRACMLGFRDYVNKNGFKSVVLGLSGGIDSAICAALAVDALGEERVRCIMLPYRYTSEESLKDAADCARALGCRYDIVPIVEPVEGFLSALSDLFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDLYKMQVYAISSWRNAHVPPGALGPSGEVIPANIISKAPSAELRPNQTDQDSLPPYPVLDDILECLVEKEMSVEEILARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRFRDR
>NZ_CP042274.1|WP_099085378.1|1286333_1286711_+|bleomycin-resistance-family-protein
MNTIADHGIRFGRIAAMLPVKNIEKAHDFYVGVLGFEKTFENGNPVGFMILKQGNAELHLTLQPTHKAAPFNVAHMMVSDVDTLHALCKSQGLRIIKGLQDKDYGLRAFVFEDPDGNRIDVGQVI
>NZ_CP042274.1|WP_099085379.1|1285313_1286141_-|TolB-family-protein
MRSSIEIFNIRTRQMRVVWQTPDLFEAPNWSPDGKYLLLNSEGLLYRLSLSGDIAPEKVDTGFATLCNNDHGISPDGSLYAISDKVEFGKSAIYLMASVGGAPRLMTKNLPSYWHGWSPDGKSFAYCGIRDQVFDIYSMDIESGVETRLTHGEGRNDGPDYSPDGAWIYFNSSRTGLMQIWRVRVDGSAVERITDSPYGDWFPHPSPKGDKVVFVSYDGDVFDHPRDLDVRVRLMDMDGGNAETLFELFGGQGTMNSPNWSPEGDEFAYVRYFPA
>NZ_CP042274.1|WP_099085380.1|1284274_1284991_-|5,6-dimethylbenzimidazole-synthase
MPADPSVSNPPGASSFDHALSPARPFSGEEREVIYRAIETRRDVRDQFLSDPLPDDLVERLLKAAHSAPSVGFMQPWNFTLITDGAIRQAAFVAFSRANEEAAAMFEGEQQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPRTDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDIRTILGIPDHIEIVAWLCVGRVDALYTEPELAVKGWRQRVPLEELVFRNRWGGV
>NZ_CP042274.1|WP_163117922.1|1282986_1284093_+|DUF2865-domain-containing-protein
MTRRSRIIGLLLPLVFIAPATAFADQVCDTLYAQLREPPRVIGNTAEVRRYANALARQNIVIRKIRNDLRGYGCSSGSVIVYGNPNAGVCAEIGDALAEAESERDAIIRDRDDAMAAARDNDGDIRRQRILAALDANGCSTAPQTEAQLPPPSDVTRYPDAFRQNGGEPGQAGLSPYPNAAAEGGLRTLCVRTCDGSFFPIAANASPLDFRAQAEQCQKMCPGTETELYFHSMTDQETADMVSAETGKPYRDLPTAFAYRNAPAKAPGCACNMAAYHEEMQKQEEAARPESETPYSGITKIPSPQGDKAAPKPAEQQQAAKPPEQPVPERDYDPNDTKVRVIGPKFLPDQTGRIDLKNPALKGIQPQQ
>NZ_CP042274.1|WP_003502992.1|1297885_1298032_+|DUF1127-domain-containing-protein
MNITRSLTNWRKYRQTVTELGRMTDRELNDLGIGRQDIRRVARTAVGI
>NZ_CP042274.1|WP_003495735.1|1298491_1298635_+|DUF1127-domain-containing-protein
MNPIRIAKNWISYRRTINELGSLSNQALSDIGLTRYDIRNVAARSFR
>NZ_CP042274.1|WP_162686123.1|1299219_1300662_+|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO
MDTEMQDKTTSPIHVVGGGLAGSEAAWQIAQSGVPVILHEMRGVRGTDAHKGDTLAELVCSNSFRSDDATANAVGVIHAEMRLAGSLIMACADRHQVPAGGALAVDRDGFSEAVTKELESHPLVTIVREEVNGLPPREWGNSIIATGPLTSPDLAAAIQAETGEDALAFFDAIAPIVHRDSINMDICWYQSRYDKVGPGGTGKDYINCPLNEEQYNAFIDALIAGDTVGFKEWEGTPYFDGCLPIEIMAERGRETLRHGPMKPMGLTNAHNPTVKAYAVVQLRQDNALGTLYNMVGFQTKLKYGVQADVFRMIPGLENAEFARLGGLHRNTYIDSPILLDRSLKLKSRPDLRFAGQITGCEGYVESASVGLLAGRFAAAEQKGETPSLPPATTALGSLLNHITGGHLSSDDEPGKRSFQPMNINFGLFPELAPGSIVKPEGVKRFRGKDKTIMKRQLIAARALRDCAEWLDLSKASVATS
>NZ_CP042274.1|WP_060726292.1|1300709_1301291_-|pilus-assembly-protein-TadG
MSIMRPISRLYSMGLCRSGAAAVEMALLAPLLILVLAVVLEIGRGWLSYDRFVTAVDNTARWSARFPEFETRVRTGVKTFVLMSGNGLLQTEKLNLTLRSAKLVGNVPELQFQPYNFFGSAEGVKWDKAIKDGNFGPNEAIIVVSGRYSYRPLFAFLADTTIDFEYVTAINPFFSRHYPYQSGKSDFNKWNVM
>NZ_CP042274.1|WP_099085374.1|1301287_1301863_-|pilus-assembly-protein-TadE
MSVPEIAPAAHDGKQSHDGSRHRLFRRLYLRILADRQAAAAVEVGLLLPVFLILIFGILEIGLLLLYHLYLSTASSAGVEYLRRAAMHRQQVTERALRQAISSGFITATSADNLKISLTPILDDDIAAAPVAFPIENSFQSPTAAAGQYILAVGYRWNFVMPTTHLLVPSSGTVRQLQNVSLAITAVRVTE
>NZ_CP042274.1|WP_099085373.1|1301849_1303103_-|pilus-assembly-protein
MFEWTRKKAVREGLFSLFIGDRTAAFAIMTALLLPVFIILMGLLFEGGRGLSYFLQSKRVMALACERSTKPTRTDVGADSTRRENVLTTFDAMIQSTKQKVLERDVTINWLRTDIKAEFSYRLLFADMFDVDEMRYRLAYSCEGIPPYPYDGEVLVDNNFENNTLGRERILKNGITTQTPSGCWGVYPYTELKWHGGTGPGIELQDWSSPCCRKIHAWEGYPEGFEKEAEKGDETANDKACKLKGNEKAVQSSDRPLFEEGANSSLASLPTRYVIELDSDWGTSIQGKKRTDANSSIYKDVELHPGKYEISVWYNGRKSSFNNVKSAELTNGIDISLQPLLPQSGVVKTIFQMKQGPGMKNAIDQVIRWRQYREQITVDTYSIYRLTIAASGLSDSFGGIITGFELRYIGRYGDERS
>NZ_CP042274.1|WP_003503003.1|1303533_1304661_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MDVRAAVAIQAGKPLEVMTVQLEGPRAGEVLVEVKATGICHTDDFTLSGADPEGLFPAILGHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRATQGQGVMPDGTSRFSIGKDKIHHYMGCSTFSNYTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVINTAKVEIGSTAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNPKEVGEDIVPYLVNMTKRNGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQEISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMEGKIQIDPMITHTMPLEDINKGFDLMHKGESIRGVVVY
>NZ_CP042274.1|WP_163117924.1|1304947_1305688_+|DUF922-domain-containing-Zn-dependent-protease
MSLISEHHERRELGPIGQLLIKGDDAAGVLLTIKSRLPDTGTIIVNLSSWYVEPSCRWFAPRMLQMASSNEDEIFTDLTPSPEACRLNERLGFATVTDCTLFYPLPFAALRPASARLRPLVDTKPGILSGETRDMLEDHAHLGCIVAVMEAENRHHPLVFLKTTTRRLPSARLIHCDDRQVAQRHISAIARHLLGHGRVALTMAALEGERKAGGLTAHKSAPIQVKGVWNPQFINETYSELVLLPP
>NZ_CP042274.1|WP_003503006.1|1305793_1306057_+|acyl-carrier-protein
MLAAQKSEIDVADTIYSYLSNRFPAYAPFSADTLLLEGGVIDSLGFLELMIFLGEGFGIILDDEHFTPDNLGTPADLIAFVLRERRR
>NZ_CP042274.1|WP_099085371.1|1306053_1307586_+|AMP-binding-protein
MTPHFLLHHLLTARAASDDPAVVHKDRSLNYREFAAAAARCAAALQEAGAQRGDRVVIYLPRGIEECWSIFGVSMASGVFVPVNALLKAQQIRHIIRDCGAKIVISDAAMINELKAALADLPDVTILLAEEIGTRTGAPARPSAAIGEDLAAILYTSGSTGSPKGVMLSHRNLLAGARIVRTYLDITGRDRILSLLPFSFDYGLNQLLTAVEQGAATVISTFRLGDEIVRDLRDHAITGLAGVPTIWAILTKAAPSLTKTPLPHLRYITNSGGRVPQETVKALREKLPDTKIYLMYGLTEAFRSTFLPPDEIDRRPTSIGKAIPECEIFIVTAEGQRAKPGEPGILVHRGPTVSLGYWNRPEDTAKVLRPHPFIPAALGGETVCYSGDLAVEDEDGFFSFVARNDAMIKSSGYRISPTEVEESLMSTGLFQQVAVIGLPDPFAGEKVHAVATAANQNIDVSAALKKAAEMLAPFMIPRAIELVERLPITANGKVDYRALVRERTDNGANG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_CP049038	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence	69676-69703	5	0.821
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1403541-1403568	6	0.786
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	KX752698	Mycobacterium phage Tonenili, complete genome	24858-24885	6	0.786
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	556291-556318	6	0.786
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	MF476925	Klebsiella phage YMC16/01/N133_KPN_BP, complete genome	47844-47871	6	0.786
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NC_029005	Streptomyces phage phiSAJS1, complete genome	41886-41913	6	0.786
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1452117-1452144	7	0.75
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	128955-128982	7	0.75
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	300096-300123	7	0.75
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	MK577502	Aeromonas phage Asfd_1, partial genome	141548-141575	7	0.75
NZ_CP042274_1	1.1\|1295468\|28\|NZ_CP042274\|CRISPRCasFinder	1295468-1295495	28	MN871507	UNVERIFIED: Aeromonas phage asfd_1h, complete genome	90501-90528	7	0.75

1. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_CP049038 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence) position: , mismatch: 5, identity: 0.821

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
ctgcgcggcttcttcaccttcagcgacc	Protospacer
* * ***********.*********.*

2. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
gtgggcggcttcatcgccttcatcggca	Protospacer
  *.******** ********* ****.

3. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 6, identity: 0.786

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
ggcatcggcgtcttcgccttcagcggaa	Protospacer
 * * **** **************** .

4. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.786

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
ccatccggcttcttctccgtcagcggcg	Protospacer
* .  ********** ** *********

5. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to MF476925 (Klebsiella phage YMC16/01/N133_KPN_BP, complete genome) position: , mismatch: 6, identity: 0.786

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
acgacgggcttcttcgccgtcagcggct	Protospacer
  **  ************ ********

6. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NC_029005 (Streptomyces phage phiSAJS1, complete genome) position: , mismatch: 6, identity: 0.786

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
gtgtgcggcttcttcccctccagcggca	Protospacer
  * *********** ***.*******.

7. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.75

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
acgagcggcttcttcgccatcatcgcgc	Protospacer
  **************** *** **

8. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 7, identity: 0.75

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
atcggcgacttcttcgccttcggcggca	Protospacer
   .***.*************.*****.

9. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
aaccacggcatcgtcgccttcagcggcg	Protospacer
 .  .**** ** ***************

10. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to MK577502 (Aeromonas phage Asfd_1, partial genome) position: , mismatch: 7, identity: 0.75

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
gcgagcagcttctacgccttcagcgagt	Protospacer
  ****.****** ***********.

11. spacer 1.1|1295468|28|NZ_CP042274|CRISPRCasFinder matches to MN871507 (UNVERIFIED: Aeromonas phage asfd_1h, complete genome) position: , mismatch: 7, identity: 0.75

cggagcggcttcttcgccttcagcggcg	CRISPR spacer
gcgagcagcttctacgccttcagcgagt	Protospacer
  ****.****** ***********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

609359 : 616737

Geobacillus_phage(33.33%)

protease,tail,head,capsid,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099085547.1\|609359_610526_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.5e-61	37.5
WP_003509186.1\|610720_611041_+	hypothetical protein	NA	NA	NA	NA
WP_099085546.1\|611069_611678_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.4e-26	41.1
WP_099085545.1\|611708_612977_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	6.1e-77	42.9
WP_099085544.1\|613166_613736_+	hypothetical protein	NA	NA	NA	NA
WP_099085543.1\|613739_614075_+\|head	phage head closure protein	NA	NA	NA	NA
WP_087743622.1\|614071_614467_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_003509834.1\|614474_615674_-	MFS transporter	NA	NA	NA	NA
WP_099086136.1\|615764_616172_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_020809572.1\|616171_616531_+	gene transfer agent family protein	NA	NA	NA	NA
WP_099085542.1\|616527_616737_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA

DBSCAN-SWA_2

1306053 : 1314706

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099085371.1\|1306053_1307586_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	3.3e-21	23.5
WP_099085370.1\|1309339_1310497_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.1e-43	44.3
WP_099085369.1\|1310533_1311664_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	6.1e-105	53.3
WP_099085368.1\|1311663_1312746_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003503025.1\|1313066_1313576_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.4e-45	58.8
WP_059760168.1\|1313612_1314182_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-47	58.5
WP_003503029.1\|1314211_1314706_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.5e-27	39.0

DBSCAN-SWA_3

1331172 : 1339574

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065695407.1\|1331172_1332735_-	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	I3PV24	Clostridium_phage	1.1e-11	30.4
WP_020012735.1\|1333081_1333723_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.0e-11	35.1
WP_003509717.1\|1333731_1334502_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-23	29.8
WP_003509719.1\|1334701_1335985_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.3e-98	46.0
WP_003509720.1\|1336087_1336891_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	6.8e-42	41.2
WP_099085364.1\|1336887_1337610_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003509722.1\|1337666_1337873_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.1e-08	69.8
WP_099085363.1\|1338001_1338736_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.3e-39	47.6
WP_003509724.1\|1338725_1339574_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.2e-33	35.4

DBSCAN-SWA_4

1362309 : 1392544

Rhizobium_phage(70.37%)

terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099085351.1\|1362309_1362636_-	cell wall anchor protein	R9TN87	Rhizobium_phage	1.6e-42	90.7
WP_099085350.1\|1362657_1363182_-	N-acetylmuramoyl-L-alanine amidase	A0A068CC96	Rhizobium_phage	3.5e-79	77.0
WP_144030926.1\|1363253_1364177_-	hypothetical protein	NA	NA	NA	NA
WP_099085348.1\|1364237_1364816_-	hypothetical protein	NA	NA	NA	NA
WP_099085347.1\|1364823_1365789_-	hypothetical protein	R9U0V1	Rhizobium_phage	1.7e-15	42.2
WP_099085346.1\|1365801_1366509_-	DUF2612 domain-containing protein	L7TKX3	Rhizobium_phage	1.7e-57	42.1
WP_144030925.1\|1366510_1367359_-	hypothetical protein	L7TN06	Rhizobium_phage	5.7e-63	44.8
WP_099085344.1\|1367406_1367772_-	hypothetical protein	L7TJM2	Rhizobium_phage	1.4e-31	60.0
WP_099085343.1\|1367768_1368422_-	hypothetical protein	L7TMF3	Rhizobium_phage	2.9e-38	44.8
WP_099085342.1\|1368421_1369303_-	hypothetical protein	L7TRC2	Rhizobium_phage	1.9e-101	60.4
WP_099085341.1\|1369283_1369607_-	hypothetical protein	L7TKW4	Rhizobium_phage	3.0e-33	61.3
WP_099085340.1\|1369611_1370175_-	hypothetical protein	L7TN02	Rhizobium_phage	5.7e-43	53.1
WP_099085339.1\|1370174_1371812_-\|tail	phage tail tape measure protein	A0A068C997	Rhizobium_phage	2.9e-103	57.9
WP_099085338.1\|1371978_1372437_-	hypothetical protein	NA	NA	NA	NA
WP_144030924.1\|1372530_1372785_+	hypothetical protein	NA	NA	NA	NA
WP_099085336.1\|1372781_1373261_+	thermonuclease family protein	NA	NA	NA	NA
WP_099085335.1\|1373273_1373708_-	DUF3277 family protein	L7TRB4	Rhizobium_phage	9.4e-38	56.2
WP_099085334.1\|1373719_1374859_-	DUF3383 family protein	L7TKV9	Rhizobium_phage	7.3e-114	56.9
WP_099085333.1\|1374885_1375368_-	hypothetical protein	L7TMZ9	Rhizobium_phage	1.7e-35	50.0
WP_099085332.1\|1375364_1375697_-	hypothetical protein	NA	NA	NA	NA
WP_099085331.1\|1375693_1376158_-	hypothetical protein	L7TME2	Rhizobium_phage	2.2e-45	61.7
WP_147883359.1\|1376157_1376547_-	DUF4054 domain-containing protein	L7TRB1	Rhizobium_phage	2.5e-26	51.2
WP_099085329.1\|1376546_1376738_-	hypothetical protein	NA	NA	NA	NA
WP_099085328.1\|1376765_1377026_-	hypothetical protein	NA	NA	NA	NA
WP_099085327.1\|1377078_1377360_-	hypothetical protein	NA	NA	NA	NA
WP_099085326.1\|1377372_1378323_-	DUF2184 domain-containing protein	L7TMZ5	Rhizobium_phage	2.9e-71	48.1
WP_099085325.1\|1378337_1378775_-	DUF2190 family protein	L7TJK9	Rhizobium_phage	5.1e-15	38.1
WP_099085324.1\|1378774_1379920_-	DUF2213 domain-containing protein	A0A2R3UA67	Siphoviridae_environmental_samples	1.8e-75	48.3
WP_099085323.1\|1380065_1380338_+	hypothetical protein	NA	NA	NA	NA
WP_163117927.1\|1380334_1381030_-	hypothetical protein	L7TMD0	Rhizobium_phage	2.2e-60	52.8
WP_099085321.1\|1381155_1382970_-	DUF1073 domain-containing protein	A0A059VA58	Pseudomonas_phage	1.1e-167	53.1
WP_163117928.1\|1382957_1383110_-	hypothetical protein	NA	NA	NA	NA
WP_099085320.1\|1383113_1384598_-\|terminase	phage terminase large subunit	A0A1P8VVI4	Erythrobacter_phage	2.0e-95	42.7
WP_099085319.1\|1384554_1384929_-	hypothetical protein	NA	NA	NA	NA
WP_144030923.1\|1385453_1385861_+	hypothetical protein	NA	NA	NA	NA
WP_144030922.1\|1386332_1386581_-	hypothetical protein	NA	NA	NA	NA
WP_086132843.1\|1386611_1386956_-	DUF3307 domain-containing protein	F8SJ72	Pseudomonas_phage	1.2e-16	41.0
WP_099085315.1\|1387481_1388252_-	hypothetical protein	A0A141GF38	Brucella_phage	1.3e-42	40.2
WP_099085314.1\|1388248_1388683_-	hypothetical protein	A0A141GF37	Brucella_phage	1.9e-54	68.5
WP_099085313.1\|1388679_1389261_-	hypothetical protein	NA	NA	NA	NA
WP_099085312.1\|1389257_1389515_-	hypothetical protein	NA	NA	NA	NA
WP_099085311.1\|1389511_1389817_-	hypothetical protein	NA	NA	NA	NA
WP_099085310.1\|1389813_1390155_-	hypothetical protein	NA	NA	NA	NA
WP_099085309.1\|1390151_1391096_-	hypothetical protein	Q854E1	Mycobacterium_phage	1.9e-19	37.1
WP_099085308.1\|1391095_1392544_-	hypothetical protein	A0A141GF34	Brucella_phage	2.4e-85	38.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP042275

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

575283 : 622719

Ochrobactrum_phage(55.26%)

plate,tail,transposase,capsid,integrase

attL 576939:576956|attR 593010:593027

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099087367.1\|575283_576330_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099087223.1\|576682_577114_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
576939:576956	attL	NA	NA	NA	NA
WP_099087368.1\|577200_578013_+	oxidoreductase	NA	NA	NA	NA
WP_087745780.1\|578498_579647_+	enolase	NA	NA	NA	NA
WP_087745782.1\|579653_580283_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_020813147.1\|580364_581963_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_112361350.1\|582390_583110_-	helix-turn-helix transcriptional regulator	A5X9F5	Aeromonas_virus	6.4e-31	35.6
WP_099087224.1\|583358_583664_+	hypothetical protein	NA	NA	NA	NA
WP_163117984.1\|583711_584563_+	ParB N-terminal domain-containing protein	A0A219VHB6	Ochrobactrum_phage	4.2e-05	28.0
WP_083532092.1\|584616_585024_+	hypothetical protein	G8GWB9	Rhodobacter_phage	5.9e-42	65.2
WP_163117985.1\|585020_585194_+	hypothetical protein	NA	NA	NA	NA
WP_099087370.1\|585226_587440_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	8.9e-108	36.5
WP_072493261.1\|587502_588261_+	ATP-binding protein	A0A0M4UT94	Ralstonia_phage	2.2e-10	34.1
WP_099087226.1\|588260_588896_+	hypothetical protein	NA	NA	NA	NA
WP_099087227.1\|588892_589291_+	transcriptional regulator	A0A1B0T6G8	Thiobacimonas_phage	1.1e-21	44.3
WP_144030983.1\|589277_589568_+	hypothetical protein	NA	NA	NA	NA
WP_099087229.1\|589629_590283_+	DUF3164 family protein	M4STB6	Rhodobacter_phage	1.2e-73	64.9
WP_099087230.1\|590290_591058_-	hypothetical protein	NA	NA	NA	NA
WP_099087231.1\|591186_591765_+	DNA methyltransferase	F8TVB4	EBPR_siphovirus	1.4e-44	48.0
WP_099087232.1\|591761_592412_+	regulatory protein GemA	M4STB3	Rhodobacter_phage	5.4e-29	41.3
WP_099087371.1\|592411_592861_+	hypothetical protein	NA	NA	NA	NA
WP_052817262.1\|592857_593073_+	hypothetical protein	NA	NA	NA	NA
593010:593027	attR	NA	NA	NA	NA
WP_099087233.1\|593062_593455_+	helix-turn-helix domain-containing protein	A0A219VHE2	Ochrobactrum_phage	1.8e-32	61.5
WP_099087234.1\|593554_594523_+	lysozyme	G8GWD3	Rhodobacter_phage	5.9e-40	37.9
WP_099087235.1\|594524_595058_+	hypothetical protein	M4SRV1	Rhodobacter_phage	2.7e-18	37.3
WP_003500859.1\|595054_595279_+	molecular chaperone DnaK	A0A219VHE0	Ochrobactrum_phage	2.7e-12	56.7
WP_099087372.1\|595314_595647_+	DUF2730 family protein	NA	NA	NA	NA
WP_099087236.1\|595643_595943_+	hypothetical protein	NA	NA	NA	NA
WP_099087237.1\|595945_596575_+	DUF3486 family protein	A0A219VH75	Ochrobactrum_phage	2.5e-47	51.4
WP_099087238.1\|596740_598411_+	hypothetical protein	A0A219VH72	Ochrobactrum_phage	5.7e-192	63.7
WP_099087239.1\|598410_600030_+	DUF935 domain-containing protein	A0A219VH73	Ochrobactrum_phage	1.1e-208	66.6
WP_099087240.1\|600016_601234_+	hypothetical protein	A0A219VH74	Ochrobactrum_phage	1.3e-137	58.9
WP_099087241.1\|601569_602667_+	hypothetical protein	A0A219VH76	Ochrobactrum_phage	4.0e-101	56.4
WP_099087242.1\|602663_603044_+	hypothetical protein	A0A219VH82	Ochrobactrum_phage	2.6e-31	62.8
WP_099087243.1\|603061_604039_+\|capsid	capsid protein	A0A219VH83	Ochrobactrum_phage	5.8e-112	61.8
WP_099087244.1\|604637_605057_+	DUF1320 domain-containing protein	A0A219VH93	Ochrobactrum_phage	5.9e-37	56.8
WP_099087245.1\|605053_605542_+	virion morphogenesis protein	A0A219VH84	Ochrobactrum_phage	5.1e-40	55.8
WP_099087246.1\|606052_606604_+\|plate	phage baseplate protein	A0A219VHA3	Ochrobactrum_phage	2.1e-50	61.1
WP_099087247.1\|606615_606834_+	hypothetical protein	A0A219VHA0	Ochrobactrum_phage	8.4e-11	60.0
WP_099087248.1\|606837_607215_+\|plate	baseplate assembly protein	A0A219VH96	Ochrobactrum_phage	5.7e-39	64.3
WP_099087249.1\|607211_608150_+\|plate	baseplate assembly protein	A0A0A8IKZ9	Aurantimonas_phage	6.7e-89	56.5
WP_099087250.1\|608146_608809_+\|tail	phage tail protein I	A0A0A8IL57	Aurantimonas_phage	3.4e-71	61.3
WP_099087251.1\|608824_611089_+	hypothetical protein	A0A0A8ILB4	Aurantimonas_phage	4.3e-291	65.8
WP_144030984.1\|611241_612408_+	hypothetical protein	A0A0A8IK81	Aurantimonas_phage	5.1e-30	57.6
WP_099087253.1\|612411_612909_+	hypothetical protein	A0A2L0UYY5	Agrobacterium_phage	3.7e-14	50.6
WP_144030985.1\|612934_613753_+	hypothetical protein	NA	NA	NA	NA
WP_099087255.1\|613922_615197_+\|tail	phage tail protein	A0A219VHA7	Ochrobactrum_phage	3.8e-172	72.3
WP_052817197.1\|615206_615725_+\|tail	phage tail protein	A0A219VHB2	Ochrobactrum_phage	2.7e-76	77.2
WP_099087256.1\|615734_616145_+	hypothetical protein	NA	NA	NA	NA
WP_099087257.1\|616259_618581_+\|tail	phage tail tape measure protein	A0A219VHB3	Ochrobactrum_phage	3.1e-34	29.3
WP_099087258.1\|618577_619009_+\|tail	phage tail protein	A0A219VHA8	Ochrobactrum_phage	7.6e-48	63.4
WP_099087259.1\|619005_619269_+\|tail	phage tail protein	A0A219VHB0	Ochrobactrum_phage	3.0e-15	46.5
WP_099087260.1\|619268_620243_+	late control protein	A0A219VHA9	Ochrobactrum_phage	7.9e-101	56.7
WP_099087261.1\|620528_621329_+	DNA adenine methylase	R9U1F2	Rhizobium_phage	6.7e-122	82.9
WP_144030986.1\|621421_621718_+	hypothetical protein	NA	NA	NA	NA
WP_003506952.1\|621960_622719_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-26	33.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP042275

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection