CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024085	Pseudomonas putida strain E41 chromosome, complete genome	3 crisprs	DEDDh,cas3,csa3,WYL,DinG,RT	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024085_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024085_1

1004840-1004904

Orphan

Consensus_repeat	Method
TGAGCTCAATTGAGCTGTATTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024085_1

>merge|NZ_CP024085|1|1004840-1004904|CRISPRCasFinder
TGAGCTCAATTGAGCTGTATTTGAGCTGTATTTGAGCTGCATTGAGCTATATTGAGCTCTATTGA

>NZ_CP024085|1|1|1004840-1004904|CRISPRCasFinder
TGAGCTCAATTGAGCTGTATTTG	AGCTGTATTTGAGCTGCAT
TGAGCTATATTGAGCTCTATTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024085.1\|WP_099452954.1\|1001019_1001787_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NZ_CP024085.1\|WP_027595519.1\|998535_999390_+\|putative-selenate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|275346
NZ_CP024085.1\|WP_099452959.1\|1015165_1015882_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377050
NZ_CP024085.1\|WP_027595530.1\|1009407_1009743_+\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|235518
NZ_CP024085.1\|WP_099452951.1\|997373_998408_-\|selenide,-water-dikinase-SelD	unknown	unknown	gnl\|CDD\|234870
NZ_CP024085.1\|WP_099452956.1\|1004922_1006254_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP024085.1\|WP_085272634.1\|1003357_1003837_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP024085.1\|WP_099452957.1\|1006315_1006738_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319937
NZ_CP024085.1\|WP_099452952.1\|999386_1000202_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226164
NZ_CP024085.1\|WP_099452958.1\|1013389_1014814_-\|acyl--CoA-ligase	unknown	unknown	gnl\|CDD\|366135
NZ_CP024085.1\|WP_027595531.1\|1009807_1011670_+\|protein-translocase-subunit-SecD	unknown	unknown	gnl\|CDD\|235615
NZ_CP024085.1\|WP_099452955.1\|1002883_1003054_+\|addiction-module-killer-protein	unknown	unknown	gnl\|CDD\|162974
NZ_CP024085.1\|WP_099452953.1\|1000195_1001023_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226165
NZ_CP024085.1\|WP_027595532.1\|1011680_1012589_+\|protein-translocase-subunit-SecF	unknown	unknown	gnl\|CDD\|237275
NZ_CP024085.1\|WP_099455787.1\|1003930_1004578_-\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379142
NZ_CP024085.1\|WP_027595525.1\|1003050_1003347_+\|putative-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|188241
NZ_CP024085.1\|WP_027595523.1\|1001816_1002707_-\|effector-protein	unknown	unknown	gnl\|CDD\|226304
NZ_CP024085.1\|WP_027595528.1\|1007185_1008235_+\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	unknown	unknown	gnl\|CDD\|234666
NZ_CP024085.1\|WP_077068621.1\|1008249_1009365_+\|tRNA-guanosine(34)-transglycosylase-Tgt	unknown	unknown	gnl\|CDD\|234642
NZ_CP024085.1\|WP_027595533.1\|1012709_1013258_+\|glycine-zipper-2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|183072

Protein	Function_ID	Function_description	E-value
NZ_CP024085.1\|WP_099452954.1\|1001019_1001787_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	8.2662e-82
NZ_CP024085.1\|WP_027595519.1\|998535_999390_+\|putative-selenate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|275346	TIGR04553, ABC_peri_selen, putative selenate ABC transporter periplasmic binding protein. Members of this family ABC transporter periplasmic binding proteins and represent one clade within a larger family that includes phosphate, phosphite, and phosphonate transporters. All members of the seed alignment occur near a gene for SelD, the selenium-activating protein needed to make selenocysteine or selenouridine. Context therefore suggests members should be able to transport selenate, although transporting other substrates as well (e.g. phosphonates) is possible. This model has no overlap with TIGR03431, whose members are found regularly with phosphonate catabolism operons.	1.40784e-128
NZ_CP024085.1\|WP_099452959.1\|1015165_1015882_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|377050	pfam03472, Autoind_bind, Autoinducer binding domain. This domain is found a a large family of transcriptional regulators. This domain specifically binds to autoinducer molecules.	2.45979e-30
NZ_CP024085.1\|WP_027595530.1\|1009407_1009743_+\|preprotein-translocase-subunit-YajC	gnl\|CDD\|235518	PRK05585, yajC, preprotein translocase subunit YajC; Validated.	2.65406e-49
NZ_CP024085.1\|WP_099452951.1\|997373_998408_-\|selenide,-water-dikinase-SelD	gnl\|CDD\|234870	PRK00943, PRK00943, selenide, water dikinase SelD.	0
NZ_CP024085.1\|WP_099452956.1\|1004922_1006254_+\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	1.25723e-16
NZ_CP024085.1\|WP_085272634.1\|1003357_1003837_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.13158e-12
NZ_CP024085.1\|WP_099452957.1\|1006315_1006738_+\|VOC-family-protein	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	1.67978e-31
NZ_CP024085.1\|WP_099452952.1\|999386_1000202_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226164	COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism].	6.23164e-91
NZ_CP024085.1\|WP_099452958.1\|1013389_1014814_-\|acyl--CoA-ligase	gnl\|CDD\|366135	pfam00501, AMP-binding, AMP-binding enzyme.	4.46932e-41
NZ_CP024085.1\|WP_027595531.1\|1009807_1011670_+\|protein-translocase-subunit-SecD	gnl\|CDD\|235615	PRK05812, secD, preprotein translocase subunit SecD; Reviewed.	0
NZ_CP024085.1\|WP_099452955.1\|1002883_1003054_+\|addiction-module-killer-protein	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	1.29902e-21
NZ_CP024085.1\|WP_099452953.1\|1000195_1001023_+\|ABC-transporter-permease	gnl\|CDD\|226165	COG3639, COG3639, ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism].	5.66939e-61
NZ_CP024085.1\|WP_027595532.1\|1011680_1012589_+\|protein-translocase-subunit-SecF	gnl\|CDD\|237275	PRK13022, secF, protein translocase subunit SecF.	1.61834e-145
NZ_CP024085.1\|WP_099455787.1\|1003930_1004578_-\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	8.01686e-05
NZ_CP024085.1\|WP_027595525.1\|1003050_1003347_+\|putative-addiction-module-antidote-protein	gnl\|CDD\|188241	TIGR02684, conserved_hypothetical_protein, probable addiction module antidote protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the downstream member of a gene pair. It is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module. [Mobile and extrachromosomal element functions, Other].	7.97806e-38
NZ_CP024085.1\|WP_027595523.1\|1001816_1002707_-\|effector-protein	gnl\|CDD\|226304	COG3781, COG3781, Predicted membrane protein [Function unknown].	2.97525e-59
NZ_CP024085.1\|WP_027595528.1\|1007185_1008235_+\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	gnl\|CDD\|234666	PRK00147, queA, S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional.	0
NZ_CP024085.1\|WP_077068621.1\|1008249_1009365_+\|tRNA-guanosine(34)-transglycosylase-Tgt	gnl\|CDD\|234642	PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional.	0
NZ_CP024085.1\|WP_027595533.1\|1012709_1013258_+\|glycine-zipper-2TM-domain-containing-protein	gnl\|CDD\|183072	PRK11280, PRK11280, hypothetical protein; Provisional.	4.06824e-92

>NZ_CP024085.1|WP_099455787.1|1003930_1004578_-|trypsin-like-peptidase-domain-containing-protein
MLLSGCNGVPTSYVSDPVYNQAFVVTSGAPLPLLLMASAIQWNEDYAVTAKHTPFLRNVVHEGLGDVVFFKHKASEVPHWRQYVPGESVTAVGFNSLMIPVQGKGHALPSLVRLEGTPGSVFYSLHDGPMVKGMSGGPVFADDGQVVGINIAFIPKNEIDARTRPDLADKERVSVFMSYSEIDKEWRRFQYLLARKAKPHAPAAIKGIVAVVAKP
>NZ_CP024085.1|WP_085272634.1|1003357_1003837_-|GNAT-family-N-acetyltransferase
MHLSHRPVQPSDIPAICCFPQGPDELFYMFPKATYPLTPVQLTDAIAQRNGSTVVQGGGMVLGFANFYKAEHGGVCALGNVVVAPAARGHGVASYLVTAMIELAREQFAAREIWVSCFNHNTAGLLLYPQLGFVPFGIEERQAPDGKRVALVQMRQVLA
>NZ_CP024085.1|WP_027595525.1|1003050_1003347_+|putative-addiction-module-antidote-protein
MSEKLIPFDIADLLDSDAAISEYLSQVLSDGDTDEIIRAIGHIARARGMTQIAAQSGLGRESLYKALSPGAKPRFDTVLKVIRALGVELFVQPHTSSH
>NZ_CP024085.1|WP_099452955.1|1002883_1003054_+|addiction-module-killer-protein
MSHECGVSELRIDVSAGYRVYFMRKGAKVIFLLVGGDKSSQTADILKARKLVEEMK
>NZ_CP024085.1|WP_027595523.1|1001816_1002707_-|effector-protein
MKEIIARKYRLVVKTIGYIGWSLFWLLIWDVLVTIDFMLFFNSKFTLPLIPLTLLGSALVVLVSFRNSSAYNRWWEARTLWGALVNSSRSFARQTLTLIDDPDDGLNPIKATLLRRHIAYVNCLAAHLKGDRCPDELIAFIPQAEFERRNRSNNFANDILSGSAALLAREYQAGRLDSIRLARLESTLVDLSNAQGGMERIANTPLPYPYVYFPRLFITLFCLIVPVGLVESLEWFTPLASTVVGFMLLAIERIGTDLQSPFRFSEHQIQMDTICETIERNLESMQREAQHGELTT
>NZ_CP024085.1|WP_099452954.1|1001019_1001787_+|phosphonate-ABC-transporter,-permease-protein-PhnE
MNRAINLLVLGVIIAAVVASFTYLELDLQALVGDGGLGQMGEYAGRFLHPDVTVEHLRAVWHGALETLAMSGLGTLLAVVLGMLLALPAAGRFGWPLQAAARVLLNALRAIPELVWAALTVLAAGLGPNAGTLALALHTAGVLGRLFAEALENAPAEPAAAIRLQGGSQVAAFCFGTLPNLWPQLLAYSLYRWENNIRMASVLGFVGAGGLGQMLYTTLSLFQEAQASTVIIAMLVLVLLVDALSDVLRQRYVRA
>NZ_CP024085.1|WP_099452953.1|1000195_1001023_+|ABC-transporter-permease
MLKAHARDPAALPRLLLSLLAVAVLWPGLQLSELNPGVLWQAENRQQIASFTQAFWPPAHDAPFLQLLYEATLQTLAVATAGMTLALVLAVPASLLASRALSLRAASRGGRAVWWSRGLRLPVRGLLIFLRSVPEIVWALLFVRAVGLGPTAGVLAIAITYSGMLGKVYAEIFESVDQRPAHALLQAGSGRLMAFFYGILPNAVSEVVSYTVYRWECAVRASVVMGFVGAGGLGQQIDLSMRMFAGAEVASMLLTFLLLVSLADLLSRFLRGRLA
>NZ_CP024085.1|WP_099452952.1|999386_1000202_+|ATP-binding-cassette-domain-containing-protein
MTSAPVAIHLHDASLHHGQVRALDAINLRVEQGERVAIIGPSGAGKSSLLHLMATAMQPSAGRLALFGELPWQLSGRARQRLRARVGLVHQAPPLPPRQRVVTAVLAGRLGQWGIVRGLLNLLYPTDVPGVRQALAELGLADKLFVQCGQLSGGQLQRVGIARVLYQRPELLLTDEPVSAMDPVLADHSLALLNRHAQANGVTLVASLHAVELALAHFPRVIGIREGQVVFDSPAEAVSPQMLDALYANEHLASPPLQGPAAVLTVQIPRC
>NZ_CP024085.1|WP_027595519.1|998535_999390_+|putative-selenate-ABC-transporter-substrate-binding-protein
MLKRPLALAAGLVLSCCAVVAQAAETLRVSAIPDEAPTELQRKFKPLGEYLAKQLGMEVKFVPVADYPAVVESLASDRLDLAWLGGFTFVQVHLKDPNATPLVQREQDAQFTSKFITANPNVKSLADLKGKSFAFGSISSTSGSLMPRYFMLKENNIKPEDYFSRVAYSGAHDATAAWVQAGKVDGGVLNASVWQKLVDAGKVDTSKVKVFATTPTYYDYNWTVRGNMAPALKAKIKQAFLDLDPANPEHKAILDLQAASRFIETKPENYQGTEQAAREAGLLK
>NZ_CP024085.1|WP_099452951.1|997373_998408_-|selenide,-water-dikinase-SelD
MSEPIRLTQYSHGAGCGCKISPKVLDVILAESGIQALDPNLWVGNASRDDAAVYALDEERGVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREVIRGGRAVCAEAGIPLAGGHSIDAPEPIFGLAVTGVVSKRHLKRNDTATAGCRLYLTKPLGIGILTTAEKKAKLREQDQGLARDWMCTLNTPGSRFGKLESVRAMTDVTGFGLLGHLVELADGSGLTAHLDYAAVPRLPSVEHYLAEGCIPGGTLRNYESYGHKIGALSDDQKHLLCDPQTSGGLLVAVSPEGEAQFLAVAAELGLQLSPIGTLGERQSNAAEVI
>NZ_CP024085.1|WP_099452956.1|1004922_1006254_+|Fic-family-protein
MTLPNKILSALEGEQALSSREIAELLGLSWSTVKRHLDVLMEAGKIQREREGRTARYRLIRASAPRLQSMPAQAIASDLPWSSESINLRKSLLLPLAMREVVTYQRDLVDSYQPNQTTWLSPDLAETLEVEGRMKGQQPAGTYARKVLEPLLIDLSWSSSRLEGNRYSLLDTERLFKSGITDGDLDAVMLLNHKAAIEFMIDAVPEYGLNSAVIRNLHALLMQDLLADSTALGSIRQTVMNISGTTYFPTQVPTLLEEMFEQILDKARQIKSPIEAAFFLWVNLAYLQPFEDGNKRTSRLAANIPLMLYNCSPLSFLDVTPHDYALAMMGVYEQRDMAMAVDLFVWVYRRSIKKYGVMLEAMGVPDPVRLHFREVLNEAINAVVRDRQAVGEVVAGLLLSEHEKLQFEPLLQAELDSLALHNCARYRLGMRQVQAWIEAGRPR
>NZ_CP024085.1|WP_099452957.1|1006315_1006738_+|VOC-family-protein
MLKLNSLVPELIVSDLTRSLAFYCDILGFRVEYERPEDHFAFLSFGGSQLMLEQDWHSESPWRVGPLEPPYGRGINLSIECPDASALVTALEAGGYPLRNPVEECWYRSGEFLFGQRNFLVLDPDGYLLRFAEAIGSKPC
>NZ_CP024085.1|WP_027595528.1|1007185_1008235_+|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA
MRVADFSFELPDSLIARHPLAERHGSRLLVLDGPSGALVHQQFTDLLDYLRPGDLMVFNNTRVIPARLFGQKASGGKLEVLVERVLDSHRVLAHVRSSKAPKVGAQILIDGGGEAEMVARHDTLFELRFTEEVLPLLERVGHMPLPPYIDRPDEGADRERYQTVYAERAGAVAAPTAGLHFDEALLEKIAAKGVERAFVTLHVGAGTFQPVRVDKIEDHHMHKEWLEVSQDVVDAVQACRARGGRVVAVGTTSVRSLESAARDGVLKAFSGDTDIFIYPGRPFHVVDALVTNFHLPESTLLMLVSAFAGYPETMAAYAAAVQEGYRFFSYGDAMFITRNPAPRGPEDQA
>NZ_CP024085.1|WP_077068621.1|1008249_1009365_+|tRNA-guanosine(34)-transglycosylase-Tgt
MSFELLATDGKARRGRITFPRGTVETPAFMPVGTYGTVKGMLPRDIEAIGAEMILGNTFHLWLRPGTEVIKKHNGLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGSKVFMGPEESMQVQRDLGSDVVMIFDECTPYPAEHDVARTSMELSLRWAQRSKNAHADNTAALFGIVQGGMYQDLRMRSLEGLENIGFDGLAIGGLSVGEPKHEMIKVLDYLPDQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDTGVIKIRNAFHRHDESPLDPTCDCYTCTNFSRAYLHHLDKCGEMLSSMLNTIHNLRHYQRLMAGLREAIQQGKLAAFVDAFYAKRGLPVPPLG
>NZ_CP024085.1|WP_027595530.1|1009407_1009743_+|preprotein-translocase-subunit-YajC
MSFLIPAAYADAAAPAAGPAGTGFEWIFLVGFLVIFYLMIWRPQAKRAKEQKNLLGNLQKGDEVVTNGGIAGKIVKVTDDFVVLEVSDTVELKFQKGAIAATLPKGTLKAI
>NZ_CP024085.1|WP_027595531.1|1009807_1011670_+|protein-translocase-subunit-SecD
MLNKYPLWKYALILLVLAIGFIYSAPNLYPDDPAVQVSGASSALQVSQADLDRVTKALTDAGITVKGGSLGEKGSALIRLTNQEDQLPAKDVVRKALGDDYVVALNLAQTTPQWLRNLGASPMKLGLDLSGGVHFLLEVDMDKAMSARMKVYEGEVKTLLRKERIRYRSLPQQDGGIMLGFSDDATREQARALIRKNFSDFDLTATERNDLAVLRLALTQAKVAEIREYSIKQNLTTVRNRVNELGVAEPLVQRQGANRIVVELPGVQDTAEAKRILGKTANLEFRFGAEPGASKATTEVFEFREGGRSAPVERGLIITGDQVTDAQASFDEHGRPQVNIRLDGHGGELMSRATRSNVGRSMAVIFIEQKPVTRYVKQTVDGVEKEVPVQSFQEEKKIISLATIQSPLGSQFRITGLNGQGESSELALLLRAGGLAAPMYFAEERTIGPSLGADNITKGIDASLWGMLFVSLFIIAIYRGFGVIATVALAGNMVLLLALMSLLGATLTLPGIAGIVLTMGMAVDANVLIFSRIREELKAGMSVQRAIHEGFNRAYTAIIDANLTSLLVGGILFAMGTGPVKGFAVTMSLGIFTSMFTAVMVTRAMVNLTCGGRDIKKLWV
>NZ_CP024085.1|WP_027595532.1|1011680_1012589_+|protein-translocase-subunit-SecF
MKTINFMGVRNVAFAITVLLTVLALFSWWQKGLNFGLDFTGGTLIELTYERPADLKAVRAELVESGFHEAVVQSFGATTDLLVRMPGDDPQLGSKVAEALQKAGGDNPATLKRVEFVGPQVGEELRDQGGMGMLLALGGILIYLAFRFQWKFAVGAIISLIHDVVVTLGILSFFQITFDLTVLAAVLAIIGYSLNDTIVVFDRVRENFRVMRKASLIENINVSTTQTLLRTIATSVSTLLAIAALLFFGGDNLFGFSLALFIGVMAGTYSSIYIANVVLIWLNLNSEDLIPPAKAEGVDERP
>NZ_CP024085.1|WP_027595533.1|1012709_1013258_+|glycine-zipper-2TM-domain-containing-protein
MNKSMLVGAVLGAVGVTAGGAVATYSLVNKGPEYAQVTDVQPIKQQVKTPREVCKDVTVTRQAPVKDQHQIAGTVVGALAGGLLGNQIGGGTGKKIATVAGAVGGGYAGNKVQEGMQERDTYTTTQTRCNTVHDISDKVVGYNVKYTIGDQVGQVKMDHEPGSTIPVDKNGKLILSENQAGQ
>NZ_CP024085.1|WP_099452958.1|1013389_1014814_-|acyl--CoA-ligase
MFQQQFFSMVARHRDHPAIVDSHGKTRSYGELLHDIDQLRARLHAAGLREGDVVATQLGNSSGYVALLFAMASLGLIHCPVSVASSIHQRAMRLGQVGAALLVTEAGIVPAGLGIPGFTLHSPTPVNLKTPAWRDCAGLMRMQETSGSTGAPKLALWRQDRLYREIMHWVDSAGLDASARYLSIHTLDGGHAVDLHVFPALLTGATLYLGDATQVENTLQTLHEQRISVMSALPSQYLALAQAAQSRGIRLPALSKPFCGGAYLDDHVVLECERHLGVHLKRIYGSTEFGMVLANFAPGLQVGCGMRPVGDVEVTLKALDPAQPEVGEIIARSAHRGSGYFPPPPMPCEDQAYATGDIARRLADGSLMPMGRSTDALLTKQGTQFAPALEAQIAQAMKFERVVMLIDEQDRRRAQVVVQANIADAQERLNELSGGLDRLGINASVTVLERIPLTPTGKPDRVRLRKLLTAHPVM
>NZ_CP024085.1|WP_099452959.1|1015165_1015882_+|LuxR-family-transcriptional-regulator
MALLVMDELLKLGEMERFEDWLAHLKLLTRKLGYSNFLIGLKPAPTDACQQVLIYSDYPDAWRTRYDAESYAAVDPVVQHCLNANRPLLWNRENYRGPSESEFFEEAAAHGLQQGLALPLHGPRGEAGMLCLKPDESGEQATAAMIQSLPMATLLRDYAMEGMLRARIECSEPVHLTSREKEVLQWSAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQKSITP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024085_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024085_2

1166611-1166704

Orphan

Consensus_repeat	Method
GGCGCTGGATCACTGATGGGGCCGCTTTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024085_2

>merge|NZ_CP024085|2|1166611-1166704|CRISPRCasFinder
GGCGCTGGATCACTGATGGGGCCGCTTTGCGGCCCTTCGCAGCACAAGGCTGCTCCTACAGGGTGGCGCTGGATCACTGATGGGGCGCTTTGCT

>NZ_CP024085|2|2|1166611-1166704|CRISPRCasFinder
GGCGCTGGATCACTGATGGGGCCGCTTTGC	GGCCCTTCGCAGCACAAGGCTGCTCCTACAGGGT
GGCGCTGGATCACTGATGGGGCGCTTTGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024085.1\|WP_099453045.1\|1171532_1172378_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP024085.1\|WP_099453042.1\|1166849_1167575_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP024085.1\|WP_019471749.1\|1152247_1153510_-\|arginine-deiminase	unknown	unknown	gnl\|CDD\|234949
NZ_CP024085.1\|WP_172960401.1\|1175885_1176749_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183082
NZ_CP024085.1\|WP_027595665.1\|1170631_1171540_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP024085.1\|WP_099453049.1\|1176960_1178430_+\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP024085.1\|WP_099453035.1\|1155403_1156831_+\|arginine-ornithine-antiporter	unknown	unknown	gnl\|CDD\|163522
NZ_CP024085.1\|WP_099453043.1\|1167555_1169010_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP024085.1\|WP_099453048.1\|1175038_1175893_+\|D-hexose-6-phosphate-mutarotase	unknown	unknown	gnl\|CDD\|185697
NZ_CP024085.1\|WP_099453037.1\|1157278_1157872_-\|biliverdin-producing-heme-oxygenase	unknown	unknown	gnl\|CDD\|225770
NZ_CP024085.1\|WP_099453038.1\|1158046_1160635_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP024085.1\|WP_099453047.1\|1173577_1174921_+\|porin	unknown	unknown	gnl\|CDD\|226185
NZ_CP024085.1\|WP_027595652.1\|1153542_1154970_-\|arginine-ornithine-antiporter	unknown	unknown	gnl\|CDD\|163522
NZ_CP024085.1\|WP_099453036.1\|1156810_1157224_-\|YbaN-family-protein	unknown	unknown	gnl\|CDD\|377291
NZ_CP024085.1\|WP_099453040.1\|1163843_1165670_+\|phosphogluconate-dehydratase	unknown	unknown	gnl\|CDD\|181628
NZ_CP024085.1\|WP_099453044.1\|1169155_1170442_+\|carbohydrate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224567
NZ_CP024085.1\|WP_027595658.1\|1161839_1162352_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP024085.1\|WP_099453039.1\|1160785_1161748_-\|FecR-domain-containing-protein	unknown	unknown	gnl\|CDD\|226235
NZ_CP024085.1\|WP_027595659.1\|1162578_1163580_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|223135
NZ_CP024085.1\|WP_099453046.1\|1172381_1173536_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	unknown	unknown	gnl\|CDD\|236947

Protein	Function_ID	Function_description	E-value
NZ_CP024085.1\|WP_099453045.1\|1171532_1172378_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	2.06041e-78
NZ_CP024085.1\|WP_099453042.1\|1166849_1167575_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	9.16243e-81
NZ_CP024085.1\|WP_019471749.1\|1152247_1153510_-\|arginine-deiminase	gnl\|CDD\|234949	PRK01388, PRK01388, arginine deiminase; Provisional.	0
NZ_CP024085.1\|WP_172960401.1\|1175885_1176749_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|183082	PRK11302, PRK11302, DNA-binding transcriptional regulator HexR; Provisional.	0
NZ_CP024085.1\|WP_027595665.1\|1170631_1171540_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	8.01151e-74
NZ_CP024085.1\|WP_099453049.1\|1176960_1178430_+\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP024085.1\|WP_099453035.1\|1155403_1156831_+\|arginine-ornithine-antiporter	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	0
NZ_CP024085.1\|WP_099453043.1\|1167555_1169010_+\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	4.06086e-45
NZ_CP024085.1\|WP_099453048.1\|1175038_1175893_+\|D-hexose-6-phosphate-mutarotase	gnl\|CDD\|185697	cd09020, D-hex-6-P-epi_like, D-hexose-6-phosphate epimerase-like. D-Hexose-6-phosphate epimerase Ymr099c from Saccharomyces cerevisiae belongs to the large superfamily of aldose-1-epimerases. Its active site is very similar to the catalytic site of galactose mutarotase, the best studied member of the superfamily. It also contains the conserved glutamate and histidine residues that have been shown in galactose mutarotase to be critical for catalysis, the glutamate serving as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. In addition Ymr099c contains 2 conserved arginine residues which are involved in phosphate binding, and exhibits hexose-6-phosphate mutarotase activity on glucose-6-P, galactose-6-P and mannose-6-P.	5.20282e-88
NZ_CP024085.1\|WP_099453037.1\|1157278_1157872_-\|biliverdin-producing-heme-oxygenase	gnl\|CDD\|225770	COG3230, HemO, Heme oxygenase [Inorganic ion transport and metabolism].	1.42832e-45
NZ_CP024085.1\|WP_099453038.1\|1158046_1160635_-\|TonB-dependent-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	3.78194e-154
NZ_CP024085.1\|WP_099453047.1\|1173577_1174921_+\|porin	gnl\|CDD\|226185	COG3659, OprB, Carbohydrate-selective porin [Cell envelope biogenesis, outer membrane].	2.78584e-174
NZ_CP024085.1\|WP_027595652.1\|1153542_1154970_-\|arginine-ornithine-antiporter	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	0
NZ_CP024085.1\|WP_099453036.1\|1156810_1157224_-\|YbaN-family-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	2.04384e-40
NZ_CP024085.1\|WP_099453040.1\|1163843_1165670_+\|phosphogluconate-dehydratase	gnl\|CDD\|181628	PRK09054, PRK09054, phosphogluconate dehydratase; Validated.	0
NZ_CP024085.1\|WP_099453044.1\|1169155_1170442_+\|carbohydrate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224567	COG1653, UgpB, ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism].	2.48488e-33
NZ_CP024085.1\|WP_027595658.1\|1161839_1162352_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	8.26367e-25
NZ_CP024085.1\|WP_099453039.1\|1160785_1161748_-\|FecR-domain-containing-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	6.36789e-50
NZ_CP024085.1\|WP_027595659.1\|1162578_1163580_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	1.71768e-175
NZ_CP024085.1\|WP_099453046.1\|1172381_1173536_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	gnl\|CDD\|236947	PRK11650, ugpC, sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC.	8.14384e-177

>NZ_CP024085.1|WP_099453040.1|1163843_1165670_+|phosphogluconate-dehydratase
MHPRILEVTQRLVERSRATRERYLQLIRGAASDGPMRASLQCANFAHGVAGCGAQDKQSLRLMNAANVAIVSAYNDMLSAHQPYQHFPEQIKHALREVGSVGQFAGGVPAMCDGVTQGEPGMELAIASREVIAMSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMLSGISNKQKADVRQRYAEGKASREELLESEMNSYHSPGTCTFYGTANTNQLVMEVMGLHLPGASFVNPYTPLRDALTAEAAQQVTRMTKASGCFMPLGEIVDEKALVNSIVALHATGGSTNHTLHMPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMAFLIRELLDAGLLHEDVNTVAGHGLRRYTQEPFLDNGKLVWREGPTQSLDESILRPVARPFSAEGGLRVMEGNLGRGVMKVSAVAPEHQVVEAPARIFHDQQSLADAFKAGELERDFVAVVRFQGPRCNGMPELHKLTPFLGVLQDRGYKVALVTDGRMSGASGKIPAAIHVCPEAYDGGPLARVREGDIVRVDGVAGTLQVKVSAEELASRDLPPAPQGNDLGCGRELFGFMRMAFSPAEQGASAFTSALENLK
>NZ_CP024085.1|WP_027595659.1|1162578_1163580_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MTLRIAINGFGRIGRNVLRALYTQGYRQDLQVVAINDLGDSAMNAHLLKYDSVHGTFDASVEADHESLTVNGDRIAVSAIRNPAELPWKAEAIDVVFECTGLFTERAKAAAHLAAGAGKVIVSAPAKGADATVVYGVNHDVLRASHQIISNASCTTNCLAPIAQVLHREFGIEQGLMTTIHAYTNDQVLTDVYHSDPYRARSATQSMIPSKTGAAEAVGLVLPELAGKLTGMAVRVPVINVSLVDLTVNLKREASADEVNQLFLEASRHSRVLGYNALPLVSCDFNHNPLSSIFDANHTRANGRMLKVLAWYDNEWGFSNRMLDNCLALCSAQ
>NZ_CP024085.1|WP_027595658.1|1161839_1162352_-|sigma-70-family-RNA-polymerase-sigma-factor
MSQSRFNSVFLVQRLTLLRTLQRMVGNPSTAEDLLQETYLRVSRALSERPIEHIEPFVFQTARNLALDHLRARRVQARMLVDDVPDEVLHSIAAPASSSEDAAHAEQLLEHLSVSLNQLSERQQRIFILSRLHGATYLEIAEQLNVSASTVQKELKLIMAICMGVADRLK
>NZ_CP024085.1|WP_099453039.1|1160785_1161748_-|FecR-domain-containing-protein
MTDHPAPRPTPAGLNARARARDEALDWLVRLQCADAQDTQAFEAWLSAAPENAEAYVEAEALWNGMPLHQAAVQLHQGQRRSLRGRLRSHWKPLATAAVLLVGLFTLGNLPMRLQADHLTVVGERQRLQLDDGAKVLLNTNSAFASDLREGRQVARLLQGEAYFQVPEGGQVPLEVQAGPLRAQVRDTDFAVRYLDGEAQVRVQRGDVDLQAASDQRIRLSAGDSISVGPQGFGQRQRADMQKDLAWVDGRLVFENCPLSQVLAEVRRYYPGWIINRNAGLEDVAVTGNYRLDQPLETLRALAHITSARLHEYPAVVILN
>NZ_CP024085.1|WP_099453038.1|1158046_1160635_-|TonB-dependent-receptor
MSTGPTRPSTLSRRTGQLSLLSLALLACGACSLPALAAEPAQASSPRMGDYRFSIGQQPLVSAINAFSQVTGWQVGFSAELADNVASPGVQGALPPEAALKHLLKGTGLGYRKISNGNVVLERQTTGNVIALQQVTVSATRSAQDVSQVPSTVSVQNREQLDRQNVNNIQDLVRYEPGVSVAGTGQRSGLNGYNIRGIDGERILTQIDGVSIPDSFFYGPYAQTQRNYVDPEIVKRVEILRGPASVLYGSNAIGGAVSYFTLDPDDIIKPGKDVGARLKTGYSSADESWLTSATVAGRQGDVDGLLHLSQRNGHETESYGGHSGDGLARTEANPQDARTTNVLAKLGWNYADDARLGFTYERYKDDRDQNILSAVGGPFIGGTTAMGFYKARNGNDTITRERFGINHEFGLDSRVADHMKWSLNYQIAKTDQHTEEVYAPPGRQVLRTRDTTYKDRQWVFDAQLDKAFSIGATDHLLTYGTTLKHEKVTGSRSGTGTCLAVGSGCSAAGADRPADGHALVSDFPDPTVNTYSLFVQDEIRWNNWTFLPGARYDYTHMEPKFTDAFLRGLESTGTAPTSQDDSDKKWHRVSPKFGLTYAFNDNYTWYGQYAEGFRTPTAKSMYGRFQNLEQGYRVEGNPGLEPEKSKSYETGLRGNFDAGNFDVAVYYNKYRDFIDEDAVQSANLEQTFQANNIKHATIKGAEVKGRLNLDHFGAPQGLYTQGSIAYTYGRNDDTGQPLNTVNPLKGVFGLGYEQQNYGGLLSWTLVKRKTRVDDTHFYAPDGSSSKFRTPGYGVLDLTGFYKVTDDVTINAGLYNLADKKYWQWDSVRSYDGQGEAAVTQPANMDRLTMPGRNFGINVVWDI
>NZ_CP024085.1|WP_099453037.1|1157278_1157872_-|biliverdin-producing-heme-oxygenase
MTERPALRSQRLNQITHAPHAELDALVKSHAPFDSRESFARFVVAQYLFQSELKALYTDPQLIAIVPDLAERCRAEQARLDLADLDTEVPGPVPGAVQNPSLGEAMGWIFVSEGSKLGAAFLIKRAVALELSDSFGARHLGEPAGGRAEGWKQFTRILDGLALSADEEAAAERGAIAAFERFTELLKHAYAADAALV
>NZ_CP024085.1|WP_099453036.1|1156810_1157224_-|YbaN-family-protein
MTRPARSKIARLLYGILAYVSLGIGLVAIVIPGLPTTEFILLAAWAATRSSPRLSAWLENHRLFGPILFNWRNGKVIQRRAKVSATLSMLLCAGLMLTFLDHHWPVFLAIGGMTLGNLWIWSRPEQACPTGSQAQQP
>NZ_CP024085.1|WP_099453035.1|1155403_1156831_+|arginine-ornithine-antiporter
MSEPGQKLRLGALIALVVGSMIGGGIFSLPQNMAARADVGAVLIGWGITAVGMLALAFVFQTLANRKPELDSGVYAYAKAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGFYFPVFGEGNTPIAIGCASLLLWAVHFLVLRGIKEAAFINQVTTVAKVVPLLIFIVIAAFAFRADIFTRDIWGLSNPQFGNVLDQVRNMMLVTVFVFIGIEGASVYSGRAQRRSDVGKATVIGFLGVLALLVLVNVLSLGVMTQPELAGLQNPSLASVLEHIVGPWGALLISIGLAISLLGALLSWALLCAEILFATARDKTMPRFLAKENANHVPANALWLTNCMIQGFLLITLFSAGTYTSLIYLASSMILVPYLWSAAYAVLLAVRADTYAGQAALRRKDLLVALVALLYAVWLLYAGGLKYLLLSALLYAPGVILFARAKHEQGQTLFTTWEKLIFAAVLAGAALAAYALYSGLLSL
>NZ_CP024085.1|WP_027595652.1|1153542_1154970_-|arginine-ornithine-antiporter
MSDSSGKLKLGALVALVVGSMIGGGIFSLPQNMAASAGVGAVLIGWAITAVGMLTLAFVFQTLANRKPDLDGGVYAYAKAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPIFGEGNTPAAIIGASILLWAVHFLVLRGIKEAAFINLVTTVAKIVPLVLFALICLFAFKLDVFTADIWGLGTPELGSVMNQVRNMMLVTVWVFIGIEGASIFSSRAEKRADVGKATVIGFVTVLLFLVLVNVLSLGIMTQPELAKLQNPSMAAVLEHVVGHWGAVLISVGLIISLLGALLSWVLLCAEIMFAAAKDHTMPEFLRRENANQVPANALWLTNAMVQIFLVITLFSSSTYLSLIYLATSMILVPYLWSAAYAFLLALRSETYEQALAERKKDLFIGAVALLYAIWLLYAGGVKYLLLSALLYAPGAILFAKAKREVGQPIFTNVEKLIFAAVVVGALVAAYGLYDGFLTL
>NZ_CP024085.1|WP_019471749.1|1152247_1153510_-|arginine-deiminase
MSAEKQKYGVHSEAGKLRKVMVCSPGLAHKRLTPSNCDELLFDDVIWVDQAKRDHFDFVTKMRERGVDVLEMHNLLTDIVQQPEALKWILDRKITSDTVGVGLTNEVRSWLEGLEPRHLAEFLIGGVAGQDLPVSEGAEVIKMYNKYLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPMYWPARRQETLLTTAIYKFHKEFTGADFQVWYGDPDKDHGNATLEGGDVMPVGKGIVLIGMGERTSRHAIGQLAQNLFEKGAAEKVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVKEIKPFIITPDSSKPYGMNIAPQDASFLEVVSEQLLGKKDKLRVVETGGNSFAAEREQWDDGNNVVAIEPGVVIGYDRNTYTNTLLRKAGIEVITISAGELGRGRGGGHCMTCPIVRDPIDY
>NZ_CP024085.1|WP_099453042.1|1166849_1167575_+|response-regulator-transcription-factor
MSTAGKSILMVDDDQEIRELLQTYLSRSGFQVHAEADGRGFRQALESMPCDLVILDVMLPDEDGFSLCRWVRQHPRQARVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIKALLRRAEFGQAAPSSAVLAFDDWRLDTVSHRLFHRDGEEVILSGADFALLKLFLDHPQQILDRDTIGNATRGREPMPLDRIVDMAVSRLRQRLRDTEKPPRLIRTVRGSGYLLAAHVCCAA
>NZ_CP024085.1|WP_099453043.1|1167555_1169010_+|HAMP-domain-containing-protein
MSAALPERRWRLLPRSLLGRMLLLTLLVVLLAQGLSSVIWVAQLRASQLQGLRASASSLAHSMSASVSYFRSLPVAYRPMVLDQLRSMGGTRFFVSLNDKPLDMPVLPVTPRKQAVIEVFQQVLHERLGPQMEASVAFVAPDDLRIFNSGLKLDELPRSWAHYSLTLEPLNPPVLVTQIRLGEGEWLYIASLLPEPYTGLEAERLPRQQIGFIVLTTALLLLFIGLLVHWQSWPLKRLARAARELSLGADVAPVAEGGGSEVVEVGRAFNSMRERISRYLTERSQLFSAISHDLRTPITRLRLRVELLEDERLQAKFSQDLDELELLVKGALQCVKDTDIHENIEPVDLNQVLDILAEPYLGDGRITVEGQALAPYPGKPLALRRCIGNLIDNAIKYGERARLRVIDSAEGFVLQVDDHGPGVPQQQMEQVFEPHFRLAGQQQGYGLGLGIARNIAHSHGGEVSLLNLREGGLRVTLYLPRGLE
>NZ_CP024085.1|WP_099453044.1|1169155_1170442_+|carbohydrate-ABC-transporter-substrate-binding-protein
MNSTLRLAAAISLASLFPLSALAADAKGNVEVVHWWTSGGEKAAVDVLKAQVEKDGFTWKDGAVAGGGGATAMTVLKSRAVAGNPPAVAQIKGPDIQDWAATGLLDSDVLKDVAKNEKWDSLLDQKVANVVKYEDDYVAVPVNIHRTNWLWINPEVFKKAGIEKAPATLDEFYAAADKLKAAGFIPLAHGGQPWQDSTVFESVALSVMGVEGYKKAMVDLDNATLTGPDMIKALTELKKIATYMDPDGKGQDWNLEANKVINGKAGMQIMGDWAKSEWTLANKVAGKDYQCVPFPGTSNGFLYNIDSLVVFKQKDAGTAAGQQDIARKVLGTDFQKVFSTNKGSIPVRNDMLADMGTYGFDACAQTSAKDFLADSKTGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPADAAKKLAAAIKAAQ
>NZ_CP024085.1|WP_027595665.1|1170631_1171540_+|sugar-ABC-transporter-permease
MTTTTAQLRASPLDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPTYKWAGLAQYARLFDNDRWWVASKNLLLFGGLFIAISLAIGVLLAVLLDQRIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQSIIRAAQMDGASLPRIYWTVVLPSLRPVFFSALMILSHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAILVPYLYSELRSKRHA
>NZ_CP024085.1|WP_099453045.1|1171532_1172378_+|carbohydrate-ABC-transporter-permease
MHSPADKPTLSLGRLAIHAVLLLAVVLYLVPLVVMLLTSFKTPEDISTGNLLSWPTVVSGIGWVKAWGTVSGYFWNSILITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFLPFQAVLLPASFTLGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDGAGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG
>NZ_CP024085.1|WP_099453046.1|1172381_1173536_+|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC
MATLELRNVNKTYGSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEHISGGAILIDDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQAAIDEEVARVAKLLQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFIGSPPMNFIPARLARQEGRLLALLDSGQARCELPLGLASDDLDGREIILGIRPEQIALGAGEGNGLPGIRADVQVTEPTGPDLLVFVTLNQTKVCCRLAPDVACRVGDSLNLQFDPARVLLFDAASGERLDVSTANASVKDNVTHFKSR
>NZ_CP024085.1|WP_099453047.1|1173577_1174921_+|porin
MEQRNRIKTLGSLALLAVVGSSGAQAAEAFSSESKWMTGDWGGTRTELLEKGYDFTLDYVGEVAGNLNGGYNDDKTARYSDQFALGAHLDLQKILGWHDAEFKLAITERSGRNLSNDRISDPRAGQFSSVQEVWGRGQTWRLTQMWVKQKYFDGALDVKFGRFGEGEDFNSFPCDFQNLAFCGSQVGNWVGGIWYNWPVSQWALRVKYNITPEFFVQVGAFEQNPSNLETGNGFKLSGSGTKGAILPVEAVWSPKVNGLPGEYRLGYYYSTAKADDVYDDVNGNPQALTGAAFKSHSSKHGWWVVAQQQVTAHGGDVNRGLSLFANFTVHDKATNVVDNYQQVGLVYKGAFDARPKDDIGFGVARIHVNDDVKKRAELLNGQSGINDYDNPGFVPLQRTEYNAELYYGFHVTNWLTVRPNLQYIKSPGGVDEVDNALVAGLKIQSSF
>NZ_CP024085.1|WP_099453048.1|1175038_1175893_+|D-hexose-6-phosphate-mutarotase
MPEHPLHRFFSSQRPRPTFEWERYQQRDVLIIDHPRCQAVFSRQGAQLLHFQPAGERPWLWCAEQWPQVGAIRGGVPVCWPWYGRHPSEDLWPAHGWARLLDWKLVDSREDDEGVTLKWRLDLCDWQVDLHARLGSRMELSLSTEHQDSEPCQLSHALLAYWRISDVSEIALSGLEDIEGYDRLNRQACREDGALKLKGGCQKVYPGTPRVQLQDPAWQRELCIDTGDSDDTVVWHPGNRPLMGVSGRECLGFVCVEAASGSGEGMRLAPGQRAHLRLQAHRLS
>NZ_CP024085.1|WP_172960401.1|1175885_1176749_-|MurR/RpiR-family-transcriptional-regulator
MRNLLEQIQGRLDELNKAERKVAEVILLNPQQATRFSIAALAQAAKVSEPTVNRFCRSFGVSGYPELKLQLAQSLASGAAYVSRAVEADDDPAAYTQKIFGSAIASLDSACQQLDPQQVSRAVDMMIQARQIHFFGLGASAPVALDAQHKFFRFNLAVSAHADVLMQRMLASVAHTGDLFVIISYTGRTRELVEVARVARENGASVLGLTAAGSPLAQACSLSLHIPLPEDTDIYMPMTSRIIQLTVLDVLATGMTLRRGVDFQPHLRKIKESLNASRYPIEDDELN
>NZ_CP024085.1|WP_099453049.1|1176960_1178430_+|glucose-6-phosphate-dehydrogenase
MAAISVEPCTFALFGALGDLALRKLFPALYQLDRADLLHPDTRVLALARESGSAQEHLNTIEAHLRRHVPDADLEPATLGRFLGRLSYQHLDFLQPEGYQALAEQLPGELPLIAYFATAAAVYGAICENLDRAGLASRTRVVLEKPIGHDLESSRRVNDAVARFFPENRVYRIDHYLGKETVQNLIALRFANSLFETQWNQNSISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQLLCLIAMDPPSELSADSIRDEKVKVLKALAPITGEGLSTRVVRGQYIAGYSDGKPVPGYLEEDNANAQSDTETFVALRADIRNWRWSGVPFYLRTGKRMPQKLSQIVIHFKETPHYIFAPEQRLQVGNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDAWRSARIPDAYERLLLEVMRGNQNLFVRKDEIEYAWKWCDQLIAGWQSAGDAPKPYAAGSWGPMSSIALITRDGRAWYGDI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024085_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024085_3

2412378-2412525

Orphan

Consensus_repeat	Method
TTGTCGGCAGACAGGGTGAAGGCAGCCAGGTGCTTGCCTTGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024085_3

>merge|NZ_CP024085|3|2412378-2412525|CRISPRCasFinder
TTGTCGGCAGACAGGGTGAAGGCAGCCAGGTGCTTGCCTTGGGCATGGAGGTAGGGCGGCGCTCGATCTGATAGGCGCTGAAAATGCCGAGCCAGGCCCCTGGTTTGTCGGCAGACAGGGTGAAGGCGGCCAGGTGCTTGCCTTGGGC

>NZ_CP024085|3|3|2412378-2412525|CRISPRCasFinder
TTGTCGGCAGACAGGGTGAAGGCAGCCAGGTGCTTGCCTTGGGC	ATGGAGGTAGGGCGGCGCTCGATCTGATAGGCGCTGAAAATGCCGAGCCAGGCCCCTGGT
TTGTCGGCAGACAGGGTGAAGGCGGCCAGGTGCTTGCCTTGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024085.1\|WP_099453739.1\|2408728_2409601_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176136
NZ_CP024085.1\|WP_099453736.1\|2404710_2405745_+\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212525
NZ_CP024085.1\|WP_099453734.1\|2403141_2404053_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176168
NZ_CP024085.1\|WP_099453738.1\|2407209_2408541_-\|D-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|235096
NZ_CP024085.1\|WP_099453747.1\|2422369_2422732_+\|IacB-protein	unknown	unknown	unknown
NZ_CP024085.1\|WP_099455823.1\|2419745_2420663_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_CP024085.1\|WP_099453743.1\|2415435_2416680_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP024085.1\|WP_027593654.1\|2409736_2410858_+\|muconate-cycloisomerase-family-protein	unknown	unknown	gnl\|CDD\|239434
NZ_CP024085.1\|WP_099453737.1\|2405815_2407213_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236830
NZ_CP024085.1\|WP_099453745.1\|2422747_2424022_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|176888
NZ_CP024085.1\|WP_099430888.1\|2414105_2415365_-\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP024085.1\|WP_099453740.1\|2410890_2411181_+\|muconolactone-Delta-isomerase	unknown	unknown	gnl\|CDD\|213786
NZ_CP024085.1\|WP_099453742.1\|2412652_2414011_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340886
NZ_CP024085.1\|WP_099453741.1\|2411224_2412160_+\|catechol-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|274134
NZ_CP024085.1\|WP_027593647.1\|2417764_2418241_-\|aromatic-ring-hydroxylating-dioxygenase	unknown	unknown	gnl\|CDD\|238357
NZ_CP024085.1\|WP_099453744.1\|2416794_2417754_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|99782
NZ_CP024085.1\|WP_099453735.1\|2404104_2404587_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP024085.1\|WP_099453745.1\|2418255_2419530_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|176888
NZ_CP024085.1\|WP_099453733.1\|2401952_2403044_-\|tartrate-dehydrogenase	unknown	unknown	gnl\|CDD\|273963
NZ_CP024085.1\|WP_099453746.1\|2421182_2422352_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173848

Protein	Function_ID	Function_description	E-value
NZ_CP024085.1\|WP_099453739.1\|2408728_2409601_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176136	cd08445, PBP2_BenM_CatM_CatR, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes of the ortho-pathway required for benzoate catabolism: muconate lactonizing enzyme I, muconolactone isomerase, and catechol 1,2-dioxygenase. CatR normally responds to benzoate and cis,cis-muconate, an inducer molecule, to activate transcription of the catBCA operon, whose gene products convert benzoate to catechol. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.73529e-104
NZ_CP024085.1\|WP_099453736.1\|2404710_2405745_+\|histone-deacetylase-family-protein	gnl\|CDD\|212525	cd10001, HDAC_classII_APAH, Histone deacetylase class IIa. This subfamily includes bacterial acetylpolyamine amidohydrolase (APAH) as well as other Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Mycoplana ramosa APAH exhibits broad substrate specificity and catalyzes the deacetylation of polyamines such as putrescine, spermidine, and spermine by cleavage of a non-peptide amide bond.	1.21056e-150
NZ_CP024085.1\|WP_099453734.1\|2403141_2404053_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176168	cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.50421e-102
NZ_CP024085.1\|WP_099453738.1\|2407209_2408541_-\|D-serine-ammonia-lyase	gnl\|CDD\|235096	PRK02991, PRK02991, D-serine dehydratase; Provisional.	0
NZ_CP024085.1\|WP_099455823.1\|2419745_2420663_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.76468e-26
NZ_CP024085.1\|WP_099453743.1\|2415435_2416680_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	3.0356e-141
NZ_CP024085.1\|WP_027593654.1\|2409736_2410858_+\|muconate-cycloisomerase-family-protein	gnl\|CDD\|239434	cd03318, MLE, Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway. This pathway is used in soil microbes to breakdown lignin-derived aromatics, catechol and protocatechuate, to citric acid cycle intermediates. Some bacterial species are also capable of dehalogenating chloroaromatic compounds by the action of chloromuconate lactonizing enzymes (Cl-MLEs). MLEs are members of the enolase superfamily characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and that is stabilized by coordination to the essential Mg2+ ion.	0
NZ_CP024085.1\|WP_099453737.1\|2405815_2407213_+\|amino-acid-permease	gnl\|CDD\|236830	PRK11049, PRK11049, D-alanine/D-serine/glycine permease; Provisional.	0
NZ_CP024085.1\|WP_099453745.1\|2422747_2424022_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|176888	cd08879, RHO_alpha_C_AntDO-like, C-terminal catalytic domain of the oxygenase alpha subunit of Pseudomonas resinovorans strain CA10 anthranilate 1,2-dioxygenase and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of anthranilate 1,2-dioxygenase (AntDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents from the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and the C-terminal catalytic domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Oxygenases belonging to this subgroup include the alpha subunits of AntDO, aniline dioxygenase, Acinetobacter calcoaceticus benzoate 1,2-dioxygenase, 2-halobenzoate 1,2-dioxygenase from Pseudomonas cepacia 2CBS, 2,4,5-trichlorophenoxyacetic acid oxygenase from Pseudomonas cepacia AC1100, 2,4-dichlorophenoxyacetic acid oxygenase from Bradyrhizobium sp. strain HW13, p-cumate 2,3-dioxygenase, 2-halobenzoate 1,2-dioxygenase form Pseudomonas cepacia 2CBS, and Pseudomonas putida IacC, which may be involved in the catabolism of the plant hormone indole 3-acetic acid. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	1.00815e-90
NZ_CP024085.1\|WP_099430888.1\|2414105_2415365_-\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.14023e-163
NZ_CP024085.1\|WP_099453740.1\|2410890_2411181_+\|muconolactone-Delta-isomerase	gnl\|CDD\|213786	TIGR03221, muco_delta, muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol. [Energy metabolism, Other].	2.39118e-53
NZ_CP024085.1\|WP_099453742.1\|2412652_2414011_-\|MFS-transporter	gnl\|CDD\|340886	cd17328, MFS_spinster_like, Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters. The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.16808e-71
NZ_CP024085.1\|WP_099453741.1\|2411224_2412160_+\|catechol-1,2-dioxygenase	gnl\|CDD\|274134	TIGR02439, Catechol_12-dioxygenase_1, catechol 1,2-dioxygenase, proteobacterial. Members of this family known so far are catechol 1,2-dioxygenases of the Proteobacteria. They are distinct from catechol 1,2-dioxygenases and chlorocatechol 1,2-dioxygenases of the Actinobacteria, which are quite similar to each other and resolved by separate models. This enzyme catalyzes intradiol cleavage in which catechol + O2 becomes cis,cis-muconate. Catechol is an intermediate in the catabolism of many different aromatic compounds, as is the alternative intermediate protocatechuate. In Acinetobacter lwoffii, two isozymes are present with abilities, differing somewhat, to act on catechol analogs 3-methylcatechol, 4-methylcatechol, 4-methoxycatechol, and 4-chlorocatechol. [Energy metabolism, Other].	0
NZ_CP024085.1\|WP_027593647.1\|2417764_2418241_-\|aromatic-ring-hydroxylating-dioxygenase	gnl\|CDD\|238357	cd00667, ring_hydroxylating_dioxygenases_beta, Ring hydroxylating dioxygenase beta subunit. This subunit has a similar structure to NTF-2, Ketosteroid isomerase and scytalone dehydratase.The degradation of aromatic compounds by aerobic bacteria frequently begins with the dihydroxylation of the substrate by nonheme iron-containing dioxygenases. These enzymes consist of two or three soluble proteins that interact to form an electron-transport chain that transfers electrons from reduced nucleotides (NADH) via flavin and [2Fe-2S] redox centers to a terminal dioxygenase. Aromatic-ring-hydroxylating dioxygenases oxidize aromatic hydrocarbons and related compounds to cis-arene diols. These enzymes utilize a mononuclear non-heme iron center to catalyze the addition of dioxygen to their respective substrates. The active site of these enzymes however is in the alpha sub-unit. No functional role has been attributed to the beta sub-unit except for a structural role.	1.28986e-28
NZ_CP024085.1\|WP_099453744.1\|2416794_2417754_-\|oxidoreductase	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	1.90996e-101
NZ_CP024085.1\|WP_099453735.1\|2404104_2404587_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	4.5652e-42
NZ_CP024085.1\|WP_099453745.1\|2418255_2419530_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|176888	cd08879, RHO_alpha_C_AntDO-like, C-terminal catalytic domain of the oxygenase alpha subunit of Pseudomonas resinovorans strain CA10 anthranilate 1,2-dioxygenase and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of anthranilate 1,2-dioxygenase (AntDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents from the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and the C-terminal catalytic domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Oxygenases belonging to this subgroup include the alpha subunits of AntDO, aniline dioxygenase, Acinetobacter calcoaceticus benzoate 1,2-dioxygenase, 2-halobenzoate 1,2-dioxygenase from Pseudomonas cepacia 2CBS, 2,4,5-trichlorophenoxyacetic acid oxygenase from Pseudomonas cepacia AC1100, 2,4-dichlorophenoxyacetic acid oxygenase from Bradyrhizobium sp. strain HW13, p-cumate 2,3-dioxygenase, 2-halobenzoate 1,2-dioxygenase form Pseudomonas cepacia 2CBS, and Pseudomonas putida IacC, which may be involved in the catabolism of the plant hormone indole 3-acetic acid. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	1.00815e-90
NZ_CP024085.1\|WP_099453733.1\|2401952_2403044_-\|tartrate-dehydrogenase	gnl\|CDD\|273963	TIGR02089, Probable_tartrate_dehydrogenase/decarboxylase, tartrate dehydrogenase. Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate. These enzymes are closely related to the 3-isopropylmalate and isohomocitrate dehydrogenases found in TIGR00169 and TIGR02088, respectively. [Energy metabolism, Other].	0
NZ_CP024085.1\|WP_099453746.1\|2421182_2422352_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173848	cd01159, NcnH, Naphthocyclinone hydroxylase. Naphthocyclinone is an aromatic polyketide and an antibiotic, which is active against Gram-positive bacteria. Polyketides are secondary metabolites, which have important biological functions such as antitumor, immunosupressive or antibiotic activities. NcnH is a hydroxylase involved in the biosynthesis of naphthocyclinone and possibly other polyketides.	1.24074e-98

>NZ_CP024085.1|WP_099453741.1|2411224_2412160_+|catechol-1,2-dioxygenase
MTVKISHTAEIQSFFEEVAGLGHAEGNPRFKQIILRVLQDTARLIEDLEVSEDEFWHAVDYLNRLGGRNEAGLLAAGLGIEHFIDLLQDAKDAEAGLTGGTPRTIEGPLYVAGAPLSQGEARMDDGTDPGVVMFLQGQVFGADGKPLAGATVDLWHANTQGTYSYFDSTQSEYNLRRRIITDAEGRYRARSIVPSGYGCDPQGPTQECLDLLGRHGQRPAHVHFFISAPGHRHLTTQINFAGDQYLWDDFAYATRDGLIGDLRFVEDAAAAHDRGVQGERFAELAFDFTLQAAQAPEAETRSHRPRALQDG
>NZ_CP024085.1|WP_099453740.1|2410890_2411181_+|muconolactone-Delta-isomerase
MLFHVKMTVKLPVDMDPAKAAKLKADEKELAQRLQHEGTWRHLWRIAGHYANYSVFDVASVEALHDTLMQLPLFPYMEIEVDGLCRHPSSIHSDDR
>NZ_CP024085.1|WP_027593654.1|2409736_2410858_+|muconate-cycloisomerase-family-protein
MTNTLIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLPADNINAAMLKLDKLAKGNTFAKSGLESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEAQHMLEIRRHRVFKLKIGANPVEQDLKHVVAIKRELGDSASVRVDVNQYWDESQALRACQVLGDNGIDLIEQPISRINRGGQVRLNQRSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYHDFQLHIPRTPGLGLTLDEQRLARFARR
>NZ_CP024085.1|WP_099453739.1|2408728_2409601_-|LysR-family-transcriptional-regulator
MELRHLRYFKVLAETLNFTRAAELLHIAQPPLSRQISQLEEQLGTLLVLRERPLRLTEAGRFFYEQTCTLLQQLENISDNTRRIGHGQRQWLGIGFAPSTLYTVLPALIRELRQDSELELGLSEMTTLQQVEALKSGRIDIAFGRIRIDDPAILQQVLCEDPLVAVLPKGHPLAGTSLTLAQLAKEPFILYPANPRPSYADHVLALFAHHGMTLKISQWANELQTAIGLVAVGLGVTLVPASVQQQHRTDIEYVSLLDTSAVSPIILSRRKGDVSPIVQRCLALIAQQAT
>NZ_CP024085.1|WP_099453738.1|2407209_2408541_-|D-serine-ammonia-lyase
MIHGKSLDAWYASHPRVEDLVALRETCWFNPGIVPTAQALGDVGLTAADVNAASARLQRFAPYLAEVFPDTAASGGIIESPIRPLPALQHTLLQEAGLAQGGALWLKADSELPISGSIKARGGIHEVLKHAEDLALAAGLITLGSDYRVLASDDARQFFSQYKVAVGSTGNLGLSIGIMSARLGFQATVHMSSDARQWKKDKLRANGVSVIEYPSDYSVAVARGRQQAAADPTCYFVDDENSPDLFLGYAVAAERLQGQFKAAGIKVDAEHPLFVYLPCGVGGGPGGVAFGLKLLFGDHVHCVFAEPTHSPCMLLGVYTGLHDETSVQDFGIDNVTAADGLAVGRPSGFVGKAMQRLLDGYYTVTDERLYQLLVLAHDLERVRLEPSALAGMPGMVQVLQATQYLARMGLTAQRMANATHLVWGTGGSMVPDDEYAAYLAKGR
>NZ_CP024085.1|WP_099453737.1|2405815_2407213_+|amino-acid-permease
MQDMSASLDQSKPTDSAQDGHLKRTLENRHIQLISIGGAIGTGLFMGSGKVIALSGTSILLVYAILGFFVFFVMRAMGELLLSDLRFKSFADIVAHYLGPRAGFVLSWSYWLSWSVAVVGDVVVVAGFFQYWYADVPAWIPAFFTLFVLLGLNMLAVRIFGEVEFWFGIIKIVAIVTLIITAAVMIATAYVSPNGVVASLSNVVAPGAVLPHGISGFFAGFQIAVFSFAGTELIGTTAAEAKNPHRSLPKAINTIPLRILLFYILALVCIISVVSWAEVPANRSPFVELFLLAGFPAAAGMLNFVVLTSAASSANSGVYSGCRMLFGLAERRNAPAIFARLSALSVPVHSLLFSAMCMLAGLALLFIIPEVMTVFTLISTISAILVIFTWSMILAAYLAYRKHNPAAHQASKFKLPGGVPMAVTSLSFLGFVLVLLALEPDTRMALCVMPLWFVFLLVAYRRRKA
>NZ_CP024085.1|WP_099453736.1|2404710_2405745_+|histone-deacetylase-family-protein
MLTVFSNKHRLHHGSELKDGAITPSFENPQRADTVLARVQSTGLGDVIAEQSFDRACYVAAHSERYVSFLENAWAEWTATGKTHDALPLVWPVRDLAIDREPGFIDGKLGFYAMDAGAPITGGTWKAVRSSANVALTGMQRVIDGAPSAFALCRPPGHHAAREYMGGYCYLNNAAIAAERCLSQGARRVAVLDVDFHHGNGTQNIFYGRPDVFFASIHGDPHVSYPYFSGYAHEQGAGAGEGFNANYPLGKGTLWAQYRLALQDALKRVVAHQPDFLVVSLGVDTFEDDPISHFKLTSEDFLRLGAEIARVGIPTLFVMEGGYMVDEIGINAVNTLQGFEGAVR
>NZ_CP024085.1|WP_099453735.1|2404104_2404587_-|Lrp/AsnC-family-transcriptional-regulator
MSKAFAYEELDEVDRELLRLLQEDGTLSSAALGERLSMTVTPCWRRRKRLEELGLIKDYQANLDRKKLGYDVMAFAQVRFGNHSAEAPDDFEQVILKLPQVLSCHKVTGEADYVLTVLATDLESYGRFVEDVLRRQPGIASIQSSLALREIKAVTRIPVR
>NZ_CP024085.1|WP_099453734.1|2403141_2404053_+|LysR-family-transcriptional-regulator
MNNLPSLDDLNIFLQVAKRASFAAVADELGMSAAYISKRIRVLEQNLEVRLLHRTTRRVTISEEGERVYQWALQIFDAVQRMGDDISAQHREPAGQLRIASSLGLGRRFVAPALSELAERYPRLDIRLDVHDRLVDLIEEGVDLDIRVGNTIAPNLIAKLLAKNRRVLCASPAYLARQGTPKVLADLGSHDCLVIKERDHPFGIWQLEGPQGQESVRVTGGLSSNHGEVAHQWCLDGRGILLRSWWDVHDSLLDGRLVQVLSDYHQPADIWAVYTSPLASSAKVRVAVDFFRQYFAERYSLPD
>NZ_CP024085.1|WP_099453733.1|2401952_2403044_-|tartrate-dehydrogenase
MTKTFRIAAIPGDGIGTEVLPEGIRVVEAAARKHGLAISFEFFEWASCDYYLAHGKMMPDDWFEQLKGFDALYFGAVGWPDKVPDHISLWGSLLKFRRDFDQYVNIRPVRLFPGVPCPLAGRAPGDIDFVVVRENTEGEYSSLGGRMFEGTENEIVLQESVFTRRGVDRILKYAFDVAQTRARKHVTSATKSNGMAVSMPYWDERTAAMAANYPEISWDKQHIDILCARFVLQPDRFDVVVASNLFGDILSDLGPACAGTIGIAPSANLNPERKFPSLFEPVHGSAPDIFGKNIANPIAMIWSGALMLEFLGNDGANPRYRAAHDDILKAIEQVIAAGDTTRDMGGQKSTQEVGRAITALIEA
>NZ_CP024085.1|WP_099453742.1|2412652_2414011_-|MFS-transporter
MNTLTEAQHLKHTQKRYLYEWYVVILCMVAYIFSFVDRQILALMIEPIKADLQLSDTQFSLLHGLAFSLFYAFMGMPIAYLADRFSRPRIIAVGVIFWSFATAACGLSKNFTQMFLARIGVGVGEAALSPSAYSMFSDLFPKEKLGRAVGIYSIGSFVGGGIAFLVGGYVITLLKDAQTIEVAFLGAMKAWQLAFFIVGLPGVIVGLLIWLTVRNPERKGAQLDADGNVRKVKLTDGLRFIGRHRATFSCHYLGFSFYAMALFCMMSWTPALYIRKFGMSPEQAGFMLGTILLLANTTGVVFGGWLTDHLAKRGRSDAAMRTGVIGALGMIVPAVLYSQVDQLWLSVTLLVPAMFFASFPMPASTAAMQILSPNQVRAQVSAVFLLISNLLGLGLGTTLVALITDRYFGVPAAVGSSMSIVSFVASLLAIVLLAKGCKCFRHSMQREHPVAA
>NZ_CP024085.1|WP_099430888.1|2414105_2415365_-|MHS-family-MFS-transporter
MRRIVIASVLGNALEWYDFFLYGTAAALIFAPLFFPAGTDPVLGTMASFAGFAVGFLARPLGGLIFGHIGDKAGRKKALVMTLAIMGAATFAMGLLPTFEQVGYLAPACLVILRVLQGVASGGEWGGGVLLLSENAPKDRVGFYAAWSQLGVSGGFVLSAAAFYLVQMLPVEDMMSWGWRVPFLASILIFGVGVYIRRRLPESKAFVEEQAQQDKPEHMPAMEVLRNHPKAVLQAMGIRIAENGSAYLFLAFTIAYAKFTGLDTQLVLASVMVAMIVEAGTIVFWGWLSDIIGRRVVYAIGSVGLMVLAFPFFWMLDTHSPVWVYLAALLGMAFCHGAMIGTQPALMGELFPAKVRYSGLAMGHEIASIFSGGLAPLAATALFSIYKDAWPVSVMLVVMGAITTLAVISIKPQASADNN
>NZ_CP024085.1|WP_099453743.1|2415435_2416680_-|OprD-family-porin
MELKWPLRAKPFCLCVGAVLPLTCLADVVDDSHLSLNFRNLYLNRNFTNPSAPVSKVGNWSQGFDLQFESGYTDTPVAVGLDLNGQYAVRLDSTGNDGSLPFSKHRQQAADDYSRGGATLKLKYANTKVLIGDQKPFYPVASNDPSRQLDTIYQGAVIESRDIDNLTLVSGRFWSIVTRESSNHERLYRYGTRDDLDSDGLDFAGATYALTPELQASYFHGVLNDIYKQDYGGIKHALKFADGYQLKTDVGYFNNREDGAARSGAVDNRAYFGLVTLEKSGHMLGLSYQRMTGDTVFPTLNGYVPQLWLPNWAGLPFIRPDERSWSVRYGYNFAAMGLPGLKLFTRYIKGTDIDRGPGLARDQESERDIMLSYVIQSGPLKDLAFDLKNMRTQQQYGNDYNEYRLITSYTWKFW
>NZ_CP024085.1|WP_099453744.1|2416794_2417754_-|oxidoreductase
MSEQLLDVIVQAREVQGGDVVVLELAAVDGQALPRFAAGAHVDLHLAPGLVRQYSLCGDPAHANVYRLGVLKDSQSRGGSVAVHEQLQPGTPMRISAPRNLFPLACDATRSILLGGGIGITPMIAMAHALHAQGKPFELHYRGRSRSRCAFVDELLGAPFAASVFTHFSDEGPEQHLDLAQVLGPAMPGVHLYTCGPAGFMDWVIAGARQQGYDDPHIHHEYFQAEVDTSGGSFEVVAARSGKTVQVQEGQPLTAALRSIGIKVEVSCEQGVCGTCLCDVLEGEPDHRDHYLTEEEKHTNEQIVLCCSRARGKRLVLDI
>NZ_CP024085.1|WP_027593647.1|2417764_2418241_-|aromatic-ring-hydroxylating-dioxygenase
MNLQLLQEVTAFIWQEGDMLDHGEYDTWLGQWTEKGTYIIPIDPRESDYENTLNYAYDDHHMRGLRVQRLIGGESISTSPQPRTVRTISRFRVLGDDGVNVTVRCAQNVREFRKESLKHYSADLTYTLVRAQGSFKIHRKVISLINSDDTLAGIGYIL
>NZ_CP024085.1|WP_099453745.1|2418255_2419530_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MSNLIPAVNLTVDPAELVQPDRVHTSLYTDPALFDAELQKIFHSTWVWVAHESEVPEPGSYKTTFIGKQPVIVVRDRKKAINVLLNRCRHRGATVCEHKKGKTNSFVCPYHGWGYALDGSLRGIPHPESYGDCLDKAELPLVSLRVESYAGMVFATFKDDIEPLEDFLGAAKKWMDLFMKQGAGYGIKVPGEHRFRFPGNWKIQLENTTDAYHFPLVHKSFLSSVDEQTLELFDFVKGPGYVEDLGNGHSVMVMIPELVDLEADLDKPIPERFESLAAELRDEGIDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVTETEIHHSVITMDGGPAAANRYRLRLHEHFQGPMGFGTPDDSEAWERVQKGARAGEDLWIMLNRGLPGEKPSADGLVSDVSAETGMRAAYQQWKKMMSA
>NZ_CP024085.1|WP_099455823.1|2419745_2420663_-|LysR-family-transcriptional-regulator
MPTRHIDLQDHRLRYLHLSHDKGSMRAAAEALGVATSSVSRQIARLEEELGIELVRPGTHRISLTAAGEAAVDYYIERIRQHALLVDRLDELRSRQQASTVIAIGEGLLGARAINSLQGFLHAHNAHKAEIISAPSLEVQRMVMDDEAHLGVVFAPNASARLTRLFSLAQPLRMIVHRDSRMAERSTVSLAEVARESLVLPGANFRVRELADAACKDQPFAIVPTLTSNSLAVILDFVRSGLGATLLAELPIIDELKNGTFKALAIDCEAMNATDIQIVTRRGRTLDGMSRELATEMAKAVRMAL
>NZ_CP024085.1|WP_099453746.1|2421182_2422352_+|acyl-CoA-dehydrogenase
MDSLCLRAAPVSALASGPAFEALLDGVRDRARLGEFDRQRYISRDVIDAFKAHGVYRALVPKRFGGLECSPGAFCEMIERISHADGSAGWVASFGMSPVYLAALPLETIAEIYGNSPDTVFAGGIFPPQPAEIVPGGFKVNGRWKYSSGSMGADIVGVGIAPRHGDKLDLPRLAVMPRQQARIDETWDTVGLLGTGSHDLVVEDVVVGEQWTFVRGGKPNLDEPFFRYPSLSFATQVLSVVGLGIARAALDELSGMASGRISVTGAPALADRPLAQVDVAKAEAALRSARAFFYESIERAWEHVLAGDPVPVDVTNLLRLSSTHAARVAAEVARSAQMLSGMTGIYNESPLARCVNDAQVVTQHAFMGDVTYQNAGAMFFGKQPLPGYL
>NZ_CP024085.1|WP_099453747.1|2422369_2422732_+|IacB-protein
MSDKKALRVLFCMGINQNFFDAPREEQLQVWAAFSAMWNGIHDLTGVSVLGNMDDDQGMVGPSDGFPWTTYLLADVPDIETVHAACNLFRTTAVGEGPYKLWRYAKVEARVGRELIIQRA
>NZ_CP024085.1|WP_099453745.1|2422747_2424022_+|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MSNLIPAVNLTVDPAELVQPDRVHTSLYTDPALFDAELQKIFHSTWVWVAHESEVPEPGSYKTTFIGKQPVIVVRDRKKAINVLLNRCRHRGATVCEHKKGKTNSFVCPYHGWGYALDGSLRGIPHPESYGDCLDKAELPLVSLRVESYAGMVFATFKDDIEPLEDFLGAAKKWMDLFMKQGAGYGIKVPGEHRFRFPGNWKIQLENTTDAYHFPLVHKSFLSSVDEQTLELFDFVKGPGYVEDLGNGHSVMVMIPELVDLEADLDKPIPERFESLAAELRDEGIDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVTETEIHHSVITMDGGPAAANRYRLRLHEHFQGPMGFGTPDDSEAWERVQKGARAGEDLWIMLNRGLPGEKPSADGLVSDVSAETGMRAAYQQWKKMMSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

328930 : 391682

Bacillus_virus(25.0%)

integrase,protease,holin

attL 360917:360943|attR 383373:383399

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027595189.1\|328930_329413_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_027595190.1\|329522_329924_+	RNA-binding protein S4	NA	NA	NA	NA
WP_027595191.1\|330008_330803_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_027595192.1\|330921_331821_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_027595193.1\|332000_333542_+	phosphoenolpyruvate carboxykinase	A0A2H4PQN1	Staphylococcus_phage	1.2e-124	46.5
WP_099452625.1\|334008_334449_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_099452626.1\|334504_334984_-	hypothetical protein	NA	NA	NA	NA
WP_099452627.1\|335350_337696_-	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_099452628.1\|337701_338532_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_099452629.1\|338706_339147_+	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	6.7e-07	50.8
WP_027595199.1\|339265_339928_-	GMP/IMP nucleotidase	NA	NA	NA	NA
WP_027595200.1\|339992_340559_+	ADP compounds hydrolase NudE	NA	NA	NA	NA
WP_099452630.1\|340555_341392_+	3'(2'),5'-bisphosphate nucleotidase CysQ	NA	NA	NA	NA
WP_027595202.1\|341542_341998_-	YiiD C-terminal domain-containing protein	NA	NA	NA	NA
WP_027595203.1\|341994_343404_-	sigma-54-dependent Fis family transcriptional regulator	W8CYM9	Bacillus_phage	2.3e-08	27.1
WP_027595204.1\|343400_345215_-	sensor histidine kinase	NA	NA	NA	NA
WP_099452631.1\|345253_346165_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	1.4e-30	35.5
WP_099428081.1\|346110_346656_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.6e-50	53.4
WP_099452632.1\|346652_347528_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.2e-105	65.2
WP_099452633.1\|347524_348607_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.4e-100	53.9
WP_027595209.1\|348873_349980_+	agmatine deiminase	M1HES8	Acanthocystis_turfacea_Chlorella_virus	1.1e-101	49.6
WP_099452634.1\|350175_350373_+	hypothetical protein	NA	NA	NA	NA
WP_099452635.1\|350490_352575_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_027595212.1\|353044_354364_+	OprD family porin	NA	NA	NA	NA
WP_099452636.1\|354483_356145_-	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_099455772.1\|356383_357751_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_099452637.1\|357752_358472_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-29	33.9
WP_099452638.1\|358612_360910_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
360917:360943	attL	NA	NA	NA	NA
WP_099428088.1\|360976_361183_-	DUF3079 domain-containing protein	NA	NA	NA	NA
WP_157767011.1\|361761_363792_-	hypothetical protein	NA	NA	NA	NA
WP_157767012.1\|363986_364859_-	hypothetical protein	NA	NA	NA	NA
WP_099452641.1\|365071_365359_-	hypothetical protein	NA	NA	NA	NA
WP_099455773.1\|365355_366336_-\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_049243851.1\|367265_368585_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	3.7e-69	40.0
WP_099455774.1\|368922_369171_-	hypothetical protein	NA	NA	NA	NA
WP_099452642.1\|369630_369924_+	DUF3077 domain-containing protein	NA	NA	NA	NA
WP_099452643.1\|370160_371372_-	methyltransferase	NA	NA	NA	NA
WP_099452645.1\|371503_372193_-	ABC transporter permease	NA	NA	NA	NA
WP_027594258.1\|372189_372885_-	ABC transporter permease	NA	NA	NA	NA
WP_099428098.1\|372939_373701_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027594260.1\|373714_374488_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.4e-21	32.4
WP_027594261.1\|375105_376491_+	GABA permease	NA	NA	NA	NA
WP_027594262.1\|376697_377141_-	hypothetical protein	NA	NA	NA	NA
WP_172961389.1\|377294_377804_+	hypothetical protein	NA	NA	NA	NA
WP_099452647.1\|377813_378821_-	polyphosphate kinase 2	NA	NA	NA	NA
WP_099452648.1\|379016_379223_+	hypothetical protein	NA	NA	NA	NA
WP_099452649.1\|379550_379823_-	oxidative damage protection protein	NA	NA	NA	NA
WP_099452650.1\|379819_380887_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_099452651.1\|380883_383133_-	AsmA family protein	NA	NA	NA	NA
WP_099452652.1\|383562_385224_+	OFA family MFS transporter	NA	NA	NA	NA
383373:383399	attR	NA	NA	NA	NA
WP_027594270.1\|385486_386080_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_099452653.1\|386080_386719_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_027594272.1\|386719_386980_+	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_016484508.1\|387007_387745_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_099452654.1\|387755_388526_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_027594275.1\|388629_389808_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-25	37.2
WP_172960399.1\|389804_390653_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_099452655.1\|390734_391682_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_2

1099780 : 1107545

Thermobifida_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099452999.1\|1099780_1100635_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.3e-08	31.9
WP_099453000.1\|1100637_1101102_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003255135.1\|1101114_1101423_-	ribosome-associated translation inhibitor RaiA	A0A0K1LP60	Escherichia_phage	4.4e-05	34.1
WP_099453001.1\|1101502_1102996_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_027595607.1\|1103171_1103897_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-23	26.5
WP_027595608.1\|1103897_1104422_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_027595609.1\|1104408_1104981_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_027595610.1\|1104989_1105514_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	8.2e-28	48.9
WP_027595611.1\|1105514_1106489_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	8.9e-36	32.9
WP_099453002.1\|1106735_1107545_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.6e-25	32.5

DBSCAN-SWA_3

2261255 : 2312746

Pseudomonas_phage(42.22%)

capsid,protease,tail,terminase,holin,head,integrase,portal

attL 2254912:2254927|attR 2288139:2288154

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2254912:2254927	attL	NA	NA	NA	NA
WP_099453621.1\|2261255_2262449_-\|integrase	site-specific integrase	J7HXC4	Pseudomonas_phage	1.7e-113	52.0
WP_099453622.1\|2262671_2263169_-	hypothetical protein	A0A1B0VM52	Pseudomonas_phage	9.1e-37	62.4
WP_099453623.1\|2263220_2263532_-	hypothetical protein	NA	NA	NA	NA
WP_099453624.1\|2263575_2263974_-	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	3.3e-13	34.6
WP_099453625.1\|2263970_2264279_-	hypothetical protein	NA	NA	NA	NA
WP_099453626.1\|2264275_2264602_-	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	1.6e-18	50.5
WP_157767031.1\|2264773_2264986_+	hypothetical protein	NA	NA	NA	NA
WP_099453627.1\|2265141_2265441_+	hypothetical protein	NA	NA	NA	NA
WP_157767032.1\|2265533_2265686_-	hypothetical protein	NA	NA	NA	NA
WP_099453628.1\|2265682_2266147_-	hypothetical protein	A0A2H4J7W7	uncultured_Caudovirales_phage	2.1e-11	42.5
WP_157767033.1\|2266206_2266908_-	Lar family restriction alleviation protein	NA	NA	NA	NA
WP_099453630.1\|2266959_2267385_+	hypothetical protein	NA	NA	NA	NA
WP_099453631.1\|2267386_2268262_-	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	9.0e-96	56.2
WP_099453632.1\|2268258_2269038_-	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	3.0e-18	37.1
WP_172961357.1\|2269452_2270061_-	hypothetical protein	NA	NA	NA	NA
WP_028697923.1\|2270156_2270378_+	hypothetical protein	NA	NA	NA	NA
WP_099453634.1\|2270401_2270947_-	hypothetical protein	J9Q748	Salmonella_phage	1.3e-20	36.2
WP_099453635.1\|2271058_2271265_+	hypothetical protein	NA	NA	NA	NA
WP_099453636.1\|2271227_2271602_-	hypothetical protein	NA	NA	NA	NA
WP_099453637.1\|2271683_2272229_-	hypothetical protein	NA	NA	NA	NA
WP_099453638.1\|2272225_2272495_-	hypothetical protein	NA	NA	NA	NA
WP_099453639.1\|2272514_2272898_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	2.1e-25	59.8
WP_099453640.1\|2272904_2273756_-	ParB N-terminal domain-containing protein	A0A0U4JP11	Pseudomonas_phage	4.5e-84	56.8
WP_099453641.1\|2274080_2274386_-	hypothetical protein	NA	NA	NA	NA
WP_099453642.1\|2274840_2275137_+	DUF1364 domain-containing protein	A5VW86	Enterobacteria_phage	5.8e-31	71.9
WP_099453643.1\|2275133_2275562_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	2.1e-45	66.4
WP_099453644.1\|2275558_2276851_+\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	2.0e-115	52.5
WP_099453645.1\|2276847_2277165_+	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	4.8e-23	52.4
WP_099453646.1\|2277176_2277566_+	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	1.3e-43	64.1
WP_099453647.1\|2277939_2278263_+\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	7.7e-29	64.2
WP_099453648.1\|2278266_2278497_+	hypothetical protein	NA	NA	NA	NA
WP_099453649.1\|2278552_2278789_-	hypothetical protein	NA	NA	NA	NA
WP_099453650.1\|2278869_2279211_+	HNH endonuclease	A0A2H4PHY5	Pseudomonas_phage	4.8e-21	57.5
WP_099453651.1\|2279370_2279871_+\|terminase	terminase small subunit	A0A2H4J8R0	uncultured_Caudovirales_phage	3.5e-12	38.5
WP_099453652.1\|2279874_2281554_+\|terminase	terminase large subunit	A0A0P0ZD10	Stx2-converting_phage	4.0e-193	61.5
WP_099453653.1\|2281704_2283003_+\|portal	phage portal protein	H2BDA8	Pseudomonas_virus	4.8e-186	71.7
WP_099453654.1\|2283019_2283877_+\|protease	Clp protease ClpP	A0A1V0E8B8	Vibrio_phage	7.9e-97	63.9
WP_099453655.1\|2283879_2285061_+\|capsid	phage major capsid protein	A0A218MGA4	Pseudomonas_phage	2.3e-123	61.4
WP_099453656.1\|2285650_2285992_+\|head,tail	phage gp6-like head-tail connector protein	C4ML08	Xanthomonas_virus	2.6e-14	40.0
WP_099453657.1\|2285988_2286315_+\|head	phage head closure protein	A0A2H4JC00	uncultured_Caudovirales_phage	2.1e-18	48.2
WP_172961358.1\|2286323_2286494_+	hypothetical protein	A0A2D1GNQ5	Pseudomonas_phage	4.1e-05	48.2
WP_099453658.1\|2286497_2286998_+	HK97 gp10 family phage protein	A0A2D1GNN2	Pseudomonas_phage	2.6e-63	70.9
WP_099453659.1\|2286990_2287377_+	DUF3168 domain-containing protein	A0A2D1GNT4	Pseudomonas_phage	3.4e-55	83.6
WP_099453660.1\|2287432_2287933_+	hypothetical protein	A0A2D1GNF2	Pseudomonas_phage	4.1e-69	76.4
WP_099453661.1\|2287973_2288318_+	hypothetical protein	NA	NA	NA	NA
2288139:2288154	attR	NA	NA	NA	NA
WP_099453662.1\|2288314_2288548_+	hypothetical protein	NA	NA	NA	NA
WP_099453663.1\|2288593_2291881_+\|tail	phage tail tape measure protein	A0A2D1GNQ1	Pseudomonas_phage	3.6e-73	36.8
WP_099453664.1\|2291880_2292219_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	4.9e-26	51.8
WP_099453665.1\|2292215_2292965_+\|tail	phage minor tail protein L	A0A0S2SY57	Pseudomonas_phage	1.6e-122	78.7
WP_099453666.1\|2292967_2293723_+	C40 family peptidase	A0A2H4J1J7	uncultured_Caudovirales_phage	5.0e-119	75.7
WP_099453667.1\|2293909_2294449_-\|protease	retroviral-like aspartic protease	NA	NA	NA	NA
WP_099453668.1\|2294635_2295031_+	hypothetical protein	NA	NA	NA	NA
WP_099453669.1\|2295041_2295386_+	hypothetical protein	A0A1B0VMC6	Pseudomonas_phage	5.5e-17	50.5
WP_099453670.1\|2295441_2296038_+\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	1.6e-67	67.5
WP_099455819.1\|2303737_2305303_+	DUF1983 domain-containing protein	A0A2H4J0B1	uncultured_Caudovirales_phage	2.7e-42	55.3
WP_099453671.1\|2305302_2306358_+	hypothetical protein	A0A2H4JA10	uncultured_Caudovirales_phage	2.2e-141	68.1
WP_099453673.1\|2307258_2307534_+\|tail	tail fiber assembly protein	A0A2H4J9Z7	uncultured_Caudovirales_phage	6.0e-22	61.8
WP_099453674.1\|2307596_2307824_+	hypothetical protein	A0A2H4J658	uncultured_Caudovirales_phage	7.6e-07	41.3
WP_099455820.1\|2307823_2308270_+	structural protein P5	A0A2H4J6R1	uncultured_Caudovirales_phage	2.5e-33	54.2
WP_099453675.1\|2308266_2308785_+	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	1.9e-37	75.0
WP_099453676.1\|2308950_2309745_+	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.4e-103	68.7
WP_099453677.1\|2309822_2310035_+	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	6.6e-13	67.8
WP_099453679.1\|2310232_2310952_-	SOS response-associated peptidase family protein	A0A2H4J991	uncultured_Caudovirales_phage	1.7e-60	51.5
WP_085273408.1\|2311053_2311482_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1L5C2A3	Pseudoalteromonas_phage	2.5e-11	40.9
WP_099453680.1\|2311471_2312746_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	3.0e-108	48.3

DBSCAN-SWA_4

3934274 : 3990180

uncultured_Caudovirales_phage(50.0%)

protease,tail,integrase,lysis,tRNA

attL 3939861:3939875|attR 3943433:3943447

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099454691.1\|3934274_3935069_-	DNA adenine methylase	C7BGE1	Burkholderia_phage	7.6e-102	66.2
WP_099454692.1\|3935220_3935775_-\|lysis	lysis protein	B5TK84	Pseudomonas_phage	3.3e-27	46.7
WP_029615568.1\|3936737_3936944_-\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	7.4e-17	62.7
WP_099454693.1\|3936918_3937797_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.7e-81	54.6
WP_157767043.1\|3937809_3939036_-	hypothetical protein	NA	NA	NA	NA
WP_099454694.1\|3939042_3939507_+	hypothetical protein	NA	NA	NA	NA
WP_157767044.1\|3939771_3939975_-	hypothetical protein	NA	NA	NA	NA
3939861:3939875	attL	NA	NA	NA	NA
WP_099454697.1\|3940230_3940467_+	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	5.8e-26	71.8
WP_099454698.1\|3940470_3941535_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	2.3e-114	59.4
WP_085273210.1\|3941864_3942884_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	5.9e-22	30.4
WP_099454699.1\|3943082_3943796_+	histidine phosphatase family protein	NA	NA	NA	NA
3943433:3943447	attR	NA	NA	NA	NA
WP_085273065.1\|3943850_3944168_+	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_099454700.1\|3944356_3945424_+	phosphotransferase family protein	NA	NA	NA	NA
WP_027592693.1\|3945447_3946215_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.3e-17	30.8
WP_099454701.1\|3946215_3947037_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_099454702.1\|3947069_3947420_-	hypothetical protein	NA	NA	NA	NA
WP_099454703.1\|3947533_3947836_+	RcnB family protein	NA	NA	NA	NA
WP_099454704.1\|3947837_3948998_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.9e-19	35.5
WP_027592698.1\|3949222_3949408_+	hypothetical protein	NA	NA	NA	NA
WP_027592699.1\|3949482_3949869_+	hypothetical protein	NA	NA	NA	NA
WP_099454705.1\|3950009_3951839_+	SLC13 family permease	NA	NA	NA	NA
WP_099454706.1\|3951977_3953402_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.2e-18	32.8
WP_033696804.1\|3953403_3954165_-	TSUP family transporter	NA	NA	NA	NA
WP_099454707.1\|3954263_3955169_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099454708.1\|3955301_3955496_-	hypothetical protein	NA	NA	NA	NA
WP_085273059.1\|3955913_3956267_-	ligand-binding protein SH3	NA	NA	NA	NA
WP_099454709.1\|3956477_3957524_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_099454710.1\|3957859_3958045_+	hypothetical protein	NA	NA	NA	NA
WP_099454712.1\|3958508_3959117_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_085273057.1\|3959171_3959351_+	hypothetical protein	NA	NA	NA	NA
WP_099454713.1\|3959559_3960831_-	OprD family porin	NA	NA	NA	NA
WP_099454714.1\|3961231_3961927_-	hypothetical protein	NA	NA	NA	NA
WP_099454715.1\|3961943_3962837_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_172961371.1\|3962840_3963641_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_099454717.1\|3963646_3964441_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_099454718.1\|3964803_3966234_+	MHS family MFS transporter	NA	NA	NA	NA
WP_099454719.1\|3966394_3967219_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_099454720.1\|3967522_3968521_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_099454721.1\|3968550_3969345_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_099454722.1\|3969426_3970236_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_099454723.1\|3970503_3971292_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003251184.1\|3972244_3972916_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	2.1e-105	91.0
WP_033696754.1\|3973097_3974477_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.3e-27	51.1
WP_099428820.1\|3974594_3974987_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	7.6e-55	81.4
WP_099454724.1\|3974988_3975348_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	3.3e-36	65.0
WP_099454725.1\|3975347_3975644_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.1e-25	61.6
WP_099454726.1\|3975640_3975976_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.8e-44	78.4
WP_099454727.1\|3975972_3976974_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.5e-152	78.4
WP_099454728.1\|3977068_3978031_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_027592727.1\|3978063_3979455_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_085273003.1\|3979455_3980736_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-95	45.5
WP_085273002.1\|3980766_3981141_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.6e-09	43.4
WP_099454729.1\|3981137_3982463_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.2e-80	40.7
WP_027592731.1\|3982475_3983099_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_172961372.1\|3983160_3985572_-	DNA translocase FtsK 4TM domain-containing protein	A0A218M9A2	Mycobacterium_phage	2.1e-86	50.3
WP_099454731.1\|3985975_3986656_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_027592734.1\|3986712_3987420_+	arginyltransferase	NA	NA	NA	NA
WP_002553999.1\|3987522_3987741_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_099454732.1\|3987909_3990180_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.9e-166	43.1

DBSCAN-SWA_5

5438681 : 5445621

uncultured_Caudovirales_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099455908.1\|5438681_5440952_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.0e-82	36.9
WP_099455459.1\|5441066_5441339_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_099455460.1\|5441541_5441820_-	hypothetical protein	NA	NA	NA	NA
WP_099455461.1\|5441875_5442259_-	hypothetical protein	A0A2H4J8C3	uncultured_Caudovirales_phage	8.2e-62	90.6
WP_099455462.1\|5442349_5442796_-	hypothetical protein	A0A2H4J163	uncultured_Caudovirales_phage	1.9e-78	93.9
WP_099455909.1\|5442837_5443203_-	hypothetical protein	A0A2H4J161	uncultured_Caudovirales_phage	8.7e-61	90.9
WP_172961417.1\|5443618_5443948_+	helix-turn-helix domain-containing protein	A0A2H4J450	uncultured_Caudovirales_phage	4.5e-24	59.0
WP_099455463.1\|5444351_5444819_-	3'-5' exoribonuclease	A0A172JI25	Bacillus_phage	2.0e-09	30.8
WP_099455465.1\|5445285_5445621_+	hypothetical protein	A0A2H4J9H6	uncultured_Caudovirales_phage	1.2e-35	78.4

DBSCAN-SWA_6

5454616 : 5463937

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099455472.1\|5454616_5455168_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	7.1e-91	92.3
WP_099455473.1\|5455277_5455460_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_099455474.1\|5455452_5455833_-	hypothetical protein	NA	NA	NA	NA
WP_099455910.1\|5455872_5456796_-	CDF family Co(II)/Ni(II) efflux transporter DmeF	NA	NA	NA	NA
WP_080725266.1\|5456815_5457091_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_099455475.1\|5457377_5457800_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-73	97.9
WP_038443860.1\|5457820_5458534_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	4.1e-131	99.2
WP_099455476.1\|5458581_5459052_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	3.1e-79	98.7
WP_032894883.1\|5459068_5460352_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.1e-230	99.5
WP_032894886.1\|5460376_5460733_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	3.6e-59	98.2
WP_099455477.1\|5460729_5461152_-	arsenate reductase ArsC	A0A2H4J437	uncultured_Caudovirales_phage	2.6e-69	94.3
WP_099455478.1\|5461280_5461745_+	GNAT family N-acetyltransferase	A0A2H4J155	uncultured_Caudovirales_phage	6.7e-74	94.0
WP_038443869.1\|5461817_5462186_+	hypothetical protein	A0A2H4J9F9	uncultured_Caudovirales_phage	1.9e-60	97.5
WP_099455479.1\|5462247_5463420_+	DUF3800 domain-containing protein	A0A2H4J132	uncultured_Caudovirales_phage	7.8e-212	96.9
WP_099455480.1\|5463412_5463937_+	hypothetical protein	A0A2H4J2P5	uncultured_Caudovirales_phage	7.3e-69	92.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection