CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024086	Pseudomonas putida strain E46 chromosome, complete genome	4 crisprs	DEDDh,DinG,WYL,csa3,cas3	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024086_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024086_1

1538248-1538367

Orphan

Consensus_repeat	Method
GCCGTTCTCAAGGCCAGTGCTGCACCTGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024086_1

>merge|NZ_CP024086|1|1538248-1538367|CRISPRCasFinder
GCCGTTCTCAAGGCCAGTGCTGCACCTGTGTGGCTTGCCGGCGATGTGGCCGGAACAAGCAACACAAGCAGTTGTTCCCACAGGTACAGTGCCGTTCTCAAGGCCAGTGCTGCACCTGTG

>NZ_CP024086|1|1|1538248-1538367|CRISPRCasFinder
GCCGTTCTCAAGGCCAGTGCTGCACCTGTG	TGGCTTGCCGGCGATGTGGCCGGAACAAGCAACACAAGCAGTTGTTCCCACAGGTACAGT
GCCGTTCTCAAGGCCAGTGCTGCACCTGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024086.1\|WP_099428577.1\|1531970_1533161_-\|benzoate/H(+)-symporter-BenE-family-transporter	unknown	unknown	gnl\|CDD\|281578
NZ_CP024086.1\|WP_099428580.1\|1538402_1539191_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_099428584.1\|1542975_1543512_+\|oxidase	unknown	unknown	gnl\|CDD\|224704
NZ_CP024086.1\|WP_099428582.1\|1540590_1541682_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|235438
NZ_CP024086.1\|WP_099428579.1\|1534340_1534706_-\|glutaredoxin	unknown	unknown	gnl\|CDD\|366113
NZ_CP024086.1\|WP_027596019.1\|1545443_1546382_-\|ZIP-family-metal-transporter	unknown	unknown	gnl\|CDD\|223505
NZ_CP024086.1\|WP_085273722.1\|1536514_1537105_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP024086.1\|WP_027596016.1\|1543639_1543912_-\|DUF3509-domain-containing-protein	unknown	unknown	gnl\|CDD\|338217
NZ_CP024086.1\|WP_099428576.1\|1529752_1531693_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP024086.1\|WP_099428578.1\|1533306_1533909_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_CP024086.1\|WP_027596020.1\|1546508_1546700_+\|PLDc-N-terminal-domain-containing-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_027596006.1\|1534765_1535311_-\|GTP-cyclohydrolase-I-FolE	unknown	unknown	gnl\|CDD\|237149
NZ_CP024086.1\|WP_099428583.1\|1541821_1542976_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|372338
NZ_CP024086.1\|WP_027596007.1\|1535380_1535941_-\|Smr/MutS-family-protein	unknown	unknown	gnl\|CDD\|225396
NZ_CP024086.1\|WP_027596018.1\|1544765_1545296_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_099428581.1\|1539383_1540346_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378924
NZ_CP024086.1\|WP_027596017.1\|1544177_1544705_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP024086.1\|WP_099428575.1\|1528237_1529635_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP024086.1\|WP_027596008.1\|1536104_1536425_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_085273721.1\|1537285_1538194_+\|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236988

Protein	Function_ID	Function_description	E-value
NZ_CP024086.1\|WP_099428577.1\|1531970_1533161_-\|benzoate/H(+)-symporter-BenE-family-transporter	gnl\|CDD\|281578	pfam03594, BenE, Benzoate membrane transport protein.	2.18894e-152
NZ_CP024086.1\|WP_027596017.1\|1544177_1544705_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	1.03222e-24
NZ_CP024086.1\|WP_099428584.1\|1542975_1543512_+\|oxidase	gnl\|CDD\|224704	COG1791, COG1791, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown].	2.91329e-29
NZ_CP024086.1\|WP_099428582.1\|1540590_1541682_+\|chorismate-synthase	gnl\|CDD\|235438	PRK05382, PRK05382, chorismate synthase; Validated.	0
NZ_CP024086.1\|WP_099428579.1\|1534340_1534706_-\|glutaredoxin	gnl\|CDD\|366113	pfam00462, Glutaredoxin, Glutaredoxin.	7.10638e-15
NZ_CP024086.1\|WP_027596019.1\|1545443_1546382_-\|ZIP-family-metal-transporter	gnl\|CDD\|223505	COG0428, COG0428, Predicted divalent heavy-metal cations transporter [Inorganic ion transport and metabolism].	3.57074e-50
NZ_CP024086.1\|WP_085273722.1\|1536514_1537105_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.0677e-67
NZ_CP024086.1\|WP_027596016.1\|1543639_1543912_-\|DUF3509-domain-containing-protein	gnl\|CDD\|338217	pfam12021, DUF3509, Protein of unknown function (DUF3509). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 92 to 110 amino acids in length. This protein has two completely conserved residues (G and R) that may be functionally important.	5.34388e-28
NZ_CP024086.1\|WP_099428576.1\|1529752_1531693_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	3.52048e-62
NZ_CP024086.1\|WP_099428578.1\|1533306_1533909_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	1.18066e-48
NZ_CP024086.1\|WP_027596006.1\|1534765_1535311_-\|GTP-cyclohydrolase-I-FolE	gnl\|CDD\|237149	PRK12606, PRK12606, GTP cyclohydrolase I; Reviewed.	2.09281e-110
NZ_CP024086.1\|WP_099428583.1\|1541821_1542976_+\|MFS-transporter	gnl\|CDD\|372338	pfam12832, MFS_1_like, MFS_1 like family. This family contains proteins related to the MFS superfamily.	2.92812e-107
NZ_CP024086.1\|WP_027596007.1\|1535380_1535941_-\|Smr/MutS-family-protein	gnl\|CDD\|225396	COG2840, COG2840, Uncharacterized protein conserved in bacteria [Function unknown].	1.09942e-59
NZ_CP024086.1\|WP_085273721.1\|1537285_1538194_+\|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase	gnl\|CDD\|236988	PRK11805, PRK11805, 50S ribosomal protein L3 N(5)-glutamine methyltransferase.	0
NZ_CP024086.1\|WP_099428575.1\|1528237_1529635_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.71963e-120
NZ_CP024086.1\|WP_099428581.1\|1539383_1540346_-\|alpha/beta-hydrolase	gnl\|CDD\|378924	pfam12697, Abhydrolase_6, Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.	3.27895e-09

>NZ_CP024086.1|WP_085273721.1|1537285_1538194_+|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase
MITSRLRTLRDYIRWAVSRFHERELFFGHGADNAWDEARLLVLGAVHLPWEVADSYLDCMLEDDERVRLQHLLKRRIEERVPTAYLLGEAWFCGMSFIVDERVLVPRSPIGELIEKRFEPWLAAEPARILDLCTGSGCIGIVAAEVFPEAEVVLGDLSFDALEVANQNIERHGLDMRVYTVQGDGFDGLPGQRFDLILSNPPYVDAEDFGDMPAEYHHEPELGLACGNDGLDLVRRMLAEAADHLTDKGLLIVEVGNSQVHVESLYPEVDFAWLEFERGGHGVFMLTAEQCRQHQELFKARV
>NZ_CP024086.1|WP_085273722.1|1536514_1537105_-|cysteine-hydrolase
MSVPTTMFRLTGRDYPPAKLSHASLIIIDAQKEYLSGPLALSGMDEAVANIARLLDAARKSGRPIIHVRHLGTVGGRFDPQGSGGQFIPGLEPLEGETVIEKRMPNAFKNTKLHDTLQALGHLDLIVCGFMSHSSVSTTVRRAKDYGYRCTLVEDASATRDLAFKDGVIPAAQIHQCEMAVMADNFACVAPTASLI
>NZ_CP024086.1|WP_027596008.1|1536104_1536425_-|hypothetical-protein
MKLKGSFDAKRLRTREPRNWGARLAAGLSALLATLGVLLAMAGIAGLLGNYPALQELNANKPLASILTGAGLLLLWLGVRFWRRSRIRLRRGRELNLSPHLMKKHD
>NZ_CP024086.1|WP_027596007.1|1535380_1535941_-|Smr/MutS-family-protein
MQDDDFSLFHAEVRGVKPIKHDRAEVGKPKADRKQLAGLRQAATVRSDKALVIDGMSDQFVIDVGAEDELMWRRDGVQETQLRKLKLGQIAFEGSLDLHGMTVEKARETLWDFIAEATKLEVRCVRVTHGKAARLDGKRPMIKSHVNTWLRQHPQVLGFASCNPRHGGTGAVYVMLKRTMLEGRDE
>NZ_CP024086.1|WP_027596006.1|1534765_1535311_-|GTP-cyclohydrolase-I-FolE
MSLEQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNGALFTSDNSEMVLVRDIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAVEKVTGAAGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRANAATRSEFLSLIK
>NZ_CP024086.1|WP_099428579.1|1534340_1534706_-|glutaredoxin
MIVKALRVGLGQLIVFGDWISRPAKRKRDAAAQARVEQAANGLALYQFHACPFCVKTRRTLHRLNVPVALRDAKNDPEHRQALLEGGGRVKVPCLRIEEEGKVSWMYESKAIIAYLDKRFA
>NZ_CP024086.1|WP_099428578.1|1533306_1533909_+|glutathione-S-transferase-family-protein
MYKVYGDYQSGNCYKVKLMLSLLGRPYEWHPVDILKGETETPEFLAMNPNGKVPVLELEDGTYLWESNAILNFLADGSEFLPTEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLGLPDDRLEEYRKLHKGGYKALKVMERQLQMTPYLVGQQYSIADVALYAYTHVAQQGGFDLADYPAVRAWLERVASHPRHVPMVG
>NZ_CP024086.1|WP_099428577.1|1531970_1533161_-|benzoate/H(+)-symporter-BenE-family-transporter
MTDATSARLRPLADSSPSAVVAGFIAMLTGYTSSLVLMFQAGQAAGLTTAQISSWIWALSIGMAVCSIGLSLRYRTPITVAWSTPGAALLITSLGGVSYGEAIGAYITCAVLVLICGLTGSFERLVKRIPASLASALLAGILFKIGSEIFVAAQHRTVLVLGMFFSYLLVKRLSPRYCVLAALLVGTALSGALGLLDFSGFRLEVATPVWTTPSFSLGATISIGIPLFVVAMTSQNMPGVAVLRADGYQVPASPLISATGFASLLLAPFGSHGVNLAAISAAICTGPHAHEDPSKRYTAAVWCGIFYGIAGVFGATLAALFAALPKELVLSIAALALFGSIMNGLTVAMGEAREREAALITFMVTASGLTLFSIGSAFWGIVAGVLTLMILNPRRV
>NZ_CP024086.1|WP_099428576.1|1529752_1531693_+|methyl-accepting-chemotaxis-protein
MGATKHGVLANLGMARKLGLGFTLVLLLTLAVAAIGIAALHSVGQRFDGLRQLAQFNTDLLRLRQHEQTFAMSSDIKQAEALRTGLQGLAERARGLPALAAAEAELSAYGQAFEAFVEAVQAKELALDMASWSVSSVANNLDVLQAGLADDGTYTLKQSQGQQGGEFLEQAAQVAQVSRLMLQAMDEARVRLDKSRKGEEGKGQTRIAQTLEAASLVEQLKAAVSDAGYQSVLGEVAGHIGSFSDKLNEYTDLLAKEQGLKAQLQARAEQVTGRVDQAYLAQEQALQGELSRNALAIALATGLALLVGVLAAWLITRAVVGPLKRVIARAQRIAAGELSLEAEAPRRDEVGQLMQAMQQMAAGLSGIVSGLQQGIEQLAGSAQALSAVTEQTNREVGSQKEETEQVATAMQQMTATVHDVARNAEEAAQAAQSADDKVESGQVVVRQSMQRIEQLASAAETASAGIDSLSAEIHTIGDVLEVIKSVAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALARRTRQSTEQIETLVGSLRGNAQQSVAQIRGSTELVRLAVADVLQTESALGSIASAVSMIQQMNQQIAAAAEQQSSVAEEISRSVTQIRGSADQAALAMQDNARSSVELAQLGTDLKGMVGHFRL
>NZ_CP024086.1|WP_099428575.1|1528237_1529635_+|PLP-dependent-aminotransferase-family-protein
MHFPLDRTSTTPLVQQLTNHLQTWIGHQRLRPGARLPSIRALARSQAVSASCVIEAYDRLVASGWLEARHGTGFFVAERKPVGEADDGLPWGEAGDGHWRQFREGHDELLKLGCGWLPNSWRAATELAQAVRQVSRGTPQDLFDYCPPLGLASLRQQLHKRLARQGIAAGPERILTTQGASHGLDLLVRTLLRPGDTVLVENPGYYNLYNLLRQHQVRMLPVPRLAEGPDLAALERLLAEHRPQCLFINSLYHNPTGTSLTPKVAYRLLELAREHDLRIIEDDIYADFQEGPATRLATLDSEQRVIYMASFSKTLSSSLRVGYLVADPALLARLAELKMVSGIGTSRFAEQVVGQMLANGSYRKSVQRLRVRLGLHMAKLLGQLEQAGWEVFCEPYGGMFVWARVPGRDVVSLERLALEHAVLLTPGSAFDYQGATSDWLRINVAYGQDSRAQAFFKHAGRPPAH
>NZ_CP024086.1|WP_099428580.1|1538402_1539191_-|hypothetical-protein
MTIAPAALEPADEPQPQDGAALPWADLAAEHFQLLRLAPLPTDRATGARPLRFVQFGYAERHDKAHSLLRMEIQLPGQKVRKEQNHLDIRVDHAERLVRIGSDQGLQLEPLNRGIGRFMLAQAVQWLQRRWSHYRVEGMALPSKDALSEDSRLRRDQFLRGVGIEVEYEDPQHLKGRTVEATVGQLKGAWSSERLQRVEILDAANLLQQADQQLQELEGQLRERDERVAKYRREDGGLRFTITCLVAFAMFQAGLLIWIATR
>NZ_CP024086.1|WP_099428581.1|1539383_1540346_-|alpha/beta-hydrolase
MMPRLVALLFMLCAGLAQAASPTVLQRPIDLDTGQGVLHGSLLLPQQATPPPVVLIIAGSGPTDRDGNNPATGRIDNLKRLALVLANDHIASVRYDKRGVAASQPATPDERDLSVERYVADVVAWSHKLKADPRFGPLILVGHSEGALIASLAAEQAGASAVITLAGVGRPLADVLREQLAQRLPPAQLARGSDLLDRLQAGQTSLDVPAPLRQVFRPSVQPYLISLFQQNPAAAFAQLPMPALIVQGRNDVQVDVTDAERLQAAKPDAQLVLIDGMNHMLRISPKAMSEQRDSYLNPELPLARELGERIVTFIQHLPSA
>NZ_CP024086.1|WP_099428582.1|1540590_1541682_+|chorismate-synthase
MSGNTYGKLFTVTTAGESHGPALVAIVDGCPPGLEISLADLQHDLDRRKPGTSRHTTQRQEPDEVEILSGVFEGRTTGCSIGLLIRNTDQKSKDYSAIKDLFRPAHADYTYHHKYGERDYRGGGRSSARETAMRVAAGAIAKKYLATQGITVRGYMSQLGPIEIPFKTWASVEHNAFFSPDPDKVPELEAYMDQLRRDQDSVGAKITVVAEGVMPGLGEPIFDRLDAELAHALMSINAVKGVEIGAGFASVAQRGTEHRDELTPEGFLSNNAGGILGGISSGQPIVAHLALKPTSSITTPGRSIDVEGNPVDVITKGRHDPCVGIRATPIAEAMMAIALMDHLLRHRAQNADVKVSTPVLGQL
>NZ_CP024086.1|WP_099428583.1|1541821_1542976_+|MFS-transporter
MPPIPYWRLSSFYLFYFALLGSTAPFLALYFDHLGFSPARIGELVAIPMLMRCVAPNLWGWLGDRTGQRLLIVRLGALCTLASFALIFFGKGYAWLALVMALHAFFWHAVLPQFEVITLAHLHGQTARYSQVRLWGSIGFILTVVGLGRLFEWLSLDIYPVALVTIMAGIVLASLWVPNAQPLEQGERSGAGGFLQQLRAPGVIAFYACVALMQLSHGPYYTFLTLHLEHLGYSRSAIGLLWALGVVAEVLVFMAMSRIFARFSVQRVLLASFLLASLRWLLLGNLADDPAVLVLAQVMHAATFGCFHAACIAFVQASFGARQQGQGQALYAALSGTGGALGALYSGYSWKLLGPTFTFGMASAAALAAAVIIALCSQSTRTRH
>NZ_CP024086.1|WP_099428584.1|1542975_1543512_+|oxidase
MSTLSVFHPSSPGLPNKLLTHHDDIAATLAEQGVRFAHHPLALRVRPGSSEDEVMAACRGHLDQLMTSHGSAAFTLLNRDGVDPSQADVRDEHVHDAEEVLAVVSGRAQVGLRLGEFVYSVLCEKGDQLVVPAGTRRWVELGETPFCLALRLFGSEQGMQARLTGDETARAFLGIDEL
>NZ_CP024086.1|WP_027596016.1|1543639_1543912_-|DUF3509-domain-containing-protein
MDLIQEKFVSVFSAYQVATQPRPDGGVLLTLRAADGKVTRRVLTYGQLHSAEQLSWAISAIRRDLAEQASELPVISMLQSQQRFALPTYR
>NZ_CP024086.1|WP_027596017.1|1544177_1544705_+|ankyrin-repeat-domain-containing-protein
MSTVQPSPAAMTDDETAAFAEQVFERARQGDAPMLERLLASGLPANLRNHKGDTLLMLACYHGHHDAVRVLLEHGADPLMANDNGQLPIAGAAFKGDLAMIRLLLEHGVPVDAAAQDGRTALMLAAMFNRSEILDYLLAQGADPAHQDARGATALMAAQTMGAADAVARLQALAG
>NZ_CP024086.1|WP_027596018.1|1544765_1545296_+|hypothetical-protein
MKNQLLELITLIGAGCMRDEDIERIADEAAQAYADPVAFLAANPDINYDDTFPIPLGEWIVLGSLPDTVLFQADSYQDLFQNIADSFDKSVPFTLKPKQLARTEPLTALNRIQVQMGALNKEAGGYVLLNFSQLLDDELQMVMVGQHDLARVLELGAEVGIKTEPALEALKVAVHV
>NZ_CP024086.1|WP_027596019.1|1545443_1546382_-|ZIP-family-metal-transporter
MPPAHSETATPPSLLSAWRQQVLTTPWLSAGLGLSLLAVIVLLAASLWNAVNGDHADNLHLALLGGLSGFGATALGAVLAVVLRDVSARTQDVMLGFAAGMMLAASSFSLILPGLDAAREITGNGPAAAFTVVLGMGLGVLLMLGLDRFTPHEHESTGPCGPEAERINRVWLFVLAITLHNLPEGMAIGVSFANGDMNIGLPLTSAIAIQDIPEGLAVALALRATGLSNMKAALVAVGSGLMEPLGAVIGLGISTGFALAYPISMGLAAGAMIFVVSHEVIPETHRNGHQTAATLGLMGGFGVMMFLDTALG
>NZ_CP024086.1|WP_027596020.1|1546508_1546700_+|PLDc-N-terminal-domain-containing-protein
MGSTFNSLVGLIILALDIWAILNVIKSGSEVGIKVLWILLIALLPVIGLVIWAIAGPRGNVRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024086_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024086_2

2388782-2388924

Orphan

Consensus_repeat	Method
TGCGCTGACCCTGTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGTGAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024086_2

>merge|NZ_CP024086|2|2388782-2388924|CRISPRCasFinder
TGCGCTGACCCTGTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGTGAAAGCACCCGCGATGTGTGCTCTCGAAGGCGTGCTGAGCAGCTTGCGCTGACCCTGTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGTGAAAG

>NZ_CP024086|2|2|2388782-2388924|CRISPRCasFinder
TGCGCTGACCCTGTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGTGAAAG	CACCCGCGATGTGTGCTCTCGAAGGCGTGCTGAGCAGCT
TGCGCTGACCCTGTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGTGAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024086.1\|WP_085673223.1\|2384348_2384711_+\|IacB-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_027595331.1\|2388277_2388775_+\|flavin-reductase	unknown	unknown	gnl\|CDD\|132654
NZ_CP024086.1\|WP_085274412.1\|2383161_2384331_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173848
NZ_CP024086.1\|WP_099429004.1\|2391025_2391538_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NZ_CP024086.1\|WP_099429001.1\|2386502_2387255_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235500
NZ_CP024086.1\|WP_099429009.1\|2396879_2397416_-\|methylamine-utilization-protein-MauE	unknown	unknown	gnl\|CDD\|284659
NZ_CP024086.1\|WP_099429002.1\|2387306_2388266_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|99782
NZ_CP024086.1\|WP_027594214.1\|2381724_2382642_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_CP024086.1\|WP_099429008.1\|2396234_2396876_-\|methylamine-dehydrogenase-accessory-protein-MauD	unknown	unknown	gnl\|CDD\|131709
NZ_CP024086.1\|WP_027595336.1\|2393081_2393480_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|226005
NZ_CP024086.1\|WP_099429006.1\|2393598_2394513_-\|transcriptional-regulator-FeaR	unknown	unknown	gnl\|CDD\|236612
NZ_CP024086.1\|WP_099429003.1\|2389887_2391012_+\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_CP024086.1\|WP_099429007.1\|2395175_2395694_-\|cytochrome-C	unknown	unknown	gnl\|CDD\|365823
NZ_CP024086.1\|WP_099428997.1\|2379623_2380100_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238357
NZ_CP024086.1\|WP_099429000.1\|2386015_2386492_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238357
NZ_CP024086.1\|WP_027595339.1\|2395698_2396220_-\|methylamine-dehydrogenase	unknown	unknown	gnl\|CDD\|367278
NZ_CP024086.1\|WP_027595332.1\|2389234_2389714_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP024086.1\|WP_099428998.1\|2380099_2381383_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|176888
NZ_CP024086.1\|WP_099429005.1\|2391579_2392899_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372583
NZ_CP024086.1\|WP_099428999.1\|2384726_2386001_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|176888

Protein	Function_ID	Function_description	E-value
NZ_CP024086.1\|WP_027595332.1\|2389234_2389714_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.06474e-16
NZ_CP024086.1\|WP_027595331.1\|2388277_2388775_+\|flavin-reductase	gnl\|CDD\|132654	TIGR03615, flavoprotein_oxidoreductase, pyrimidine utilization flavin reductase protein F. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.	1.95475e-70
NZ_CP024086.1\|WP_085274412.1\|2383161_2384331_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173848	cd01159, NcnH, Naphthocyclinone hydroxylase. Naphthocyclinone is an aromatic polyketide and an antibiotic, which is active against Gram-positive bacteria. Polyketides are secondary metabolites, which have important biological functions such as antitumor, immunosupressive or antibiotic activities. NcnH is a hydroxylase involved in the biosynthesis of naphthocyclinone and possibly other polyketides.	1.22224e-99
NZ_CP024086.1\|WP_099429004.1\|2391025_2391538_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	4.57063e-20
NZ_CP024086.1\|WP_099429001.1\|2386502_2387255_+\|SDR-family-oxidoreductase	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	1.10284e-73
NZ_CP024086.1\|WP_099429009.1\|2396879_2397416_-\|methylamine-utilization-protein-MauE	gnl\|CDD\|284659	pfam07291, MauE, Methylamine utilisation protein MauE. This family consists of several bacterial methylamine utilisation MauE proteins. Synthesis of enzymes involved in methylamine oxidation via methylamine dehydrogenase (MADH) is encoded by genes present in the mau cluster. MauE and MauD are specifically involved in the processing, transport, and/or maturation of the beta-subunit and that the absence of each of these proteins leads to production of a non-functional beta-subunit which becomes rapidly degraded.	4.98685e-17
NZ_CP024086.1\|WP_099429002.1\|2387306_2388266_+\|oxidoreductase	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	6.12487e-107
NZ_CP024086.1\|WP_027594214.1\|2381724_2382642_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.0304e-25
NZ_CP024086.1\|WP_099429008.1\|2396234_2396876_-\|methylamine-dehydrogenase-accessory-protein-MauD	gnl\|CDD\|131709	TIGR02661, Methylamine_utilization_protein_MauD, methylamine dehydrogenase accessory protein MauD. This protein, MauD, appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulfide bonds. MauD shares sequence similarity, including a CPxC motif, with a number of thiol:disulfide interchange proteins. In MauD mutants, the small subunit apparently does not form properly and is rapidly degraded. [Protein fate, Protein folding and stabilization, Energy metabolism, Amino acids and amines].	2.51022e-65
NZ_CP024086.1\|WP_027595336.1\|2393081_2393480_-\|c-type-cytochrome	gnl\|CDD\|226005	COG3474, COG3474, Cytochrome c2 [Energy production and conversion].	2.03814e-30
NZ_CP024086.1\|WP_099429003.1\|2389887_2391012_+\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	6.77987e-86
NZ_CP024086.1\|WP_099429007.1\|2395175_2395694_-\|cytochrome-C	gnl\|CDD\|365823	pfam00034, Cytochrom_C, Cytochrome c. The Pfam entry does not include all Prosite members. The cytochrome 556 and cytochrome c' families are not included. All these are now in a new clan together. The C-terminus of DUF989, pfam06181, has now been merged into this family.	0.000247988
NZ_CP024086.1\|WP_099428997.1\|2379623_2380100_-\|hypothetical-protein	gnl\|CDD\|238357	cd00667, ring_hydroxylating_dioxygenases_beta, Ring hydroxylating dioxygenase beta subunit. This subunit has a similar structure to NTF-2, Ketosteroid isomerase and scytalone dehydratase.The degradation of aromatic compounds by aerobic bacteria frequently begins with the dihydroxylation of the substrate by nonheme iron-containing dioxygenases. These enzymes consist of two or three soluble proteins that interact to form an electron-transport chain that transfers electrons from reduced nucleotides (NADH) via flavin and [2Fe-2S] redox centers to a terminal dioxygenase. Aromatic-ring-hydroxylating dioxygenases oxidize aromatic hydrocarbons and related compounds to cis-arene diols. These enzymes utilize a mononuclear non-heme iron center to catalyze the addition of dioxygen to their respective substrates. The active site of these enzymes however is in the alpha sub-unit. No functional role has been attributed to the beta sub-unit except for a structural role.	5.3114e-28
NZ_CP024086.1\|WP_099429000.1\|2386015_2386492_+\|hypothetical-protein	gnl\|CDD\|238357	cd00667, ring_hydroxylating_dioxygenases_beta, Ring hydroxylating dioxygenase beta subunit. This subunit has a similar structure to NTF-2, Ketosteroid isomerase and scytalone dehydratase.The degradation of aromatic compounds by aerobic bacteria frequently begins with the dihydroxylation of the substrate by nonheme iron-containing dioxygenases. These enzymes consist of two or three soluble proteins that interact to form an electron-transport chain that transfers electrons from reduced nucleotides (NADH) via flavin and [2Fe-2S] redox centers to a terminal dioxygenase. Aromatic-ring-hydroxylating dioxygenases oxidize aromatic hydrocarbons and related compounds to cis-arene diols. These enzymes utilize a mononuclear non-heme iron center to catalyze the addition of dioxygen to their respective substrates. The active site of these enzymes however is in the alpha sub-unit. No functional role has been attributed to the beta sub-unit except for a structural role.	2.65876e-28
NZ_CP024086.1\|WP_027595339.1\|2395698_2396220_-\|methylamine-dehydrogenase	gnl\|CDD\|367278	pfam02975, Me-amine-dh_L, Methylamine dehydrogenase, L chain.	1.10088e-59
NZ_CP024086.1\|WP_099429005.1\|2391579_2392899_-\|hypothetical-protein	gnl\|CDD\|372583	pfam13372, Alginate_exp, Alginate export. This domain forms an 18-stranded beta-barrel pore which is likely to act as an alginate export channel.	8.52613e-06
NZ_CP024086.1\|WP_099428998.1\|2380099_2381383_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|176888	cd08879, RHO_alpha_C_AntDO-like, C-terminal catalytic domain of the oxygenase alpha subunit of Pseudomonas resinovorans strain CA10 anthranilate 1,2-dioxygenase and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of anthranilate 1,2-dioxygenase (AntDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents from the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and the C-terminal catalytic domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Oxygenases belonging to this subgroup include the alpha subunits of AntDO, aniline dioxygenase, Acinetobacter calcoaceticus benzoate 1,2-dioxygenase, 2-halobenzoate 1,2-dioxygenase from Pseudomonas cepacia 2CBS, 2,4,5-trichlorophenoxyacetic acid oxygenase from Pseudomonas cepacia AC1100, 2,4-dichlorophenoxyacetic acid oxygenase from Bradyrhizobium sp. strain HW13, p-cumate 2,3-dioxygenase, 2-halobenzoate 1,2-dioxygenase form Pseudomonas cepacia 2CBS, and Pseudomonas putida IacC, which may be involved in the catabolism of the plant hormone indole 3-acetic acid. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	2.61501e-91
NZ_CP024086.1\|WP_099429006.1\|2393598_2394513_-\|transcriptional-regulator-FeaR	gnl\|CDD\|236612	PRK09685, PRK09685, DNA-binding transcriptional activator FeaR; Provisional.	5.80369e-147
NZ_CP024086.1\|WP_099428999.1\|2384726_2386001_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|176888	cd08879, RHO_alpha_C_AntDO-like, C-terminal catalytic domain of the oxygenase alpha subunit of Pseudomonas resinovorans strain CA10 anthranilate 1,2-dioxygenase and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of anthranilate 1,2-dioxygenase (AntDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents from the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and the C-terminal catalytic domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Oxygenases belonging to this subgroup include the alpha subunits of AntDO, aniline dioxygenase, Acinetobacter calcoaceticus benzoate 1,2-dioxygenase, 2-halobenzoate 1,2-dioxygenase from Pseudomonas cepacia 2CBS, 2,4,5-trichlorophenoxyacetic acid oxygenase from Pseudomonas cepacia AC1100, 2,4-dichlorophenoxyacetic acid oxygenase from Bradyrhizobium sp. strain HW13, p-cumate 2,3-dioxygenase, 2-halobenzoate 1,2-dioxygenase form Pseudomonas cepacia 2CBS, and Pseudomonas putida IacC, which may be involved in the catabolism of the plant hormone indole 3-acetic acid. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	8.30053e-91

>NZ_CP024086.1|WP_027595331.1|2388277_2388775_+|flavin-reductase
MVDVSQFRNAMALLGGAVSVITTDGPAGRFGFTASAVCSVTDAPPTLLVCMNRASYSNEQFKANGALCVNVLAGTHQELSGAFANRNLSTEERFATTHWTVLESGAPVMQEALVNFDCRIAQVHEVGSHSIFYCEIQDIRHGGADDGLVYFNRAYHRVCEASKAC
>NZ_CP024086.1|WP_099429002.1|2387306_2388266_+|oxidoreductase
MNEQLLNVVVRKREIQGADVVVLDLGRADGAALPAFEAGAHVDIHVAPGVVRQYSLCSDPADASVYRLGVLKDPASRGGSLGVHETLLEGRELQISAPRNLFPLAPQASRSILLGGGIGITPMIAMAHALHQQGADFELHYCGRSRSRSAFLEALAAAPFAARVVTHFDDEDPAQRLNLEAVLGAASQGTHLYTCGPSGFMDWVIEGARRQGYAEDHIHKEYFQVEVDASGQGFEVVAARSNKTVQVAEGQTILEALAQVGIKIDISCEQGVCGTCMCEVLEGEPDHRDVYLTDEEKAANDQILVCCSRAKSNKLVLDI
>NZ_CP024086.1|WP_099429001.1|2386502_2387255_+|SDR-family-oxidoreductase
MNQVALVTGAGQGLGQRFCAQLLAAGFDVVVSDRDLALAQASAEQLQQAQQGQGGRTLAVKLDVASKADFEQALAQVLEHFGALHVVVNNAAVTKTTPLMQISPEEFDAVVGLNLRSVFLGCQVFGAYLAEAGYGRIINMASLAGQNGGTATGAHYAASKGAIVTLTKIFAKEFAARGVTVNAIAPGPIESPAVHAAVPAERLPGLLANIPVQRLGDAGFLGDLIVQLARPEAYFTTGATWDVNGGLFMR
>NZ_CP024086.1|WP_099429000.1|2386015_2386492_+|hypothetical-protein
MNLQLLQEVAAFIWQEGDMLDHGEYDTWLGQWTEKGTYIIPIDPRESDYENTLNYAYDDHHMRGLRVQRLIGGESISTSPQPRTVRTISRFRVLGDDGVNVTVRCAQNVREFRKESLKHYSADLTYTLMRAQGSFKIHRKVISLINSDDTLAGIGYIL
>NZ_CP024086.1|WP_099428999.1|2384726_2386001_+|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MSNLIPAVNLTVDPAELVQPDRVHTSLYTDPTLFDAELQKIFHSTWIWVAHESEVPEPGSYKTTFIGKQPVIVVRDRKKAINVLLNRCRHRGATVCEHKKGKTNSFVCPYHGWGYALDGSLRGIPHPESYGDCLDKAELPLVSLRVESYAGMVFATFKDDIEPLEDFLGAAKKWMDLFMKQGAGYGIKVPGEHRFRFPGNWKIQLENTTDAYHFPLVHKSFLSSVDEQTLELFDFVKGPGYVEDLGNGHSVMVMIPELVDLEADLDKPIPERFESLAAELRDEGIDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVTETEIHHSVITMDGGPAAANRYRLRLHEHFQGPMGFGTPDDSEAWERVQKGARAGEDLWIMLNRGLPGEKPSADGLVSDVSAETGMRAAYQQWKKMMSA
>NZ_CP024086.1|WP_085673223.1|2384348_2384711_+|IacB-protein
MSDKKALRVLFCMGINQNFFDAPREEQLQVWAAFSAMWNGIHDLAGVNVLGNMDDDQGMVGPSDGFPWTTYLLADVPDIETVHAACNLFRTTAVGEGPYKLWRYAKVEARVGRELIIQRA
>NZ_CP024086.1|WP_085274412.1|2383161_2384331_+|acyl-CoA-dehydrogenase
MDSLCLRAAPVSALASGPAFEALLDGVRDRARLGEFDRQRYISRDVIDAFKAHGVYRALVPKRFGGLECSPGAFCEMIERISHADGSAGWVASFGMSPVYLAALPLETIAEIYGNSPDTVFAGGIFPPQPAEIVPGGFKVNGRWKYSSGSMGADIVGVGIAPRNGDKLDLPRLAVMPRQQARIEETWDTVGLLGTGSHDLVVEDVVVGEQWTFVRGGKPNLDEPFFRYPSLSFATQVLSVVGLGIARAALDELSGMASGRISVTGAPALADRPLAQVDVAKAEAALRSARAFFYESIERAWEHVLAGDPVPVDVTNLLRLSSTHAARVAAEVARSAQMLSGMTGIYNESPLARCVNDAQVVTQHAFMGDVTYQNAGAMFFGKQPLPGYL
>NZ_CP024086.1|WP_027594214.1|2381724_2382642_-|LysR-family-transcriptional-regulator
MPTRHIDLQDHRLRYLHLSHDKGSMRAAAEVLGVATSSVSRQIARLEEELGIELVRPGTHRISLTAAGEAAVDYYIERIRQHALLVDRLDELRSRQQASTVIAIGEGLLGARAINSLQGFLHAHNAHKAEIISAPSLEVQRMVMNDEAHLGVVFAPNASARLTRLFSLAQPLRMIVHRDSRMAERSTVSLAEVARESLVLPGANFRVRELADAACKDQPFAIVPTLTSNSLAVILDFVRSGLGATLLAELPIIDELKNGTFKALAIDCEAMNATDIQIVTRRGRTLDGMSRELATEMAKAVRMAL
>NZ_CP024086.1|WP_099428998.1|2380099_2381383_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MSNLIPAVNLTVDPAELVQPDRVHTSLYTDPTLFDAELQKIFHSTWIWVAHESEVPEPGSYKTTFIGKQPVIVVRDRKKAINVLLNRCRHRGATVCEHKKGKTNSFVCPYHGWGYALDGSLRGIPHPESYGDCLDKAELPLVSLRVESYAGMVFATFKDDIEPLEDFLGAAKKWMDLFMKQGAGYGIKVPGEHRFRFPGNWKIQLENTTDAYHFPLVHKSFLSSVDEQTLELFDFVKGPGYVEDLGNGHSVMVMIPELVDLEADLDKPIPERFESLAAELRDEGIDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVTETEIHHSVITMDGGPAAANRYRLRLHEHFQGPMGFGTPDDSEAWERVQKGARAGEDLWIMLNRGLPGEKPSADGLVSDVSAETGMRAAYQQWKKMMTAESK
>NZ_CP024086.1|WP_099428997.1|2379623_2380100_-|hypothetical-protein
MDLNLLNEVTAFIWQEGDMLDHGEYDTWLGQWTEKGTYIIPIDPRESDYENTLNYAYDDHHMRGLRVQRLIGGESISTSPQPRTVRTISRFRVLGDDGVNVTVRCAQNVREFRKESLKHYSADLTYTLVRAQGSFKIHRKVISLINSDDTLAGIGYIL
>NZ_CP024086.1|WP_027595332.1|2389234_2389714_-|MarR-family-transcriptional-regulator
MSNSKNTGHSHHDPASDEFRKEDFPFYWLARVHGRYTQNMERLLKKIDLDVPRWRVLWILNENGESSISEISTHAIAKLSTITKIVYRMKDDGLVDTAPSPEDGRVTQVRITEVGLQNIERMQDVTRELFQRSFKGLTEAQVQRLNRMLEVVFHNLETP
>NZ_CP024086.1|WP_099429003.1|2389887_2391012_+|amidase
MTIIVETLDLGGTGPRVVVKDTIDVAGTATRASSQALEDAPLAERHADVVSQLLAAGARLTGKVSLHELAFGTTGINRYTGTAANPRFPGRIPGGSSSGSAAAVAAGLADFSLGTDTGGSVRVPACCCGVFGLKPTFGRVSRKGVIPARTSLDCVGPFAASLPMLVRAMSMIDPSFVPAQVPAKARIGVLRVTAEAAIHKVVHGALSASGLPLGNVEFKHFGAAYDAGMVVINRETFEGCGHLLQTGKVGSDIAGRLAAAGQTTDTALAEAEEVRRRFTEEVDQALANFDVLALPTMPDFPLRLEDAADTRAVLGMTSLVRPFNLSGHPALSIPLGSEAGLPVGLQLVAAKGADEKLLAVAERLLLNLYAGNDH
>NZ_CP024086.1|WP_099429004.1|2391025_2391538_+|nuclear-transport-factor-2-family-protein
MTDILELQARLRSFEHQQAIRVCINRYMALCDQLDAQSPLDELAQLFCRDAVWEGKGAKYAESFGGYRGREAIRAMFATYMKTPAHFALNVHFLTSEVIEVADEEGVGRWVMLQTSTFADGASHLNAARLTVRFALEEGQWRMAHFQTENLFSRPVTAWNSDAPLPVPER
>NZ_CP024086.1|WP_099429005.1|2391579_2392899_-|hypothetical-protein
MHHRPFRLTLAALLAGASLSASAHELYSDAERHLNANVEAVFGAFHSERSYAIARDQPGSTSWREGYIKYGLSADQGLGSVGSLYGAFAMLSSATWGDGDAAGFSDGSERTSKIEDAYVGWKSGNLVPMLGEDGIDLSFGKQMVAVGDGFLLQGDSLNVGHGLADGQFNRGGAYYLAARKSFDKTAVLRLGGSSGWRGDMMWLQSDNRAQANTELHVATLEHVADAGTVGLTYIGTTHVDEQYASPLQLERDGMKTYSLRGQGNAGVENLFLSGEYAKQDKPHTATEDAWYLEAGWTFADLPWQPNLSYRYSRFSEQYDTLFYGLGRGLGTWFQGEVAGNYAGPFNSNARVQKVGLTVSPTPTLNLGVMGFHFDTIDRSLGNVDGRELDIYAEWTLNEHLMIVPLVGLYQPDRSVEQGGTQLGNNHDNLYGQVVFVSTF
>NZ_CP024086.1|WP_027595336.1|2393081_2393480_-|c-type-cytochrome
MSTVVSSKFVMPFLLAALASPLALAEDCAAPQRQQGEQVFARDCAACHSAQKDGPVMMGPNLHDVVGRTPGTVPGANYSQAMKTRQAAWTAQSIGAFIAQPQAAVPGTYMPYAGLPDAGERQSVTCFLAGLK
>NZ_CP024086.1|WP_099429006.1|2393598_2394513_-|transcriptional-regulator-FeaR
MTPATRVTDDHFQAWLSQVNDACGHFNARKLDAGFVGQLEKCQVGQISMSIVDMTHVNLFRGPREIRASGADNYYAVLQMAGTSHIEHQDARIELRPGDLTLIDASAPLDMHFHQRSRQLSLILPRTQVESGTRGVSVACAKRIEAQTPLASMARQMMLEAGRTQHMANNESQAVLEALIALLRPAITQDSVPGSHERMFRKALALIDQRITCESLTPEFIAREVGISMRSLYRIFAKHDLVIAQYIRNRRLDFCAESLRNPSMDQKVSSLGYAWGFSDSSYFSTAFKGRFGMTPGEYRKRHAN
>NZ_CP024086.1|WP_099429007.1|2395175_2395694_-|cytochrome-C
MKALTAVLILCLLAPVAQARTLPNPNQRPAPGNEVPPVPIAQAGYSVPVNYQLQCAGCHRDNGEGSAANDTPRMQGFVGNFLRVPGGREFLVRVPGISQSALNDQQIADLLNWLLARDGMAGNSSPEQWPPYSGEEVHRVRQNSMLNLPHLRAGLIEAMQAKGIAISDGLGH
>NZ_CP024086.1|WP_027595339.1|2395698_2396220_-|methylamine-dehydrogenase
MSFLDKLFERSSRHVADTTSRRKVLARLGSLIVAGAALPVLLPIDRTAKALAAEQPKMGDPGDPTSCDYWRNCSIDGFLCSCCGGSITSCPPGTDASLVTWIGTCRNPADGKNYIISYNDCCGKHACGQCACSRNDDEQPLYRPFNNNDINWCLGAESKIYNCTVTIIRGVAV
>NZ_CP024086.1|WP_099429008.1|2396234_2396876_-|methylamine-dehydrogenase-accessory-protein-MauD
MQLLIASNILLWLLLIAVAFTVMALVRQIGVLHGRIAPAGALMVDKGVTVNDPAPQVTAADRHGRPVNIGYRGERSQLLFFLAPGCPVCKSLLPAIKSIAKDNSGELDVIYVSDGDFAEQQALIDANDLQQATYVVGPEIGMTYQIGKLPYAVLIDQAGTLRAKGLVNSREHLDSLFETVHLGSASLQQYLHGNHAQGHAHDHDHAHPHSAQH
>NZ_CP024086.1|WP_099429009.1|2396879_2397416_-|methylamine-utilization-protein-MauE
MLDPVLVIASSTALATLLASAASHKLRDLRAFSAIVRAYQLLPAPLAPVATASLALAELALALALLLPGGRASAALAVVLLMALYASAIGINLWRGRRDIDCGCSGPGAAQPLRPVLLLRNLVIALLAGLAALPMAERALGALDIFVVIAASAVALLIHVAVDGLLANQPRLAKLTGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024086_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024086_3

3767420-3767530

Orphan

Consensus_repeat	Method
TTGTAGGAGCAGCCTTGCGCTGCGAAGAGGCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024086_3

>merge|NZ_CP024086|3|3767420-3767530|CRISPRCasFinder
TTGTAGGAGCAGCCTTGCGCTGCGAAGAGGCCGGCAAGGGCACCTACTTCTCTATGGCTGCAATCGCGCACGCTTTTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGCA

>NZ_CP024086|3|3|3767420-3767530|CRISPRCasFinder
TTGTAGGAGCAGCCTTGCGCTGCGAAGAGGCCGGCA	AGGGCACCTACTTCTCTATGGCTGCAATCGCGCACGCTT
TTGTAGGAGCAGCCTTGTGCTGCGAAGAGGCCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024086.1\|WP_099429778.1\|3762471_3762930_-\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP024086.1\|WP_027593712.1\|3763129_3763567_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP024086.1\|WP_027593708.1\|3759436_3759775_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024086.1\|WP_027593725.1\|3779091_3779451_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|320084
NZ_CP024086.1\|WP_099429786.1\|3775778_3777350_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277321
NZ_CP024086.1\|WP_099429777.1\|3761278_3762475_-\|cyanate-transporter	unknown	unknown	gnl\|CDD\|340968
NZ_CP024086.1\|WP_099429776.1\|3757801_3759055_+\|glycolate-oxidase-subunit-GlcF	unknown	unknown	gnl\|CDD\|236890
NZ_CP024086.1\|WP_099429785.1\|3774349_3774700_+\|response-regulator	unknown	unknown	gnl\|CDD\|381145
NZ_CP024086.1\|WP_099429782.1\|3768022_3769249_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|223715
NZ_CP024086.1\|WP_099430931.1\|3774867_3775617_-\|precorrin-6A-synthase-(deacetylating)	unknown	unknown	gnl\|CDD\|236218
NZ_CP024086.1\|WP_027593709.1\|3759852_3761286_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP024086.1\|WP_099429787.1\|3777441_3778731_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP024086.1\|WP_027593716.1\|3766820_3767408_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP024086.1\|WP_099429783.1\|3769242_3769818_-\|chemotaxis-protein-CheB	unknown	unknown	gnl\|CDD\|319752
NZ_CP024086.1\|WP_099429784.1\|3770632_3774100_-\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP024086.1\|WP_099429780.1\|3765959_3766808_+\|3-hydroxybutyryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|180269
NZ_CP024086.1\|WP_099429779.1\|3763577_3764594_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP024086.1\|WP_027593720.1\|3769814_3770636_-\|protein-glutamate-O-methyltransferase-CheR	unknown	unknown	gnl\|CDD\|224271
NZ_CP024086.1\|WP_027593714.1\|3764762_3765947_+\|acetyl-CoA-C-acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|181625
NZ_CP024086.1\|WP_099429781.1\|3767600_3767978_-\|response-regulator	unknown	unknown	gnl\|CDD\|381145

Protein	Function_ID	Function_description	E-value
NZ_CP024086.1\|WP_099429778.1\|3762471_3762930_-\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	4.93243e-37
NZ_CP024086.1\|WP_027593712.1\|3763129_3763567_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	4.59363e-28
NZ_CP024086.1\|WP_099429776.1\|3757801_3759055_+\|glycolate-oxidase-subunit-GlcF	gnl\|CDD\|236890	PRK11274, glcF, glycolate oxidase subunit GlcF.	0
NZ_CP024086.1\|WP_099429786.1\|3775778_3777350_+\|metallophosphoesterase	gnl\|CDD\|277321	cd00842, MPP_ASMase, acid sphingomyelinase and related proteins, metallophosphatase domain. Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway. ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes). ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues. Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages. ASMase belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.43381e-06
NZ_CP024086.1\|WP_099429777.1\|3761278_3762475_-\|cyanate-transporter	gnl\|CDD\|340968	cd17410, MFS_CynX_like, Cyanate transport protein CynX and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of Escherichia coli cyanate transport protein CynX and similar proteins. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The gene encoding CynX is part of the cyn operon that also includes cynS, encoding cynase, which catalyzes the reaction of cyanate with bicarbonate to give ammonia and carbon dioxide, and cynT, which encodes a carbonic anhydrase. The CynX-like subfamily belongs to the 2-nitroimidazole and cyanate transporters like (NIMT/CynX-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.89567e-140
NZ_CP024086.1\|WP_027593725.1\|3779091_3779451_+\|DNA-binding-protein	gnl\|CDD\|320084	cd16170, MvaT_DBD, DNA-binding domain of the bacterial xenogeneic silencer MvaT. MvaT is a xenogeneic silencer conserved in Pseudomonas which assists in distinguishing foreign from self DNA. It prefers binding to flexible DNA segments with multiple TpA steps, and forms nucleoprotein filaments through cooperative polymerization.	2.04829e-18
NZ_CP024086.1\|WP_099429785.1\|3774349_3774700_+\|response-regulator	gnl\|CDD\|381145	cd18161, REC_hyHK_blue-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinase/response regulators similar to Pseudomonas savastanoi blue-light-activated histidine kinase. Typically, two-component regulatory systems (TCSs) consist of a sensor (histidine kinase) that responds to specific input(s) by modifying the output of a cognate response regulator (RR). TCSs allow organisms to sense and respond to changes in environmental conditions. Hybrid sensor histidine kinase (HK)/response regulators contain all the elements of a classical TCS in a single polypeptide chain. Pseudomonas savastanoi blue-light-activated histidine kinase is a photosensitive HK and RR that is involved in increased bacterial virulence upon exposure to light. RRs share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	5.08451e-23
NZ_CP024086.1\|WP_099429782.1\|3768022_3769249_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.14794e-47
NZ_CP024086.1\|WP_099430931.1\|3774867_3775617_-\|precorrin-6A-synthase-(deacetylating)	gnl\|CDD\|236218	PRK08284, PRK08284, precorrin 6A synthase; Provisional.	6.59379e-135
NZ_CP024086.1\|WP_027593709.1\|3759852_3761286_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.16329e-130
NZ_CP024086.1\|WP_099429787.1\|3777441_3778731_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	0
NZ_CP024086.1\|WP_027593716.1\|3766820_3767408_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	4.33402e-13
NZ_CP024086.1\|WP_099429783.1\|3769242_3769818_-\|chemotaxis-protein-CheB	gnl\|CDD\|319752	cd16433, CheB, Chemotaxis response regulator protein-glutamate methylesterase, CheB. This family contains the methylesterase CheB (EC 3.1.1.61; also known as CheB methylesterase, chemotaxis-specific methylesterase, methyl-accepting chemotaxis protein methyl-esterase, or protein methyl-esterase) domain, a phosphorylation-activated response regulator involved in reversible modification of bacterial chemotaxis receptors. Signaling output of the chemotaxis receptors is modulated by CheB and methyltransferase CheR by controlling the level of receptor methylation. cheR and cheB have a strong preference to occur in the same operon, and a subgroup contains multidomain proteins with CheB-CheR fusions. Reversible methylation of transmembrane chemoreceptors plays an important role in ligand-dependent signaling and cellular adaptation in bacterial chemotaxis. Phosphorylated CheB catalyzes deamidation of specific glutamine residues in the cytoplasmic region of the chemoreceptors and demethylation of specific methyl glutamate residues introduced into the chemoreceptors by CheR.	7.97824e-85
NZ_CP024086.1\|WP_099429784.1\|3770632_3774100_-\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	4.96336e-70
NZ_CP024086.1\|WP_099429780.1\|3765959_3766808_+\|3-hydroxybutyryl-CoA-dehydrogenase	gnl\|CDD\|180269	PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	4.81649e-174
NZ_CP024086.1\|WP_099429779.1\|3763577_3764594_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	4.32256e-26
NZ_CP024086.1\|WP_027593720.1\|3769814_3770636_-\|protein-glutamate-O-methyltransferase-CheR	gnl\|CDD\|224271	COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms].	1.06505e-62
NZ_CP024086.1\|WP_027593714.1\|3764762_3765947_+\|acetyl-CoA-C-acyltransferase-family-protein	gnl\|CDD\|181625	PRK09051, PRK09051, beta-ketothiolase BktB.	0
NZ_CP024086.1\|WP_099429781.1\|3767600_3767978_-\|response-regulator	gnl\|CDD\|381145	cd18161, REC_hyHK_blue-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinase/response regulators similar to Pseudomonas savastanoi blue-light-activated histidine kinase. Typically, two-component regulatory systems (TCSs) consist of a sensor (histidine kinase) that responds to specific input(s) by modifying the output of a cognate response regulator (RR). TCSs allow organisms to sense and respond to changes in environmental conditions. Hybrid sensor histidine kinase (HK)/response regulators contain all the elements of a classical TCS in a single polypeptide chain. Pseudomonas savastanoi blue-light-activated histidine kinase is a photosensitive HK and RR that is involved in increased bacterial virulence upon exposure to light. RRs share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.82652e-25

>NZ_CP024086.1|WP_027593716.1|3766820_3767408_+|TetR/AcrR-family-transcriptional-regulator
MPPVNAAMRCANFEERRDRAMALFAEKGFGQVSMRELAAHVGLTAGSLYHHFPSKQDLLYDLIEELYEELQATLDLGRRAMARGGSALSCLIAAHWQLHAERPLQFRLAERDFCCLSEAQQARLLLLRRRYETGVLHLIAPRASLKGEALAATAHVLATLLNQLPGLLQARRLSEGEGLGLMESLLLGGIERTLR
>NZ_CP024086.1|WP_099429780.1|3765959_3766808_+|3-hydroxybutyryl-CoA-dehydrogenase
MNIEQIAVIGAGTMGNGIAQVCAVAGYHVLLVDVSDAALERGVATLRKNLERQVSKGTLDAEQAEAAKTRIRTSTDYAQLSGAQLVIEAATENLQLKQRILQQVAASVAADCLIATNTSSLSVTQLAASIEHPERFIGVHFFNPVPMMALVEIIRGLQTSDSTYAQALLVTEKVGKTPISAGNRPGFVVNRILVPMINEAIFVRQEGLASAEDIDTGMRLGCNQPIGPLALADLIGLDTLLAIMEAFHEGFSDSKYRPAPLLKEMVAAGWLGRKSGRGFFTY
>NZ_CP024086.1|WP_027593714.1|3764762_3765947_+|acetyl-CoA-C-acyltransferase-family-protein
MSSAEIYVVSAVRSAIGGFGGSLKDLPLADLATAVTRAAIERAGVDAGQIGHVVMGSVIPTEPRDAYLARVAAMNAGIPKETPAFNVNRLCGSGLQAIVSAAQCLLLGDTDVALAAGAESMSRGPYLLPQARWGARMGDLQGIDYTVGVLQDPFEHFHMGITAENVSAKHGITREMQDELALTSQRRAARAIAEGRFTSQIVPLELKTRKGSVQFSVDEHVRGDVTAEQLAGMKTVFKKDGTVTAGNASGINDGAAGLVLANGDAVRRLGLKPLARLVGYAHAGVEPELMGLGPIPATRKVLEKTGLSIQDLDVIESNEAFAAQACAVARELGFDPEKVNPNGSGISLGHPVGATGAIIATKAIHELHRIQGRYALATMCIGGGQGIAVVFERV
>NZ_CP024086.1|WP_099429779.1|3763577_3764594_-|AraC-family-transcriptional-regulator
MRDSDTVAVYFLEAMLHALRERPDVRDAHLRAVGIDPQLLEQPQARVPAKAFAQLWLALIQLLDDEFFCLDSHGMPLGSFALICRGLIQEPNLEKALRQCMGGFGLFLRDLRGSLTLRGGRAVISVQSSIADPVTRVYAEETYLVLMIGLLCWLAGRRIAIDRTELAVSRPAQDDDLLLWGPDLRLGSGRTEVEFDSAYLRLPVVQDLPALKTFLRSAPQGLVIRFRNQNGLVAEVYRHLRARRYGQWPTLAALAQVQGISASTFRRQLEREGRSYQQIKDEVRRAMAFEHLREGVLSIAEVAEQAGFQEPSAFHRAFKKWTGQSPGSYRAKLTGRSG
>NZ_CP024086.1|WP_027593712.1|3763129_3763567_+|carboxymuconolactone-decarboxylase-family-protein
MNTRIEWAKHAPEAYKAMVGLEQALAKCGLENSLLELVRLRASQINGCAYCVNMHANDARQAGETEARLQTLSVWQETAYFTARERAALAWVECLTRLPERGAPQPEYEALQAHFEPQEVVNLTLAIATINAWNRFGVGFAMVPA
>NZ_CP024086.1|WP_099429778.1|3762471_3762930_-|nucleoside-deaminase
MSEERYMREALELARTNIQAGGRPFGAVLVYQGQVVARAVNEIHSTQDPTAHAEMQAIRKAAHALGQARLDGAEVYASGHPCPMCLAAMHLCGIERAWFAYDNDEGEPYGLSTAAVYAQMARPPQQQSLPLRPLKPSGEAGLYLEWKQANTQ
>NZ_CP024086.1|WP_099429777.1|3761278_3762475_-|cyanate-transporter
MRTALNLLLVVLLALNLRPILTSVGPLLEPMRASTGLGYQQAALLTALPVLCMGLVPLLQPWLRRWISEHGGMLAGLSAIALACLWRLQLDSAWALIASAVVAGLGVAVVQGMMPGLVNRWFPTRLAGAMGMYSAALMSGGGLAAVLGPHISGYFGHWQAGLGLWAIPALVALLAWALLRPRQATPTLAGAAGGHWFGTRRAWLLAVYFGLINGGYTSMVAWLPAYHLEHGGTAQGGGDLVGLMTIFQVAGALGLPLLLRRWVDRRPGLWLALSIQLAGFLGLLLAPTLSMGVWVAMIGFGLGACFSQSLTLTLEHLKTPAEAGSLAAFVQGIGFIITGIVPYITGWLRDVSGDFQASWVLLTVTVVAMLLVTACFAPRGYAAAIARSVPNGQAASVS
>NZ_CP024086.1|WP_027593709.1|3759852_3761286_+|PLP-dependent-aminotransferase-family-protein
MELHIRLEGRKGLADQLYQQLRAGIDSGHLAAGSQLPPTRLLAEQLGVSRKTVAEAYSRLTYDNLLSGVVGRGTFITPRHPLRSNEATAIPLAAAASLERWQQRATVLGRPQLQAPSRYDFVGGASSKTQFPFDQWRSCLNYALRRSQRHPERQFSAQGLPELREAIAHHIAYARGVHCNAADVLVCNGAQQALDLIARVLIEPGCPVAMEDPGYPPARQLFLALGARLQSIPVDDQGMCVEQIADGTRLIYVTPSHQFPLGMPMSEPRRRALLARAAELGALIIEDDYDCEFRYQGPPADALQRLDRHGLVAYVGTFSKTLLQELRLGYAVLPPAVLKAACVAKHLSDWHSPTLLQWALARFISEGHLNKHIRRCHDVYSARRERILARLGGDLAPWFSAVPASAGFHLSALAKPGVDVELLANLARKVEVGLYSLAPFFSDVPVRPGLVMGFGAIELLDIDPALDRVRDTLQRLS
>NZ_CP024086.1|WP_027593708.1|3759436_3759775_+|hypothetical-protein
MHQSARPTAELRHTLRELLAHKVSNPDDDPHLSGVLFFCATDERTRQLIERIELLASEAFFDASGRAITHRMRAAAVDGVRIKQKHKAPADETVIRIALPDKGYITVSTARL
>NZ_CP024086.1|WP_099429776.1|3757801_3759055_+|glycolate-oxidase-subunit-GlcF
MQTNLSEAAKRLPRAEEAERILRSCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLEGAPITASTQLHLDRCLTCRNCETTCPSGVKYHDLLDIGRAVVEQQVPRPLGQRLLQGGLRAVVPRPALFKALCRTGQALRPVLPATLKSKLPAQVTAPGVRPAPRHARRVLMLEGCVQPALSPNTNAAAARVLDRLGISVEPIREAGCCGAVDYHLNAQAQGLDRARRNIDAWWPAIEAGAEAIVQTASGCGAFVRDYGHLLEADPRYAAKAARVSALSRDLVEVLCEAPVEQLGLCAEQRVAFHCPCTLQHALKLGGAVEGLLTRLGFTLTAVPDGHLCCGSAGTYSLTQPELSRQLRDNRLKALESGMPQVIVTANIGCQAHLAGAGRTPVRHWVEIVDAGLGLGLGLGLGLGAG
>NZ_CP024086.1|WP_099429781.1|3767600_3767978_-|response-regulator
MSEDAQDVVLVVEDEPAIRMILRDYLAGEGYHVLVAEDGEQAFKILASKPHLDLMVTDFRLPGGISGVDIAEPAVKLRPELKVIFISGYPAEILESGSPITRKAPILAKPFDLDTLHEQIQALLR
>NZ_CP024086.1|WP_099429782.1|3768022_3769249_-|hybrid-sensor-histidine-kinase/response-regulator
MLSHTIAKLLIVDDLPENLLALDALIQGEDREVHQAQSAEAALSLLLEHEFALAILDVQMPGMNGFELAELMRGTEKTKNIPIVFVSAAGREMNYAFKGYESGAVDFLHKPLDTLAVKSKVSVFVDLFRQRKVLGRQLEALERSRQEQEVLLGQLELARCELEHAVRMRDDFMSIVSHEVRTPLNGLILETQLRKMHLARGNLEAFSADKLQAMVERDERQINSLIRLIEDMLDVSRIRTGKLSLRPRVFDIGQLVRGLVENFSAQATALETHIALQRCETLQGEWDEFRIEQVVANLLSNALRYGERKPVQVRVFAEDGMAWVQVQDHGIGISAVNQQRIFQQFERVAAHQASGGLGLGLYISEQIVQAHGGRILVDSEEGEGATFTLQLPLATFKEQNDQARATSA
>NZ_CP024086.1|WP_099429783.1|3769242_3769818_-|chemotaxis-protein-CheB
MNGARAVVMGASAGGVAALFQVLGALPSAFAIPVLCVLHLPDGRHSQLAEVLQRRLQRPVREASDKERISAGMIYVAGPGYHLSVERDLTLSLSQEAPVHFSRPAIDFLFMSASDAYGASLLGVLLTGANEDGAAGLAYINNNGGRTIVQDPRDAQVALMPEAALALHQPDHILTLSGIGQLLATLETSAC
>NZ_CP024086.1|WP_027593720.1|3769814_3770636_-|protein-glutamate-O-methyltransferase-CheR
MTSERNTDIEIRLLIEAIYLKYSYDFRNYSGASIKRRILHALRQFDCLTVSALQERVLHDPGMFMQLLQFLTIPVSEMFRDPSHFLALRNEVVPLLRTWPSIKIWVAGCSTGEEVYSMAILLREEGLLERTIIYATDINPHSLDRAKQGIYSMQSMREYEENYRLAGGRRDFAEYYTAAYGNAIMDSSLRDNVTFADHSLATDSVFSETQLVSCRNVLIYFNKDLQDRALGLFHESLCHRGFLVLGSKESVDFSAYSQRFEPLVKPERIYRKT
>NZ_CP024086.1|WP_099429784.1|3770632_3774100_-|response-regulator
MIQVASIDQQSFRKLLSRNIGLPLGVGLLGAVAFVAVINYLLSAMQWVEHTDRVIGNANETVKLSIDMETGMRGFLITGDERFLDPYEVAKPKILGSLQSLRAMVEDNPQQVDRIDRLLALQKAWNDFGSEMITLRRSEGNYQASIGNGRGKRITDEIRKEFEGLIDTEQQLRMARNEKVSSVTVTAISAFVLFIVGLSALLAYLGRRDLLALSSSYDENLQAQQRAAERLEHQAWLRNGQTQLAQQVLGQLTLPMLGDNILRFFATYLGSVVGAVYARDEHGRLVRVATYGLSAEEQAREQIKGDHDGLLAQAVREGRLLCLDDLPEDYYRLSSGLGNGLPRSALLMPATDDGQINGVIELGFLRPLQPRDEELMERVGGNLGMSIESARYRQRLQEVLAETQQLNEELQVQQEELKTANEELEEQSRVLKESQAHLETQQAELEQTNEQLSERTDALDRKNDELSQAQQELQARADDLQRSSKYKSEFLANMSHELRTPLNSSLILAKLLAENGEGNLSAEQVKFAESIYSAGNDLLNLINDILDIAKVEAGKLEVRPETTQLERLVEGLRGMFLPLAEHKGLAFEVKVEPQVPVTLFTDRQRLEQILKNLLSNAIKFTDHGQVSMTISHQAGTGIIFAVRDSGIGIAADQQQAIFGAFHQVDGSSNRRYGGTGLGLSISRDLAHLLGGQINVESNPGQGSVFSLVMPERYEHEGEEVEALSLRPAVDTLPPAPKASNAVAPKLPAPTFADDRERAPFDNRCILVIEDEPNFARILFDLAHELGYSCLVAHGADEGFALASQYIPDAILLDMRLPDHSGLTVLQRLKELAGTRHIPVHIISVEDRVEAAMHMGAVGYAVKPASREELKEVFARLEAKLTQKLKHILLVEDDDLQRESIARLIGDDDVEITAVAMAQDALALLRENIYDCMIIDLKLPDMLGNELLKRMTAEDIRSFPPVIVYTGRNLTREEETDLLKYSRSIIIKGARSPERLLDEVTLFLHKVESQLSHERQRMLKTARSRDKVFEGRKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDGFEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWLPQLERI
>NZ_CP024086.1|WP_099429785.1|3774349_3774700_+|response-regulator
MHLLVVEDDDIVRMLMVEVLDELGYTVIEAEDATAALRVLEDPAQALALMMTDVGLPDMRGEVLAQRARELRPLLPVLFASGYAENVNVPEGMHLIGKPFSIEQLRNKVVDILGTV
>NZ_CP024086.1|WP_099430931.1|3774867_3775617_-|precorrin-6A-synthase-(deacetylating)
MNTILLVGIGAGDPRQITLEAVEALRRATVFFVLDKGGERQALARARKALVDHYVQPGSYRWVQVEDPFRDADAMDYVAAVQDWHVRRASLYSRLLSEALGPDDVGAFLLWGDPSLYDSTLRILERVRELGVRVQVEIIPGISSVQALAARHQVPLNRIGEPLTVLPGRRLAEQQRIDNIVVMLDGQCAFASLDDPGLMIYWGAYLGTADEVLIAGPLQAVKAQILQVREEARTRKGWIMDTYLLRREL
>NZ_CP024086.1|WP_099429786.1|3775778_3777350_+|metallophosphoesterase
MLSLKKRRVPLARVFLSTLLLSGYLNNCAFAEVDTVTQRFVFQSDTQYPRSPSGADYPGESLPLLDAQNAAITAYRDAYGGGIPIILNGDVTEFGHRYQWNIMKGRMLPGTYYGLGNHDYENNVDSCGLNECAMLSVVTHLTEDIKRWNVDAFDQYQEGDDSPTWQKYHGSMAYRKTFGDFAFIQLHNHFAYRKSFSGWFNYEDKTVHIKPSLDWLESQLKIADEAGKLIIINMHRHPEDNDWGSAAERARFQEMVNKYKVLAIFMGHTHELALRGKIGDVPVLDSGSPIYKTFLVGEADPQANAFTVKQAKDNTLLPSPLLTIPIRFYVPEPAILPWPESLDFTLPLLHVRDRDISHFEVSIDGQPYVRSDNRKKVTIENLTPYTRYNYNIRVYDSGSATPVKTYDGTAATLNALLSPKDLCYVSLGEPGAPNNSLHVKWSPPYPNYAPGNYWFRVTLWTLQGNYIRELRGAAQGSRSREIQFLEPDDVMNTRIHVRYQSAGLVDGRDATFDLKDLFHGCGT
>NZ_CP024086.1|WP_099429787.1|3777441_3778731_-|OprD-family-porin
MFAPLPHAPGRRVAGLFLLCAGVNAQAAGFLEDSSAKVEARNVYFNRDFRDGHSSSSQGASKREEWAQGFILNVQSGYTQGPVGFGVDALGMVGFKLDSSPADSNSGLLPSSGHDPRHSADQYAKMGLAAKVKVSSTVLKYGSMMPDVPLLKYNDGRLLPTMFHGAMLTSEEVRDLKFTLARLDKYTARDSTDRQDIRVHCKNKRYACDIEADHFDLAGLDYRFNDRVSAQYQVAKLENIYRQHFLGLVASQPLAVGSLSADLRVIKSDDIGNARAGDIDHRAFSGMLGYSLGGHKVSAGWQRMYGESAMPYLDGSNPYLVNYAQVNDFAAAQERSWQLRYDYDFKALGVPGLTFFTRYINGDHIKVPGSNAEGKEWERDTEFKYQVQSGTFKDVSVRLRNSTYRSNYEKWARDMDETRVIVSYSFSVW
>NZ_CP024086.1|WP_027593725.1|3779091_3779451_+|DNA-binding-protein
MSRLAEFRAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKGLRDIIAILDPKAATRPTAAAPKQQRRPRVVKVYENPHTGELIETKGGNHRGLKAWKEEYGAATVESWVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024086_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024086_4

6096227-6096330

Unclear

Consensus_repeat	Method
CCATACGCCGATCAGTGTGGGAGC	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_CP024086_4

>merge|NZ_CP024086|4|6096227-6096330|CRISPRCasFinder
CCATACGCCGATCAGTGTGGGAGCAACTGTCTTGTGGTGCTTGTTCCGGCCGCATCGCTGGCAAGCCCACACATGGTCCCCCATACGCCGATCAATGTGGGAGC

>NZ_CP024086|4|4|6096227-6096330|CRISPRCasFinder
CCATACGCCGATCAGTGTGGGAGC	AACTGTCTTGTGGTGCTTGTTCCGGCCGCATCGCTGGCAAGCCCACACATGGTCCC
CCATACGCCGATCAATGTGGGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024086.1\|WP_003253341.1\|6096912_6097602_+\|phosphate-regulon-transcriptional-regulator-PhoB	unknown	unknown	gnl\|CDD\|131209
NZ_CP024086.1\|WP_027592133.1\|6097647_6098955_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|274368
NZ_CP024086.1\|WP_027592135.1\|6095278_6096169_+\|4-hydroxybenzoate-octaprenyltransferase	unknown	unknown	gnl\|CDD\|237229
NZ_CP024086.1\|WP_099430813.1\|6106075_6108364_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226956
NZ_CP024086.1\|WP_027592132.1\|6099094_6100435_+\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP024086.1\|WP_027592137.1\|6094384_6094552_-\|rubredoxin	unknown	unknown	gnl\|CDD\|224687
NZ_CP024086.1\|WP_099430810.1\|6096371_6096740_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226765
NZ_CP024086.1\|WP_099430806.1\|6090656_6092060_+\|HDOD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224554
NZ_CP024086.1\|WP_099430809.1\|6094721_6095279_+\|chorismate-lyase	unknown	unknown	gnl\|CDD\|113128
NZ_CP024086.1\|WP_027592131.1\|6100451_6101348_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP024086.1\|WP_027592143.1\|6087569_6088496_+\|hydrogen-peroxide-inducible-genes-activator	unknown	unknown	gnl\|CDD\|176103
NZ_CP024086.1\|WP_099430807.1\|6092713_6093013_-\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259853
NZ_CP024086.1\|WP_027592129.1\|6102616_6103387_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|182974
NZ_CP024086.1\|WP_027592140.1\|6092191_6092566_-\|helicase	unknown	unknown	gnl\|CDD\|376720
NZ_CP024086.1\|WP_027592144.1\|6086743_6087475_+\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|223880
NZ_CP024086.1\|WP_099430811.1\|6101560_6102451_-\|response-regulator	unknown	unknown	gnl\|CDD\|381150
NZ_CP024086.1\|WP_027592142.1\|6088499_6090578_+\|ATP-dependent-DNA-helicase-RecG	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236794
NZ_CP024086.1\|WP_027592128.1\|6103481_6104315_-\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184582
NZ_CP024086.1\|WP_099430808.1\|6093201_6094350_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|179902
NZ_CP024086.1\|WP_099430812.1\|6104387_6106058_-\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|227318

Protein	Function_ID	Function_description	E-value
NZ_CP024086.1\|WP_003253341.1\|6096912_6097602_+\|phosphate-regulon-transcriptional-regulator-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	5.4912e-141
NZ_CP024086.1\|WP_027592133.1\|6097647_6098955_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	0
NZ_CP024086.1\|WP_027592135.1\|6095278_6096169_+\|4-hydroxybenzoate-octaprenyltransferase	gnl\|CDD\|237229	PRK12848, ubiA, 4-hydroxybenzoate octaprenyltransferase.	6.90442e-172
NZ_CP024086.1\|WP_099430813.1\|6106075_6108364_-\|ABC-transporter-permease-subunit	gnl\|CDD\|226956	COG4590, COG4590, ABC-type uncharacterized transport system, permease component [General function prediction only].	0
NZ_CP024086.1\|WP_027592132.1\|6099094_6100435_+\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	4.10463e-128
NZ_CP024086.1\|WP_027592137.1\|6094384_6094552_-\|rubredoxin	gnl\|CDD\|224687	COG1773, COG1773, Rubredoxin [Energy production and conversion].	1.43342e-23
NZ_CP024086.1\|WP_099430810.1\|6096371_6096740_-\|hypothetical-protein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	6.91962e-46
NZ_CP024086.1\|WP_099430806.1\|6090656_6092060_+\|HDOD-domain-containing-protein	gnl\|CDD\|224554	COG1639, COG1639, Predicted signal transduction protein [Signal transduction mechanisms].	4.3868e-86
NZ_CP024086.1\|WP_099430809.1\|6094721_6095279_+\|chorismate-lyase	gnl\|CDD\|113128	pfam04345, Chor_lyase, Chorismate lyase. Chorismate lyase catalyzes the first step in ubiquinone synthesis, i.e. the removal of pyruvate from chorismate, to yield 4-hydroxybenzoate.	1.55686e-47
NZ_CP024086.1\|WP_027592131.1\|6100451_6101348_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	1.604e-28
NZ_CP024086.1\|WP_027592143.1\|6087569_6088496_+\|hydrogen-peroxide-inducible-genes-activator	gnl\|CDD\|176103	cd08411, PBP2_OxyR, The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The C-terminal domain also contains the redox-active cysteines that mediate the redox-dependent conformational switch. Thus, the interaction between the OxyR-tetramer and DNA is notably different between the oxidized and reduced forms. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.49418e-91
NZ_CP024086.1\|WP_099430807.1\|6092713_6093013_-\|HU-family-DNA-binding-protein	gnl\|CDD\|259853	cd13831, HU, histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.	2.10413e-34
NZ_CP024086.1\|WP_027592129.1\|6102616_6103387_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|182974	PRK11115, PRK11115, phosphate signaling complex protein PhoU.	5.62417e-92
NZ_CP024086.1\|WP_027592140.1\|6092191_6092566_-\|helicase	gnl\|CDD\|376720	pfam02036, SCP2, SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.	0.00751781
NZ_CP024086.1\|WP_027592144.1\|6086743_6087475_+\|energy-transducer-TonB	gnl\|CDD\|223880	COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane].	5.91298e-21
NZ_CP024086.1\|WP_099430811.1\|6101560_6102451_-\|response-regulator	gnl\|CDD\|381150	cd19923, REC_CheY_CheY3, phosphoacceptor receiver (REC) domain of chemotaxis response regulator CheY3 and similar CheY family proteins. CheY family chemotaxis response regulators (RRs) comprise about 17% of bacterial RRs and almost half of all RRs in archaea. This subfamily contains Vibrio cholerae CheY3, Escherichia coli CheY, and similar CheY family RRs. CheY proteins control bacterial motility and participate in signaling phosphorelays and in protein-protein interactions. CheY RRs contain only the REC domain with no output/effector domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.87522e-48
NZ_CP024086.1\|WP_027592142.1\|6088499_6090578_+\|ATP-dependent-DNA-helicase-RecG	gnl\|CDD\|236794	PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional.	0
NZ_CP024086.1\|WP_027592128.1\|6103481_6104315_-\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184582	PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional.	0
NZ_CP024086.1\|WP_099430808.1\|6093201_6094350_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|179902	PRK04965, PRK04965, NADH:flavorubredoxin reductase NorW.	5.27352e-106
NZ_CP024086.1\|WP_099430812.1\|6104387_6106058_-\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|227318	COG4985, COG4985, ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism].	4.51642e-116

>NZ_CP024086.1|WP_027592135.1|6095278_6096169_+|4-hydroxybenzoate-octaprenyltransferase
MYLQLLKSLNRVHPRAWDFVQLSRMDRPIGIYLLLWPTLSAVWIAGQGSPTLANVLIFGLGVVLMRAAGCCINDFADRKVDGHVKRTADRPLASGRVKPREALALFAILVGVSFLLVLCTNSRTVWLSFGAVALAFCYPFMKRYTYYPQVVLGAAYSWGIPMAFTAAGGELPASAWLLYIANLLWTVGYDTYYAMVDRDDDLKIGVKSTAILFGEADRVIILTLQLLSLACLLLAGSRFELGGWFHLGLLGAALCFAWEFWSTRKLDRESCFKAFLHNHWAGLLVFIGVVLDYALR
>NZ_CP024086.1|WP_099430809.1|6094721_6095279_+|chorismate-lyase
MSYESPQAAAVAWLPYSQLATEIDRPTLDWLFDEGSLTRRLTRLSHDHFSVTPLLEGWQPLRDDECLALGIAPGAQGWVREVYLRGHGQPWVFARSVASRSALERGGLDLETLGSRSLGELLFCDQAFIRHPLQVCSYPQAWLPTEARHDALWGRRSRFERDGLDLLVAEVFLPALWQAAKEENR
>NZ_CP024086.1|WP_027592137.1|6094384_6094552_-|rubredoxin
MKKWQCIVCGLIYDEAEGWPDDGIAPGTRWEDVPADWLCPDCGVGKSDFEMIAIG
>NZ_CP024086.1|WP_099430808.1|6093201_6094350_-|FAD-dependent-oxidoreductase
MTSPVVIIGTGLAGYNLAREFRKLDGETPLLLITADDGRSYSKPMLSTGFAKLKDADGLCMAEPGAMAEQLKAEIRTHTRISGIDPGHKRLWIGEEAVAYRDLVLAWGAQTVQVPIEGDAGGQVFPINDLEDYARFRAAAAGKQRVLILGAGLIGCEFANDMSLGGFQVEVVAPCEQVMPTLLHPAAAAAVQAGLEGLGVRFHLGPVLTRLQQVAQGLEAHLSDGSVIACDLVVSAIGLRPRTDLAAAAGLQTNRGVVVDRQLRTSHANIFALGDCAEVDGINLLYVMPLMSCARALAQTLAGNPTAVSYGAMPITVKTPACPLVVSPPPQGHDGNWQVEGQGSDLKVLCHDADGKLLGYALTGAAVMEKLALNRQLPPVMA
>NZ_CP024086.1|WP_099430807.1|6092713_6093013_-|HU-family-DNA-binding-protein
MRKPELAAVIAEKADLTKEKANVVLNAILDSITGALDKDTVTLVGFGTFEKRHRGARTGKNPQTGEPVKIKASNTVAFKPGKNLRDSVNAPAKPAKKGK
>NZ_CP024086.1|WP_027592140.1|6092191_6092566_-|helicase
MKFRFLLWAMGLLMARASRNNPAFKQQLKDKDLVFQMQTLDGKIARHFIVSDERISSKGGVHPQPAFAIAFKDAAYGFATLQASNKQLAFMQGIQDKHIQIKGNPALVMWFQGLMKYLKPKKKR
>NZ_CP024086.1|WP_099430806.1|6090656_6092060_+|HDOD-domain-containing-protein
MTEVALDTATPHAPSVIRLLLDKVGVTYREVLEHAQLPAASRVQAVLLDDEVGALMVLFPQSQLLDLNRLTELTGRKLTAVSVPRLKQMLDKHHLKRLPGIPALTSSPCQYEKSLLDCETVLIQSGEAGLLLEIDRANFKRMLAKASASSFGQEVKAISPNLDRPDDDSHEITQAVQAFTARRIQKRLEETIEIPPLADTAQKIIKLRVDPNASIDDITGVVETDPALAAQVVSWAASPYYASPGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKDHPQQATPYWQQSIYTAAIIEGLTRAMPRAERPEAGLTYLAGLLHNFGYLLLAHVFPPHFSLICRHLEVNPHLCHTYVEQHLLGINREQIGAWLMKLWDMPEELSTALRFQHDPSYDGDYAAFPNLVCLATRLLRSRGIGSGPQEEVPDELLERLGVTREKAEDVVNKVLEAETLLRELASQFHAPH
>NZ_CP024086.1|WP_027592142.1|6088499_6090578_+|ATP-dependent-DNA-helicase-RecG
MSELSKVPVTVLKGVGDAMAEKLAKVGLENLQDILFHLPLRYQDRTRVVPIGELRPGQDAVIEGVVSGADVTMGKRRSLVVRLGDGSGVLSLRFYHFSNAQKEGLKRGTHLRCYGEARPGASGLEIYHPEYRALNGDEPPPPVEQTLTPIYPSTEGLTQQRLRLLCQQSLGMLGPRSLPDWLPDELARDYQLAPLDDAIRYLHNPPADADLDELAEGQHWAQHRLAFEELLTHQLSQQRLRESLRSLRAPVLPKASRLPAQYLANLGFKPTGAQQRVANEIAYDLAQAEPMMRLVQGDVGAGKTVVAALAALQALEAGYQVALMAPTEILAEQHFITFKRWLEPLGIEVAWLAGKLKGKARASSLEQIANGAPMVVGTHALFQEEVKFKHLALAIIDEQHRFGVQQRLALRKKGVAGELCPHQLIMTATPIPRTLAMSAYADLDTSVLDELPPGRTPVNTVLVADSRRFEVVERVRAACAEGRQAYWVCTLIEESEELTCQAAESTYEELGSALGELRVGLIHGRMKPAEKAEIMAQFKAGELQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSAVSHCVLLYHPPLSQIGRERLGIMRETNDGFIIAEKDLELRGPGEMLGTRQTGLLQFKVADLMRDADLLPAVRDAAQALIARWPDHVSPLLDRWLRHGQQYGQV
>NZ_CP024086.1|WP_027592143.1|6087569_6088496_+|hydrogen-peroxide-inducible-genes-activator
MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGVLIFERSKSAVRLTPVGESIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPYLFPHLIPQLHRVAPQMPLYIEENFTHVLREKLRNGELDAVIIALPFNEADVLTLPLYDEPFCALMPADHPWTAKKTIDTAMLNDKSLLLLGEGHCFRDQVLEACPTLNKGGEGSRHTTVESSSLETIRHMVASGLGVSILPLSAVHSHHYAPGIIEVRPLTAPAPFRTVAIAWRASFPRPKAIEILADSIRLCSVAKPPVEQPA
>NZ_CP024086.1|WP_027592144.1|6086743_6087475_+|energy-transducer-TonB
MTKTRHNLARYSGSLALVLGVHAVAVLLTLNWSVPQAIELPPAAMMVELAPLPEPAPPPPPKAVPQPPAPVEELPLPKLVEAPKPKIAIAKPPKPKAKPQPPKPEKKPEPPKEAPPTESVVDAPPSNTPPQKSAAPAPSIASNSNALPTWQSDLLRHLAKYKRYPEDARRRGLQGINRLRFVVDAEGKVVSYAMAGGSGSAALDRATLEMIRRAGTVPKPPPELLNNGTIEVVAPFVYSLDRR
>NZ_CP024086.1|WP_099430810.1|6096371_6096740_-|hypothetical-protein
MTRHTLSWMALLAALALPGVASADHAMEKNGMLVDHAGMTLYTFDKDAGGKSMCNGDCAKNWPPLMAKAGEKAEGEWTQIKRDDGTMQWAYDGKPLYTFVKDKKAGDTTGDGMKDVWHVAKP
>NZ_CP024086.1|WP_003253341.1|6096912_6097602_+|phosphate-regulon-transcriptional-regulator-PhoB
MVGRNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRKPDLILLDWMLPGTSGIELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRRTGPSDSEAPIEVGGLLLDPISHRVTIDGKPAEMGPTEYRLLQFFMTHQERAYTRGQLLDQVWGGNVYVEERTVDVHIRRLRKALGEAYENLVQTVRGTGYRFSTKS
>NZ_CP024086.1|WP_027592133.1|6097647_6098955_+|phosphate-regulon-sensor-histidine-kinase-PhoR
MNQNWHATLIRHLLLLISVCLLGGLVSGYYGWSLAIGLALYLGWTLKQLLRLHDWLRNHQPDEAPPDGYGLWGEVFDSIYHLQRRDQRVRGRLQAVIDRVQESTAALRDAVIMLDSDGNLEWWNRAAETLLGFKTPQDGGQQVTNLVRHPRFKEYFEAENYVEPLEIPSPINDRMRVQLHITRYGNNEHLMLVRDVTRIHQLEQMRKDFVANVSHELRTPLTVITGYLETLLDNVEDVNPRWTRALQQMSQQGSRMQTLLNDLLLLAKLEATDYPSDNLPVPVDALLQSIKGDAQALSGPRNQRISLEAAPGVSLKGSEAELRSAFSNLVFNAVKYTPDEGSIRIRWWADAQGAHLSVQDSGIGIDAKHLPRLTERFYRVDSSRASNTGGTGLGLAIVKHVLLRHRGRLEISSVPGHGSTFTCHFAPAQLANGKG
>NZ_CP024086.1|WP_027592132.1|6099094_6100435_+|HlyC/CorC-family-transporter
MDPSPGISLTSLFADFGMIIFALLLVLLNGFFVAAEFAMVKLRSTRVDSIAELHGWRGSILRKVHNQLDAYLSACQLGITLASLGLGWVGEPAFAHLLEPLLAYMGVDTPELIKGISFFVAFFVISYLHIVVGELAPKSWAIRKPELLSLWTAVPLYLFYWAMYPAIYLLNASANTILRIAGQGEPGPHHEHHYSREELKLILHSSRGQDPSDQGMRVLASAVEMGELEVVDWANSREDMVSIDAHAPLKQILALLRRHKFSRYPVYDAEREEFTGLLHIKDLLLELAELDHLPETIDLEDLARPLERVSRHMPLSQLLEQFRKGGAHFVLVEEADGKVIGYLTMEDVLEVLVGDIQDEHRKTERGILAYQPGKLLVRGDTPLFKVERLLGIDLDHIEAETLAGLVYETLKRVPEEEEVLEVEGLRIIIKKMKGPKIVLAKVLKLD
>NZ_CP024086.1|WP_027592131.1|6100451_6101348_-|M23-family-metallopeptidase
MPARLLLFCALLMASASSLGVTLYPITDANGVGAYTDRPGPGAKPIELHESMVERQESQVRLNAIVFQGGVSFSARNESHVPVQVELHLDKLINAQGGNAPRIVRRVLPGRSTQMLSVLRGRPGTLLGYRSTLLQAMGDPGLRPQGYRYAFPWLGGPFRVTQGPNGRFSHFGPKGRYAMDIAMPEGTTIIAAREGVVVNVENSQTGRGSNPSGNFVRVLHADGTMGVYLHLMRGSVVVAEGQRVKQGQMLAKSGNTGNSTGPHLHFVVQRNVGLALESIPYQFDRPISGLPDFTAGNP
>NZ_CP024086.1|WP_099430811.1|6101560_6102451_-|response-regulator
MSKVNVLVVDDAPFIRDLVRKCLRNAFPGMVIDDAVNGRKAMAMLGKEPFDLVLCDWEMPEMSGLELLSWCRQQPALKSLQFIMVTSRGDKENVIQAIQAGVSDFVGKPFTNEQLLTKVKKALTKIGKLDSLMATGPARANSAFANDSLSALTGGKPEAVKVAAPAAAPAKPLLNAPAPPAAAPSGRGQGQLRLSSGTQPCVIKALSLKEALLVVRRSEALPQVLEGAVLDLEQGENAEVARLNGYLHAVAALEPKPDSDWLQLTFKFVDQDAQKLDYLSRLIARGTAQKHFTPGA
>NZ_CP024086.1|WP_027592129.1|6102616_6103387_-|phosphate-signaling-complex-protein-PhoU
MINKESLTHHISQQFNAELEEVRSHLLAMGGLVEKQVNDAVTALIEADSGLAQQVREVDEQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDESTKIARRAIQLCEEGESPRGYVEVRHIGDQVRNMVRDALDAFARFDADLALSVAQYDKTIDREYKTALRELVTYMMEDPRSISRVLSVIWALRSLERIGDHARNISELVIYLVRGTDVRHMGLKRMKAEVQGTSGDEAESANVPGQADDK
>NZ_CP024086.1|WP_027592128.1|6103481_6104315_-|phosphate-ABC-transporter-ATP-binding-protein
MQHESHTHGIDMSALGRDKQSLRLAEETVAIEVPGLSLFYGDKQALFDVSMNIPKQRVTAFIGPSGCGKSTLLRTFNRMNDLVDGCRVEGAINLYGTNIYRKGEDVAELRRRVGMVFQKPNPFPKTIYENVVYGLRIQGINKKRTLDEAVEWALKGAALWDEVKDRLHDSALGLSGGQQQRLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIYELKSKYTIVIVTHNMQQAARVSDYTAFMYMGKLVEFGDTDTLFTNPAKKQTEDYITGRYG
>NZ_CP024086.1|WP_099430812.1|6104387_6106058_-|phosphate-ABC-transporter-permease-PstA
MKKDSLKGWFKSGAPGVWISGGAVAMAVIMTIGLLSVIAVRGLGHFWPADLVQATYKVPGQADHIVVGEVVQKEEVPRARLKGAGLPVPEQGPEFMTRELIKVGNRDLNGSDFTWVVGDWLVDEQRPVDLMALERREWGNFYGYLVSVKEEGRVVAEGPAAWNELQARLKRANQLNGELQQLEKKDIGAINHGLERLRLHSRKLELEGKLDAAAQADMDAERAELNSRYKAIEDRLSGLHQAFSRDSLVACDANGREVEINLSKVVHAIQPNGMSGLTKMGTYFAKVWEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQGPVTRLIRIAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATALLLVLVIATLNLSAVWIRNHLREKYKALDH
>NZ_CP024086.1|WP_099430813.1|6106075_6108364_-|ABC-transporter-permease-subunit
MNDLANSTMTQNSQPVRIDFNTPELQRKRRMRALKDRLTRWYVLVGGLAVLAAITLIFFYLAYVVLPLFQGAELTSKKALEPTWLQQDAGKPLMIALEEQNLVGMRVSDKGQALFFDTKTGAELQRVDLPVPAGTQVSSISTDQPGSPLVVLGLSNGQALVFHHTYKITYPDNKKTITPGIDYPYGKDAFVLDDQGRPLEHVSVNVNGETLLLAGSTGSHLQVTQLTREENMMTGEVTSEQNRIDLPQMTEPVKAIYVDPRQQWLYVVNGRATADVFSLRDKSLNGRYKLLEDGNAEITASGQLVGGISLIFGDSKGGLNQWFMARDPDGESRFKLIRSFQMGNAPIVQIDAEERRKGFIALDAEGKLGVFHSTAHRTLLVEPAAEGAGILALSPRANRIIIEEGGKLLPLSLKNPHPEVSFSALWGKVWYENYDEPKYVWQSTASNTDFEPKLSLSPLTFGTLKAAFYAMILAAPLAIAAAIYTAYFMAPGMRRKVKPVIELMEAMPTVILGFFAGLFLAPYLEGHLPGVFSLFVLMPFGILLAGFVWSRLPESIRLRVPDGWEAAILIPVILFTGWFALTMSPYLETWFFGGDMRLWITNDLGITYDQRNALVVGIAMGFAVIPNIYSIAEDAVFSVPRSLTLGSLALGATPWQTLTRVVILTASPGIFSALMIGMGRAVGETMIVLMATGNTPVMEMNLFEGMRTLAANVAVEMPESEVGGSHYRVLFLAALVLLMFTFIMNTLAELIRQRLRKKYSSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

299338 : 307324

Escherichia_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027595203.1\|299338_300748_-	sigma-54-dependent Fis family transcriptional regulator	W8CYM9	Bacillus_phage	2.3e-08	27.1
WP_027595204.1\|300744_302559_-	sensor histidine kinase	NA	NA	NA	NA
WP_099428080.1\|302597_303536_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	9.8e-32	36.7
WP_099428081.1\|303454_304000_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.6e-50	53.4
WP_099428082.1\|303996_304872_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	9.6e-106	66.0
WP_099428083.1\|304868_305951_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.8e-99	53.9
WP_099428084.1\|306217_307324_+	agmatine deiminase	M1HES8	Acanthocystis_turfacea_Chlorella_virus	1.8e-101	49.6

DBSCAN-SWA_2

325179 : 383069

Bacillus_virus(50.0%)

integrase,transposase,holin

attL 318289:318316|attR 346862:346889

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
318289:318316	attL	NA	NA	NA	NA
WP_172960333.1\|325179_326073_-\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_027594254.1\|327262_327511_-	hypothetical protein	NA	NA	NA	NA
WP_033694190.1\|327971_328265_+	DUF3077 domain-containing protein	NA	NA	NA	NA
WP_099428096.1\|328501_329713_-	methyltransferase	NA	NA	NA	NA
WP_027594257.1\|329846_330536_-	ABC transporter permease	NA	NA	NA	NA
WP_099428097.1\|330532_331228_-	ABC transporter permease	NA	NA	NA	NA
WP_099428098.1\|331282_332044_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_085273850.1\|332057_332831_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-20	32.4
WP_027594261.1\|333448_334834_+	GABA permease	NA	NA	NA	NA
WP_027594262.1\|335040_335484_-	hypothetical protein	NA	NA	NA	NA
WP_033694195.1\|335637_336147_+	hypothetical protein	NA	NA	NA	NA
WP_099428099.1\|336156_337152_-	polyphosphate kinase 2	NA	NA	NA	NA
WP_085273848.1\|337346_337553_+	hypothetical protein	NA	NA	NA	NA
WP_027594266.1\|337880_338153_-	oxidative damage protection protein	NA	NA	NA	NA
WP_099428100.1\|338149_339217_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_099428101.1\|339213_341463_-	AsmA family protein	NA	NA	NA	NA
WP_027594269.1\|341892_343554_+	OFA family MFS transporter	NA	NA	NA	NA
WP_027594270.1\|343796_344390_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_027594271.1\|344390_345029_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_027594272.1\|345029_345290_+	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_016484508.1\|345317_346055_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_027594274.1\|346065_346836_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_027594275.1\|346956_348135_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-25	37.2
346862:346889	attR	NA	NA	NA	NA
WP_172960399.1\|348131_348980_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_099428102.1\|349061_350009_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099428103.1\|350462_351839_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_027594279.1\|352234_353341_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_027594280.1\|353541_354042_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_099428104.1\|354142_355105_+	FecR family protein	NA	NA	NA	NA
WP_099428105.1\|355313_358127_+	TonB-dependent receptor	NA	NA	NA	NA
WP_099430851.1\|358153_360922_+	insulinase family protein	A0A2K9LA15	Tupanvirus	1.0e-07	23.8
WP_099428106.1\|360918_362574_+	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_027594285.1\|362826_363084_-	hypothetical protein	NA	NA	NA	NA
WP_099430852.1\|363455_365099_+	hypothetical protein	NA	NA	NA	NA
WP_099428107.1\|365147_365621_-	thioesterase family protein	NA	NA	NA	NA
WP_099428108.1\|365631_366597_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_099428109.1\|366614_367499_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_099428110.1\|367620_368565_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099428111.1\|368712_369657_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_027594291.1\|369715_370117_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_027594292.1\|370402_371380_+	membrane dipeptidase	NA	NA	NA	NA
WP_027594293.1\|371457_371988_+	hypothetical protein	NA	NA	NA	NA
WP_027594294.1\|372003_374064_+	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_099428112.1\|374241_376194_+	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_085273836.1\|376193_377426_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_027594297.1\|377436_378207_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_099428113.1\|378743_379634_+	RHS repeat-associated core domain-containing protein	A0A1W5K0N1	Bacteriophage	7.4e-21	50.5
WP_027594299.1\|379788_381081_-	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_027594300.1\|381376_382477_+	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_099428114.1\|382613_383069_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1087745 : 1095510

Thermobifida_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027595604.1\|1087745_1088600_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.3e-08	31.9
WP_027595605.1\|1088602_1089067_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003255135.1\|1089079_1089388_-	ribosome-associated translation inhibitor RaiA	A0A0K1LP60	Escherichia_phage	4.4e-05	34.1
WP_027595606.1\|1089467_1090961_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_027595607.1\|1091136_1091862_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-23	26.5
WP_027595608.1\|1091862_1092387_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_027595609.1\|1092373_1092946_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_099428395.1\|1092954_1093479_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	3.1e-27	48.1
WP_027595611.1\|1093479_1094454_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	8.9e-36	32.9
WP_016501329.1\|1094700_1095510_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.4e-25	32.5

DBSCAN-SWA_4

2062387 : 2070960

uncultured_Caudovirales_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085273003.1\|2062387_2063668_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-95	45.5
WP_027592727.1\|2063668_2065060_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_099428817.1\|2065175_2066138_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_099428818.1\|2066232_2067234_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.1e-153	79.0
WP_027592724.1\|2067230_2067566_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	4.0e-44	78.4
WP_099428819.1\|2067562_2067859_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.3e-25	62.6
WP_027592722.1\|2067858_2068218_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	8.6e-37	66.7
WP_099428820.1\|2068219_2068612_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	7.6e-55	81.4
WP_033696754.1\|2068729_2070109_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.3e-27	51.1
WP_003251184.1\|2070288_2070960_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	2.1e-105	91.0

DBSCAN-SWA_5

3952920 : 4011972

uncultured_Caudovirales_phage(25.0%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099430853.1\|3952920_3953979_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099429885.1\|3954346_3955537_-	MFS transporter	NA	NA	NA	NA
WP_099429886.1\|3955656_3956562_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_027593866.1\|3956546_3957467_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_027593867.1\|3957627_3958404_+	YqcI/YcgG family protein	NA	NA	NA	NA
WP_099429887.1\|3958406_3959033_+	LysE family translocator	NA	NA	NA	NA
WP_099429888.1\|3959058_3960153_+	hypothetical protein	NA	NA	NA	NA
WP_099429889.1\|3960309_3961005_+	sel1 repeat family protein	NA	NA	NA	NA
WP_027593871.1\|3961095_3961797_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_099429890.1\|3961793_3962108_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_085273250.1\|3962104_3962938_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_027593874.1\|3963014_3963242_+	hypothetical protein	NA	NA	NA	NA
WP_099429891.1\|3963277_3963766_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_027593876.1\|3963765_3964374_-	SCO family protein	NA	NA	NA	NA
WP_012271640.1\|3964588_3965173_-	Fe-S biogenesis protein NfuA	NA	NA	NA	NA
WP_099429892.1\|3965231_3966266_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	2.8e-19	32.6
WP_027593878.1\|3966502_3968812_-	fatty acid cis/trans isomerase	NA	NA	NA	NA
WP_099429893.1\|3968978_3972686_+	methionine synthase	A0A140XBC7	Dickeya_phage	1.0e-15	68.3
WP_099429894.1\|3972850_3973069_+	DUF2970 domain-containing protein	NA	NA	NA	NA
WP_099429895.1\|3973357_3978094_-	hypothetical protein	NA	NA	NA	NA
WP_099429896.1\|3978168_3979245_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099429897.1\|3979460_3981113_+	nitrite/sulfite reductase	NA	NA	NA	NA
WP_027593883.1\|3981096_3981591_+	DUF934 domain-containing protein	NA	NA	NA	NA
WP_099429898.1\|3981663_3986880_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_157765565.1\|3986970_3990999_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_172960372.1\|3991062_3995490_-	hypothetical protein	NA	NA	NA	NA
WP_172960373.1\|3995520_3995850_+	hypothetical protein	NA	NA	NA	NA
WP_099429901.1\|3996807_3997611_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.6e-35	36.6
WP_099429902.1\|3997758_3998940_+	MFS transporter	NA	NA	NA	NA
WP_027593888.1\|3999326_3999791_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_027593889.1\|3999805_4001161_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.1e-11	23.2
WP_099429903.1\|4001157_4001871_-	response regulator	NA	NA	NA	NA
WP_099429904.1\|4002039_4002822_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_099429905.1\|4002814_4003057_+	hypothetical protein	NA	NA	NA	NA
WP_099429906.1\|4003190_4004156_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099429907.1\|4004365_4005514_+	carboxypeptidase family protein	NA	NA	NA	NA
WP_099429908.1\|4005631_4006600_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_099429909.1\|4006596_4008942_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_099429910.1\|4009002_4009779_-	molecular chaperone	NA	NA	NA	NA
WP_027593898.1\|4009818_4010322_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_027593899.1\|4010325_4010859_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_099429911.1\|4010877_4011414_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_099429912.1\|4011444_4011972_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection