CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	0 crisprs	WYL,csa3	0	6
NZ_CP016621	Microvirga ossetica strain V5/3m plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	0 crisprs	csa3,RT,DEDDh	0	8
NZ_CP016616	Microvirga ossetica strain V5/3m chromosome, complete genome	2 crisprs	DEDDh,csa3,RT,Cas14u_CAS-V	0	12
NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	2 crisprs	RT,csa3,DEDDh	5	11
NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	0 crisprs	RT,csa3	0	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016617_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016617_1

44336-44649

Orphan

Consensus_repeat	Method
CATTGCCCGCGGGCAA	PILER-CR

4 spacers

The CRISPR arrays of NZ_CP016617_1

>merge|NZ_CP016617|1|44336-44649|PILER-CR
CATTGCCCGCGGGCAATGCGTCAATGACAGTTGGATCCTGCTCTCGGCCGCTGCGATCTGGCCTCTCCCGTAAGAAGACATTGCCCGCGGGCAATACGTCTCGGCGAGCGTTCCCAATGGGTTCCCCTTCCCTATCCGGGACTGTTGCTGCATTGCCCGTGGGCAAGGGGTCGACGGTCAGAAGTGTGTTGTTTTTATCTGACCAGTTGCGGTCACAATGACAGATTGCCCGCGGGCAATGTGTCGGTTTTTGCGAGAAACCTGGCTGAACTCCTCTCTCGTCCAATGTTGCCCGGGGCATTTCCCGCGGGCAA

>NZ_CP016617|1|1|44336-44649|PILER-CR
CATTGCCCGCGGGCAA	TGCGTCAATGACAGTTGGATCCTGCTCTCGGCCGCTGCGATCTGGCCTCTCCCGTAAGAAGA
CATTGCCCGCGGGCAA	TACGTCTCGGCGAGCGTTCCCAATGGGTTCCCCTTCCCTATCCGGGACTGTTGCTG
CATTGCCCGTGGGCAA	GGGGTCGACGGTCAGAAGTGTGTTGTTTTTATCTGACCAGTTGCGGTCACAATGACA
GATTGCCCGCGGGCAA	TGTGTCGGTTTTTGCGAGAAACCTGGCTGAACTCCTCTCTCGTCCAATGTTGCCCGGGG
CATTTCCCGCGGGCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016617.1\|WP_099513279.1\|33007_33343_+\|transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP016617.1\|WP_099513281.1\|37826_39605_-\|SLC13-family-permease	unknown	unknown	gnl\|CDD\|223547
NZ_CP016617.1\|WP_099513289.1\|49380_50430_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP016617.1\|WP_175608894.1\|48862_49144_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368217
NZ_CP016617.1\|WP_099513276.1\|30564_31482_+\|complex-I-NDUFA9-subunit-family-protein	unknown	unknown	gnl\|CDD\|187579
NZ_CP016617.1\|WP_099513293.1\|56043_57030_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP016617.1\|WP_099513275.1\|27742_30232_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_099514245.1\|46441_47251_-\|APH(6)-family-putative-aminoglycoside-O-phosphotransferase	unknown	unknown	gnl\|CDD\|226100
NZ_CP016617.1\|WP_099513290.1\|50550_51252_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP016617.1\|WP_099514244.1\|44682_45768_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271180
NZ_CP016617.1\|WP_157934358.1\|41642_42596_-\|plasmid-partitioning-protein-RepB	unknown	unknown	gnl\|CDD\|274586
NZ_CP016617.1\|WP_099513283.1\|40149_40875_-\|DUF2270-domain-containing-protein	unknown	unknown	gnl\|CDD\|227817
NZ_CP016617.1\|WP_099513285.1\|42781_43984_-\|plasmid-partitioning-protein-RepA	unknown	unknown	gnl\|CDD\|274585
NZ_CP016617.1\|WP_099513280.1\|34089_36549_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_157934359.1\|52288_52504_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223747
NZ_CP016617.1\|WP_099513287.1\|47361_47751_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350250
NZ_CP016617.1\|WP_099513295.1\|57988_59254_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP016617.1\|WP_099513288.1\|47737_48013_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|198034
NZ_CP016617.1\|WP_099513282.1\|39815_40070_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_099513277.1\|32182_32836_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679

Protein	Function_ID	Function_description	E-value
NZ_CP016617.1\|WP_099513279.1\|33007_33343_+\|transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.88187e-10
NZ_CP016617.1\|WP_099513281.1\|37826_39605_-\|SLC13-family-permease	gnl\|CDD\|223547	COG0471, CitT, Di- and tricarboxylate transporters [Inorganic ion transport and metabolism].	5.40387e-54
NZ_CP016617.1\|WP_099513289.1\|49380_50430_-\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.23835e-49
NZ_CP016617.1\|WP_175608894.1\|48862_49144_+\|hypothetical-protein	gnl\|CDD\|368217	pfam04977, DivIC, Septum formation initiator. DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.	0.00074237
NZ_CP016617.1\|WP_099513276.1\|30564_31482_+\|complex-I-NDUFA9-subunit-family-protein	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.1603e-93
NZ_CP016617.1\|WP_099513293.1\|56043_57030_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.86607e-22
NZ_CP016617.1\|WP_099514245.1\|46441_47251_-\|APH(6)-family-putative-aminoglycoside-O-phosphotransferase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	7.75802e-89
NZ_CP016617.1\|WP_099513290.1\|50550_51252_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.80286e-62
NZ_CP016617.1\|WP_099514244.1\|44682_45768_-\|site-specific-integrase	gnl\|CDD\|271180	cd00799, INT_Cre_C, C-terminal catalytic domain of Cre recombinase (also called integrase). Cre-like recombinases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.	4.82577e-45
NZ_CP016617.1\|WP_157934358.1\|41642_42596_-\|plasmid-partitioning-protein-RepB	gnl\|CDD\|274586	TIGR03454, partition_RepB, plasmid partitioning protein RepB. Members of this family are the RepB protein involved in replicon partitioning. RepB is found, in general, as part of a repABC operon in plasmids and small chromosomes, separate from the main chromosome, in various bacteria. This model describes a rather narrow clade of proteins; it should be noted that additional homologs scoring below the trusted cutoff have very similar functions, although they may be named differently. [Mobile and extrachromosomal element functions, Plasmid functions].	9.8026e-112
NZ_CP016617.1\|WP_099513283.1\|40149_40875_-\|DUF2270-domain-containing-protein	gnl\|CDD\|227817	COG5530, COG5530, Predicted integral membrane protein [Function unknown].	2.12401e-93
NZ_CP016617.1\|WP_099513285.1\|42781_43984_-\|plasmid-partitioning-protein-RepA	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	0
NZ_CP016617.1\|WP_157934359.1\|52288_52504_+\|hypothetical-protein	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.28816e-05
NZ_CP016617.1\|WP_099513287.1\|47361_47751_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350250	cd18683, PIN_VapC-like, Uncharacterized subfamily of the VapC (virulence-associated protein C)-like family of the PIN domain superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.82315e-51
NZ_CP016617.1\|WP_099513295.1\|57988_59254_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.61789e-58
NZ_CP016617.1\|WP_099513288.1\|47737_48013_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|198034	smart00966, SpoVT_AbrB, SpoVT / AbrB like domain. This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation. AbrB is thought to interact directly with the transcription initiation regions of genes under its control. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator. DNA-binding activity in this AbrB homologue requires hexamerisation. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins.	6.4403e-07
NZ_CP016617.1\|WP_099513277.1\|32182_32836_+\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	1.49944e-16

>NZ_CP016617.1|WP_099513285.1|42781_43984_-|plasmid-partitioning-protein-RepA
MSALEQSTLDPVVARVDENNRAQISLDAELLAKELQKHTQRIFPPVAQKAIRRFSSAEAANFLGIHEGYLRQLAVDGKAPLPEIQPNGKRTFSVDEITAVREFLDGNQSNRRYIPHRMAGEKLQILSVINFKGGSAKTTTAAHLSQYLALRGYRVLAIDLDPQASLSTLFGQQPELDVLPNETLYGALRYDNERTSIEEIIRATYLPGLHFIPGNLELMEFETTTPVAKEVRSFFLRIFQALQPVESEYDVVVMDCPPNLGYLTMAALSAATSLLVTVHPQMLDVLSMAQFLKMVGDTVNLFGDRRPDYDWLRYLITRYEPNDGPQNQMVTWMRSLFEHRVLQNPVLKSTAIADSGLTKQTLYEVDRTKFTKSTYDRALESLDLVNGEIEANIRRAWGRQ
>NZ_CP016617.1|WP_157934358.1|41642_42596_-|plasmid-partitioning-protein-RepB
MDQEQVASAGDKEIASLPRHTRPTMTSQQRIMAETLNAADRAGELEEQLRSGHAVVDLDPSTVDASFVPDRMAYSEEAHRELVQAIKAEGQIVPILVRPHTQEQGRFQVAYGHRRLRAVTELGIKVRAVVRELTDEQLVVAQGQENNARTNLSFIEKARFALQLEERGFRRDVIMQALCVDRPRVSQMVKFASSIPMEIINAIGPAPGIGRRKWEDFAALITKGNIDKARYAIERAENSGRDSDAKFEAAYKALTTRAEVSRPELWTAPDGTRLAKYTETDDKFSIVIDRKLSPRFGKFLVSRLEQLYNEFQAREKE
>NZ_CP016617.1|WP_099513283.1|40149_40875_-|DUF2270-domain-containing-protein
MLSKTDQSTVQVLRPTIAAPVFPSTSTEFITVLAHYHRAEIARMAGWRDRIDRTTNWAITVVAAMLSVSLSTPTAHHGVLLFAMVLVLLLLVIEARRYRFFDVYRNRVRRMERNYFAQIFAAEEGTTDDWILKLGDDLRRPMFLTSTSQALSRRLRRNYCWLFLILLFAWLVKTTFIRMQENAAEAHLVGSVGEWVRNAAIGPVPGWAVILAVTLFYAWILYASLHRPKGEGELAFGNVHV
>NZ_CP016617.1|WP_099513282.1|39815_40070_-|hypothetical-protein
MGMPKQAAALAVYELTNAVPQIGLEQLRRLNTSHYLDDQDCKYVGGHRMLCSGVTEMRVTSDTPLFRLGGLYLVSLTDGRPPPP
>NZ_CP016617.1|WP_099513281.1|37826_39605_-|SLC13-family-permease
MALDQALAFAILAAAMILFIWGRLRYDLVAILALLAAVFTGVVPHGEAFKGFGDDIVIIVASALVVSAAVARSGVMEAVLHRVSSHVTSVQGQIVLLVTAVTILSAFVKNIGALAMMIPVAFLVARRLKASPSCFLMPMAFGSLLGGLVTLVGTSPNIIVSRVRGELTGQPFGMFDFAPVGLGLAVAGVVFLVFGFRLLPGRRKAKGTMDEALDIPDYMTEARVTAASVVTGRPVGDLARFCNDKVMVTGIVRHKTVRMPLLPDAILLEGDILLLEGDPEALERAVARARLELEGGDRPTHTARAADEIAGIEAVVGPRSILIGQTAKRITLHEHFNINLLAVSRSGQHFTERLRDIVLQAGDVLVLKGDLTRLPGTLRELGCLPLAERAIRLGNVRQGLVPVAVLGSAMALTAVGALPVAPAFLTAAVLMVLLGALSLREAYAAIDPPILVMLGALIPVSEAIRTTGGADLIARGLSDLAGTLPPYGALALVMLAAMAVTPFLNNAAAVLVMAPVAVSFAQQLGYRPDAFLMAVAVGAACDFLTPIGHQCNTLVMGPGGYRFGDYWRLGLPLSILVLVLGVPLILLVWPLV
>NZ_CP016617.1|WP_099513280.1|34089_36549_+|hypothetical-protein
MMNNEHVPLGGFLPVSVILPFGPQSEDVKEMQEAIVARIQVPAAFDLSDLEAGSHVHVAQESDTVLRLIEAYRQSADPDDVKERNIDVLEHVSRDPINHAVVVEFSSQGLLRFVVLRRSIEYVAGQDGTPLVVRMIHDVVAAHYKGSLHTDDLMQACGAAVLADLVKLHLDIAEIATHLDAQEVPYHGLEQQLPFMLEPALRVESHVKGSVGDNDYAVHAIGTLIETYSGHWAGIRDPNHTPGPAYFVGPYYPGSWFTAKQSSSGRDTRESLRAREILRSASLIAHSNLRRVTPAETPDFVPGRRVETIVSEYASLEALAAGGFALGLDVKDPRSVFGFFGEDVKTGLLYIFEVTNRALSAYVGIERTLSLTLEAGVMMPLTLDLKLGHMLGEVQEPMIADRIAEVFLDQAISDVFSLQSSLSAFSGDILVRFRVPSALAAHFRQVISQDWKESLDAIGYEGSHHRVREPVTIEEDVWPDHEEPHVPEVLFQQLPTGVSIDPNSILEAASDEVEDDVDDLEVLRCRDGKAEWVHLEELEEDETDEPFWLLRTWVGGMAQPVVYSTVSGRNIDGGEWYPQELVANFSHTLASLPQTVKTVALSPRGVAKLREAAERLFSHANIKVAPIETVFLNADAYDAVFGDRLSEEDESLLDHLATCADPDRDWEDPLDGEWEMTRPSDFIVAVHDDLRLSDDFKGADAILAEFLSGRAFALLGYGDDLFRSTMFIVALAYVRRILNSAEVPLLAKSDIRIVRDNLHYAWDQRVSEAKISSAISAAIEEVSQGTPKVRIYLAVARVAQAFEAVVDLASMVTERRVAY
>NZ_CP016617.1|WP_099513279.1|33007_33343_+|transposase
MMTHYAGLDVSQKETTICVVDEQGRRLWRGTAPTDPEALTEILRQHGCDLHVGVETGPLMPWLVHGLRRNGLEVICLDARHAKAALAMQFNKNDRDDAEGLLRSCARAGIL
>NZ_CP016617.1|WP_099513277.1|32182_32836_+|OsmC-family-protein
MQITPLGPLEREAEGSSNTAIVTNLEHTEFGQVIFVGDHTLHADQPLGAGGQAAGPDPYQYLLAALGACTSMIVGAFARRKAWPLEQVVVRLTHSQTHPTSADRHPSGKISDRIERSIDLVGPLSDTQRDLLLKVADMCPLVGMLTSGLDIVTTLTAHAPGESYDPVDRDSDQSFPASDPPGWIRMTGAGSPLHINALTLLVEHADNSLAPSELRAR
>NZ_CP016617.1|WP_099513276.1|30564_31482_+|complex-I-NDUFA9-subunit-family-protein
MTQVTVFGGSGFIGRHLVEHLARAGASVRVATRHPSPTGEPPRLARIQQVEADILDDVAVQAAVHGADTVINLVGILSPAQRHTFTAIHEDGARRVAASAKHLGVRHLVHVSALGASRTAPALADRSKAAGEEAVRAAFPEAAIVRPSLVFGSDDHFFNGFAARARRLPALPLIGGGQTRFQPVYVEDVVAGFAAILAHPASRGKIYEFGGPQVYTFRELLEFVCAMIRARPLLVPVPFWAAELLSGLLQVFPGAPLTRDQVRLLRTHKVVSGSEPLLGDLGVEPQALETIVPEYLSAYRQVGRG
>NZ_CP016617.1|WP_099513275.1|27742_30232_+|hypothetical-protein
MQKIAQRLSFYTGLGLITAATLMLQIVETRIISVTSWYHLAFFVISVAMFGLTAGAVWVYLRPERYRPGQLSYHLSTASLSFALATILALLVQLTIVTSLPASVMSLVVWTEFAVALSLPFFFSGIVVSLALTRSPFPVGVVYGIDLLGAALGCLGALGLLNLVSGPSAVLWIAVLIAAGGQFFARADLGDVPLGRSVAGWLFRYRGPVLAGLAILAFANSLIEGVRPTVVKDQIEHPATIAYEKWNSFSRITVGQPERTRPALWGPSPRFVADPIEQRWMNIDGGAGTAVYRFSGDLNELAFLRYDVTNLAYAVPGLQTGAVIGVGGGRDLLSARVFGVSEVVGVEINPIFIDLLTRRFANDTAIGRQPGLSFEVDEARSWFARAERSFDVIQMSLIDTWAATGAGAFTLSENGLYTVEAWRIFLERLTPSGVFTVSRWYAPGEVNETGRMVSLAVATLQSLGATDPKRHLFMAASDNVATLVMSRSPLSAQALAALRQAAHTYAFSVLLSPQAPAASPLLERIVAAPDRSALARATEASYLDLSPPTDARPFFFNQLRLGRLLDQDVFTLASRVGVYGGNLSATLTLAMLILISAILVAATIIVPLRSMVSSRPSGLIGAGTFYFGLIGIGFMMVEIGLLQRISVFLGHPVYALSVVLFSLILSTGIGSLVSERAPLDSSARLVSWSALTSLYLLLLPFWLPDILLRLESAGLLLRAGLAVLVLSPAGFLMGFGFPTGMRLVSAIDKKPTPWFWGINGAAGVLAASVAVLTSIEFGIDTTLRIGAICYLLLPGPALLLARCARAMRESGRSIGDEGPPSTLDLTSVS
>NZ_CP016617.1|WP_099514244.1|44682_45768_-|site-specific-integrase
MAAADRYAEVLTDADVATLKHLAETGIGANTLRALASDLAYLEAWCRAATGRALPWPADPELVLKFIAHHLWDPEQKAIDPGHGMPDAVIAELWDRRILKVRGPHAPKTVSRRLANWSTLHQWKGVEGRFDDAGVKKALRLAMKASGRAPQRKSRKPVTRDILECLLASCSGSKAIDLRDRAILLIAFAAGGRRRSEVATLKHSQISVADPIKLRPTDPTSPMVPCVRIALGRTKTTTAGQGAFVFAAGRAAVALYEWMQAANVTSGPIFREVRKDGSIGANPLTPQSVNLILKKRCRMAGLDPAEFSAHGLRSGFMTQAGRDGIPLVDAMRQSAHKSVQQAAGYYDEQEHAQSRSVQIFI
>NZ_CP016617.1|WP_099514245.1|46441_47251_-|APH(6)-family-putative-aminoglycoside-O-phosphotransferase
MLEPYLRQWGLVSTGDLIVTRTSQLLPVLFHGQPAMLKVTGDADERYGHLLMRWWAADGAARVLACDDGAVLLERATGSRSLVRLAEHGRDDEATRIICAVARRLHTPRGAPPPGLVPLTTWFEPLAPMAQAQGGILVHAANAATDVLASQREIVPLHADLHHENVLDFGERGWLAIDPKRVIGERTFEYTILFCDPDLGLPHLTIARRPEIFARRLAAVSEAAGLETRRLLLWILAWAGLSAAWQLTDDLDPGIELQVAEMALAALHA
>NZ_CP016617.1|WP_099513287.1|47361_47751_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MLAIDTNLIVRYLTGDHPEQSSQARALIDREDVFVCTTVLLETEWVLRSAYGYTPAQIATALNAFAGLPHVTLEDAPLAARALEWMAEGLDFADALHLVKAAGCTAFVSFDQRFAKAANRVSEVKVRAP
>NZ_CP016617.1|WP_099513288.1|47737_48013_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MTKAESLMTVVSTKGQVILPKSIRQHRHWAAGTRLVVEETPEGVLLKAAPLFATTRPEDVYGSLPYQGPPKTLEDMDASIVAEAKRRHARD
>NZ_CP016617.1|WP_175608894.1|48862_49144_+|hypothetical-protein
MTSPGGSNKPLSSTALRELVSDLAGKIDRLEQEVEQLRLDNSNLRLDNQALKDEIARLKHLPPRPPFKPSGMEKAGAVMSGWRPFGNVIVVDV
>NZ_CP016617.1|WP_099513289.1|49380_50430_-|IS110-family-transposase
MSEIATIGLDIAKNVFQLHAVDRSGKIVLRKALRRSQVQGFFSRLPPCLIGMEACATAHHWARTLMAFGHDVRLIPPAYVKPYLRRQKNDAADAAAICEAVARPSMRFVPVKSPQQQSTLMLHRARDLLIGQRTALINALRGHFAELGIVVAQGARNTRQLIALLHEEANPDFPAAARTALQPLATMLLGIETQIAKLDKAILAAHRSDPVSMRLAAIPGIGPIVASCLAASVPDASLFQGSREFAAYLGLVPRQHSTGGKARLGSISKMGNRHLRKLLVVGAHAALYSMKSGKTRTAMADWARSLLAKKPFKVVAVALANKMARIAWAVMARSTTYEPGSKGVAASAA
>NZ_CP016617.1|WP_099513290.1|50550_51252_+|IS6-family-transposase
MSKPISYKRHRFPPEIIAHAVWLYFRFPLSLRLVEEMLLERGIVVSYETVRRWALKFGPAYARRLRRKPPSRRDIWHLDEVVVTIAGKKHWLWRAVDQDGYVLDEVVQTRRDTTAAKRLLRRLLRKQDCPPRRMITDKLGSYAAARRQIMPEVEHRSHKGLNNRAENSHLPFRRRERVMQGFRSLRYLQRFVSVFSAVRNLFVPPRSRRSARATHLHRLNAMAAWKVAANVAA
>NZ_CP016617.1|WP_157934359.1|52288_52504_+|hypothetical-protein
MPRWTSPTQRRPVLGAVRSAAHTVGRDGLAIRHGVCGDCGSVHERDQNAVLTIARLGCETLGLKGPGTLAL
>NZ_CP016617.1|WP_099513293.1|56043_57030_+|IS481-family-transposase
MHSIHPQARTTPAIRSEIARSHEPTGVLAQRFSVSTETVRKWRKRGAKDCQDHSSRPHKLPWKATEEERAIVCALRQATGFPLDDLTFVVTHFLPHLNRDAVYRILKAEGLGRLPPAQQRKRESGTFKDYDLGFVHIDIKHLPKLETANGESRKRFLYVAIDRCSRWVHLAVKDDELATSAVAFLKEAIRAFPFKVTHVLTDRGSCFTADGFEHACRKLKVEHRKTKPYTPQTNGLVERFNGRVQREVLGITIYSHRDLETLLKGFNQAYNRRRQRVLKGASPEQVVHRRLAAEPNLANARFKPPDRYALAQALHVVAHAKEVSHPDN
>NZ_CP016617.1|WP_099513295.1|57988_59254_+|IS256-family-transposase
MNETTNIVRFRQPDTIDDPLTDILRTGARKLLAQAIEIEAEAFLASMRELKLPDGRERLVRHGHGPERTIQTGIGPVAVSRVKIRDRGDEGEDRIRFTSAILPKWARRTKSLDALLPILYLRGLSTGDFQEALSALLGKDAPNLSPSAITRLTGEWQAEYERWQVRDLSARHYVYVWADGVYLQARMEDQAECILVLIGATPEGKKELVGFQAGVRESAQSWRELLVEIKRRGLAIPPRMAVGDGALGFWKALDELFPGTHHQRCWLHKTANVLNKAPKSVQPGMKVALREIYLAPTRAQAEVAVDLFEEAYGARYPKAVECVRKDQWALLAFYDWPAEHWIHLRTTNPIESVFATVRHRTVRTKGSLSPTTARLMVFKLVMAAARSWRRLMGENQLPKVIAGVKFPDGIEIIQMPTNSAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016617_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016617_2

1205894-1206001

Orphan

Consensus_repeat	Method
GCCAGCCCAGCCTCAACGAGCGAGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016617_2

>merge|NZ_CP016617|2|1205894-1206001|CRISPRCasFinder
GCCAGCCCAGCCTCAACGAGCGAGAGCCCGGCGACATCCCAGGGAACAGACAAATCAGGAGCCGTGCAAGCGGATGCTCCGGCCAGCCCGGCCTCAACGAGCGAGAGC

>NZ_CP016617|2|1|1205894-1206001|CRISPRCasFinder
GCCAGCCCAGCCTCAACGAGCGAGAGC	CCGGCGACATCCCAGGGAACAGACAAATCAGGAGCCGTGCAAGCGGATGCTCCG
GCCAGCCCGGCCTCAACGAGCGAGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016617.1\|WP_099514159.1\|1197671_1198388_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP016617.1\|WP_157934482.1\|1203320_1204127_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236766
NZ_CP016617.1\|WP_099514169.1\|1217133_1217481_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_099514328.1\|1201220_1201418_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_099514157.1\|1195335_1196532_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP016617.1\|WP_099514330.1\|1212927_1213401_-\|transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP016617.1\|WP_099514162.1\|1200084_1200969_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP016617.1\|WP_157934483.1\|1206337_1207555_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173797
NZ_CP016617.1\|WP_099514158.1\|1196459_1196978_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350159
NZ_CP016617.1\|WP_099514329.1\|1211893_1212154_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_157934481.1\|1199198_1199954_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227949
NZ_CP016617.1\|WP_099512701.1\|1214735_1215161_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225949
NZ_CP016617.1\|WP_099514160.1\|1198685_1199177_+\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP016617.1\|WP_099514156.1\|1194892_1195201_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350159
NZ_CP016617.1\|WP_099514168.1\|1208995_1209241_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016617.1\|WP_099510694.1\|1213397_1214539_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP016617.1\|WP_099509451.1\|1209436_1210975_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP016617.1\|WP_099509450.1\|1210993_1211755_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP016617.1\|WP_099510694.1\|1215502_1216644_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP016617.1\|WP_099514164.1\|1202314_1202701_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP016617.1\|WP_099514159.1\|1197671_1198388_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.30529e-63
NZ_CP016617.1\|WP_157934482.1\|1203320_1204127_+\|hypothetical-protein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.00271948
NZ_CP016617.1\|WP_099514157.1\|1195335_1196532_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	5.37519e-136
NZ_CP016617.1\|WP_099514330.1\|1212927_1213401_-\|transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	4.40238e-10
NZ_CP016617.1\|WP_099514162.1\|1200084_1200969_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	5.58056e-13
NZ_CP016617.1\|WP_157934483.1\|1206337_1207555_+\|S8-family-serine-peptidase	gnl\|CDD\|173797	cd05561, Peptidases_S8_4, Peptidase S8 family domain, uncharacterized subfamily 4. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	6.56433e-80
NZ_CP016617.1\|WP_099514158.1\|1196459_1196978_-\|hypothetical-protein	gnl\|CDD\|350159	cd09008, MTAN, 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidases. This subfamily includes both bacterial and plant 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidases (MTANs): bacterial MTANs show comparable efficiency in hydrolyzing MTA and SAH, while plant enzymes are highly specific for MTA and are unable to metabolize SAH or show significantly reduced activity towards SAH. MTAN is involved in methionine and S-adenosyl-methionine recycling, polyamine biosynthesis, and bacterial quorum sensing. This subfamily belongs to the nucleoside phosphorylase-I (NP-I) family, whose members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	6.2674e-26
NZ_CP016617.1\|WP_157934481.1\|1199198_1199954_+\|hypothetical-protein	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	4.00697e-06
NZ_CP016617.1\|WP_099512701.1\|1214735_1215161_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.97002e-11
NZ_CP016617.1\|WP_099514160.1\|1198685_1199177_+\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	5.93509e-39
NZ_CP016617.1\|WP_099514156.1\|1194892_1195201_-\|hypothetical-protein	gnl\|CDD\|350159	cd09008, MTAN, 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidases. This subfamily includes both bacterial and plant 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidases (MTANs): bacterial MTANs show comparable efficiency in hydrolyzing MTA and SAH, while plant enzymes are highly specific for MTA and are unable to metabolize SAH or show significantly reduced activity towards SAH. MTAN is involved in methionine and S-adenosyl-methionine recycling, polyamine biosynthesis, and bacterial quorum sensing. This subfamily belongs to the nucleoside phosphorylase-I (NP-I) family, whose members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	1.48861e-21
NZ_CP016617.1\|WP_099510694.1\|1213397_1214539_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.32765e-73
NZ_CP016617.1\|WP_099509451.1\|1209436_1210975_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.71119e-45
NZ_CP016617.1\|WP_099509450.1\|1210993_1211755_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	1.90796e-73
NZ_CP016617.1\|WP_099510694.1\|1215502_1216644_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.32765e-73

>NZ_CP016617.1|WP_157934482.1|1203320_1204127_+|hypothetical-protein
MAAMAVEAAVATGVEAAVAMAMAAGKAPGVAKAVPMETAAEKAAMAGRATLEEQAAGTGMPEAARAARLEATKLGAIRAEAMQAQAAQARATKAESAVTVKAGAKATLATAVKAAALPEVQAVVPEEAPALGRVPVTAAPEATPRARAKEATRMATRPQAPVTESQATTGTARDEAAKGQARLTTHGAGTGVPEIAREPARPTRDPAWGTVKATAPPKGTRKAVLAASGMDTARVMATPMLTAAAAKPETKAMALAGTAVRGHVKAET
>NZ_CP016617.1|WP_099514164.1|1202314_1202701_-|hypothetical-protein
MQQDEFFPLDAIPPRVRRAILQEFQGRRPTVQEVAQISDRHWLATPEVGPSTLEKIHEVLQPQPYQGDGALPKMTDAELLARLESLQEELRSIRHILKTRIGKTSGKLLRNQGRMRSFPDEEAGLRSV
>NZ_CP016617.1|WP_099514328.1|1201220_1201418_-|hypothetical-protein
MKRRIEFVAQAIHDAQPSAFAWDAEPAFDRERYREYARNAIKLLGEDIGVLLFSLGEAAAEQYVG
>NZ_CP016617.1|WP_099514162.1|1200084_1200969_-|TonB-dependent-receptor
MRIEEELKRKRADMIVVVEQLTLRIETVKKQVSAIDQVIAIYDPAHQASSAVKPNRKQASLVLSAARGRRVARGGPRLRAAYIEDAQSFLAYSLAPTTTVGLIPADAPANGPTKGLVLRWDAEWMPHVFTALEYQRQTLQDLSTPRINTLSLIEDIDEARSEWLAATVNVWLGHGIGVFGTIGGVTSEILEGRGQGEPVPYIPDRFARAGVTFVHPSRLRFTLTQNYIGKRSGSYENDRLDAYWTTDAAITWETPDRHFQFGVTALNLLDQDYEFGFYIPAPGRTIAATIKARL
>NZ_CP016617.1|WP_157934481.1|1199198_1199954_+|hypothetical-protein
MSELHLSDEVLMAFADGELDEPVAAAVARAMADDPRVARRIVDFQQSRRLTRTAYSGELMPEVPPALLAAVSAQIEAYEAKEHRTVITNLAEERKRRLRAEPRLLRMALAASIAVVACGIGYWAGRQGNDRTDDLVARLDDSAIHRELSRVASGEEVELPFGRLRVISSYRLENGSLCREFRLAHAKEIADAVACLRDGWNVTFALAGAATDAGYVPSGAGDPMAAYLQAVGAGEPLVGDAEANALREVAR
>NZ_CP016617.1|WP_099514160.1|1198685_1199177_+|RNA-polymerase-sigma-factor
MPTAIGQELVALLPRLRRFALVLCRSPSLADDLVQGACERALANPDSWTPGTRFDAWMFRILRNHWIDHLRRTKAEGMAEDITTHTQLIGDPGEGPILSRLVLSEVQRAIDSLPLDQREVLVLVCGEDLTYREAADILHVPIGTVMSRLARARRRLVELTAAA
>NZ_CP016617.1|WP_099514159.1|1197671_1198388_+|IS6-family-transposase
MKQGSKNPFKGRQFTAEIILWAVRWYLQFPISYRDLERMLADRGIKVDHTTLFRWIQAYAPELDKRIRPHLQMTNGSWRVDETYIRVKGEWVYLYRAVDAVGQTIDFLLSPKRDAAAGRRFFRKALRQPHTVNPRTITVDKNAAYPIAAKAMKQSQELWRFAKFRQVKFLNNIVEQDHRRIKRLVRPGLGFKSFMTASRTIAGYEIMAMVRKGQVASVSVNDMKAQNDFIAALFSAVA
>NZ_CP016617.1|WP_099514158.1|1196459_1196978_-|hypothetical-protein
MTTGILCATPEELDALHHRFEFDGEPTTLAGFQFWKGNVPDRSRPIVLSQSGIGKVNAATLATILFTTFGWDDLIFSGVAGALTDLEVGSVVLVTKGATMTTGSSAMAFSPASQSVTSRYRVLPSLYRICRSCPVAWCKRASPRLSRIDQAVTADSLRTGSSLNALRLSSDM
>NZ_CP016617.1|WP_099514157.1|1195335_1196532_+|IS256-family-transposase
MTDERMALIELIEKGADADLIRDMLAFAAERLMSLEVEALTGAPAGVRSSERLTHRNGYRERAWDTRAGRIDLSIPKLRKGSYFPVFLEPRRTAEKALTAVIQEAYVHGISTRSVDDLVKAMGASGISKSQVSRLCEEIDERVNAFLSRPIEGEWPYLWIDATYLKTREAGRIVSTAVILAVGVNTDGRREVLGIATGASEAEPFWTAFLRSLADRGLRGVSLVIADDHKGLRAAAYRVFHASLQRCRVHWMRNAMAHLAPKQRPAVVAMLKTIFAQDTAEAAREQWASVADALRERCPKLTELTDRSREEVLVYMSFPREHWGQIASTNPLERLNGEIKRRADVVGIFPNDRAVIRLVGALMLEQNDEWAVSRRYMSLESLSALSDDPVRRLSAVTA
>NZ_CP016617.1|WP_099514156.1|1194892_1195201_-|hypothetical-protein
MEHLRDRMADKLTIRLGSVLSGDVFINCQDARARLKALGGDIVDMESTAVLEVAHRFGKGAYIIRTISDGAGDDSHLSYAEMVAMVAHNSALCVEDLLRIMP
>NZ_CP016617.1|WP_157934483.1|1206337_1207555_+|S8-family-serine-peptidase
MQTASASASVADAVDPRPKPRQSTSFILASGLSRDDLTKLTAQGFHVETRTQGRITPQVVRLRIPQGASLTQARQKVRLVDAQASADFDHYYYLDEGAGTCTGPDCRATALVNWSASNAAQCGPTPLIGMIDTGINLEHEALKDQAIEVLPAPASHADASLQDHGTAIAALLVGRRGSQTPGLLPDAKLVAVDAFYRDGGTADRTDVMSLVAGVEALAERGVQVMNLSLSGPPNEVLQNAIEAAQAKGIVIVAAAGNNGPGAEPSYPAAYPGVIAVTAVDQELNVYRRATQGGYVDLAAPGVNIWTASSKGSGTLKSGTSYAVPFVSAATSLLLASNPTLDPKVVQSGLEARTRDLGKPGWDPTYGFGLIQVAGLCPQPTKPAPVTASYEQPAALPFAAQTSEVP
>NZ_CP016617.1|WP_099514168.1|1208995_1209241_-|hypothetical-protein
MPRYFFDTFDGENLHSDETGVDLPDIDEAKREAQKALPDMVKDALPDGNHRTFVVNVRDETRQTVVRAALSLVVEEGTFDD
>NZ_CP016617.1|WP_099509451.1|1209436_1210975_+|IS21-family-transposase
MPTQRLSMRRIREVLRLRHVQGLTERVIARTLGISNGVVHGYLRRARLAGLSWPLPDGLDDDALELLLFPAPSSAQTDRRPVPDWVYVEKELRRRGVTRVLLWEEYRAAHPDGFGYTWFCTTYEAWKGRVRPTMRQTHRGGEKVFVDFAGDTIDVFDPLTGQAHPMKLFVAAMGASNYTYAEACASESLPDWIAVHANLFAFLGGVPKFVICDNLKAAVTNPDRYDPGLNRTYAEMAGHYGTAILAARPRRPKDKAKVEVAVQIAQRWILARLRNHRFFALAELNRAIRSLVVELNARQMRGFGSSRAELFAEIDRPRLGALPDEPYVFARWKRCRVAPDYHVEVDGHWYSVPYRLIRELVDVRLAGATVEIFHKGQRVASHARAPNRRGHTTVAEHMPSAHRRHGQWTPRGLIAAGERIGPSVAAFFEAVIADRPHPEQGFRTCLGILSLARSYGDTRVEAACRRGLLIKARSVASIRSILKNGLDRAVVDETPDHEPLRHGNIRGQGYFH
>NZ_CP016617.1|WP_099509450.1|1210993_1211755_+|ATP-binding-protein
MLTHPTHERLIALGLTGMAKAFEEQRRLPDLDALSFEERIGLLVDREAAERDTKRLTARLKFAALRQNACVEDVDWRTPRGIDRAVFARLVVGDWIDRHENVLITGAAGLGKSWIACALGHKACRDNRSVLYHRVPRLFEALALARGDGRYGRLLKALGRVQVLILDDWGLSVLTGSERRDLLEILDDRHGRSSTIVTSQVPVDAWHDLIGDPTLGDAILDRLVHNAHRLQLAGESMRKQNARARPLDGDQIS
>NZ_CP016617.1|WP_099514329.1|1211893_1212154_+|hypothetical-protein
MDISKDTTAISEPTGQPVSTWSEEWKEECEARAILAMSKEQRDAFFNGRKDADGKPIDRGVVGVRGVKAAEEIRATMERLLTATGR
>NZ_CP016617.1|WP_099514330.1|1212927_1213401_-|transposase
MATKPLSTKPKQIQFGAIDLRSARRVVLIRSHAGQADAQAFLRALRRRYRGAGWLWLLSDRASAHTAPQTQALADRLRIRFVWLPRQAPELSPMDQLWRELKRLIAANRQAASIDALAADAAAWVLALTPQQACRKAGMASKHFWLRKLLQNFWRPT
>NZ_CP016617.1|WP_099510694.1|1213397_1214539_-|IS3-family-transposase
MPKTRFKREFQDEAVRLVLTSGRSQRAIADDLGVNRSTLARWMAEHQDMRPSSAPPPNEDVMDELKRLRRENEVLRQERDILKKATAFFVGGKSMRFTFIDAAKAEFPIQRLCQVLEVSQSGYFAWRSRPACQRQRDDLVLLAHVRSAFRESNGTYGSPRMTRELQDQGLPIGRRRTARLMRENGLKARQKRRFKRTTDSHHAFPIAPNLLEQDFSAERPNQKWNADISYVWTSEGWLYLAVVLDLFARRVVGWAVSDRLHKELALEALRKALAIRRPGEGLTHHADRGSQYCSIEYQAELRKHGIRISMSGTGNCFDNAVVETFFKTLKSELVWRTVFQTRAEARKAIGRYIDGFYNPVRRHSTLDYVSPAQFERLAG
>NZ_CP016617.1|WP_099512701.1|1214735_1215161_-|helix-turn-helix-domain-containing-protein
MYRRLEALLLVAEGHSMAEAARRCRVNRSSVHRWLAQYRAEHEATALIDRPRSGRPRLHHTLTPRRLAAALARDPRRCGYQATSWTVPLLAHDLATKGLAVSPRTLRRRLHEAGYRWKRPRYVYVERAPHLAQKKGASPGV
>NZ_CP016617.1|WP_099510694.1|1215502_1216644_+|IS3-family-transposase
MPKTRFKREFQDEAVRLVLTSGRSQRAIADDLGVNRSTLARWMAEHQDMRPSSAPPPNEDVMDELKRLRRENEVLRQERDILKKATAFFVGGKSMRFTFIDAAKAEFPIQRLCQVLEVSQSGYFAWRSRPACQRQRDDLVLLAHVRSAFRESNGTYGSPRMTRELQDQGLPIGRRRTARLMRENGLKARQKRRFKRTTDSHHAFPIAPNLLEQDFSAERPNQKWNADISYVWTSEGWLYLAVVLDLFARRVVGWAVSDRLHKELALEALRKALAIRRPGEGLTHHADRGSQYCSIEYQAELRKHGIRISMSGTGNCFDNAVVETFFKTLKSELVWRTVFQTRAEARKAIGRYIDGFYNPVRRHSTLDYVSPAQFERLAG
>NZ_CP016617.1|WP_099514169.1|1217133_1217481_+|hypothetical-protein
MRYYFHLVGPNDDVFPDEIGIEASCFEAAKAEALVAIHEIRADHEDVDVTWRGWHLEIADASQEVIFTIALELRRHLQHVREKLPAGGGHIVHALFLALGLGLDQLVPILRPVSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016617_1	1.2\|44430\|56\|NZ_CP016617\|PILER-CR	44430-44485	56	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	44430-44485	0	1.0
NZ_CP016617_1	1.3\|44502\|57\|NZ_CP016617\|PILER-CR	44502-44558	57	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	44502-44558	0	1.0
NZ_CP016617_1	1.4\|44575\|59\|NZ_CP016617\|PILER-CR	44575-44633	59	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	44575-44633	0	1.0
NZ_CP016617_2	2.1\|1205921\|54\|NZ_CP016617\|CRISPRCasFinder	1205921-1205974	54	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	1205921-1205974	0	1.0
NZ_CP016617_1	1.1\|44352\|62\|NZ_CP016617\|PILER-CR	44352-44413	62	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	44352-44413	2	0.968

1. spacer 1.2|44430|56|NZ_CP016617|PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tacgtctcggcgagcgttcccaatgggttccccttccctatccgggactgttgctg	CRISPR spacer
tacgtctcggcgagcgttcccaatgggttccccttccctatccgggactgttgctg	Protospacer
********************************************************

2. spacer 1.3|44502|57|NZ_CP016617|PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggggtcgacggtcagaagtgtgttgtttttatctgaccagttgcggtcacaatgaca	CRISPR spacer
ggggtcgacggtcagaagtgtgttgtttttatctgaccagttgcggtcacaatgaca	Protospacer
*********************************************************

3. spacer 1.4|44575|59|NZ_CP016617|PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgtgtcggtttttgcgagaaacctggctgaactcctctctcgtccaatgttgcccgggg	CRISPR spacer
tgtgtcggtttttgcgagaaacctggctgaactcctctctcgtccaatgttgcccgggg	Protospacer
***********************************************************

4. spacer 2.1|1205921|54|NZ_CP016617|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ccggcgacatcccagggaacagacaaatcaggagccgtgcaagcggatgctccg	CRISPR spacer
ccggcgacatcccagggaacagacaaatcaggagccgtgcaagcggatgctccg	Protospacer
******************************************************

5. spacer 1.1|44352|62|NZ_CP016617|PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.968

tgcgtcaatgacagttggatcctgctctcggccgctgcgatctggcctctcccgtaagaa	CRISPR spacer
tgcgtcaatgacagttggatcctgctctcggccgctgcgatctggcctctcccgtaagaa	Protospacer
************************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4977 : 233972

169

Acidithiobacillus_phage(18.18%)

integrase,transposase

attL 7997:8013|attR 225520:225537

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513261.1\|4977_5595_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	6.0e-22	38.0
WP_099513262.1\|5687_6728_-	hypothetical protein	NA	NA	NA	NA
7997:8013	attL	NA	NA	NA	NA
WP_099513263.1\|8263_9946_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
7997:8013	attL	NA	NA	NA	NA
WP_099513265.1\|10508_11501_-	phasin family protein	NA	NA	NA	NA
7997:8013	attL	NA	NA	NA	NA
WP_099513266.1\|12151_13180_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	7.7e-06	27.4
WP_099513267.1\|13694_14723_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_175608893.1\|14850_15192_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_157934355.1\|16651_18775_+	EAL domain-containing protein	NA	NA	NA	NA
WP_099508092.1\|19235_20276_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099511091.1\|20392_21385_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513269.1\|21545_22955_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513270.1\|23151_23622_-	DUF1772 domain-containing protein	NA	NA	NA	NA
WP_157934356.1\|24137_24335_+	hypothetical protein	NA	NA	NA	NA
WP_157934357.1\|25795_25978_+	hypothetical protein	NA	NA	NA	NA
WP_099513274.1\|27007_27232_-	hypothetical protein	NA	NA	NA	NA
WP_099513275.1\|27742_30232_+	hypothetical protein	NA	NA	NA	NA
WP_099513276.1\|30564_31482_+	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_099513277.1\|32182_32836_+	OsmC family protein	NA	NA	NA	NA
WP_099513279.1\|33007_33343_+\|transposase	transposase	NA	NA	NA	NA
WP_099513280.1\|34089_36549_+	hypothetical protein	NA	NA	NA	NA
WP_099513281.1\|37826_39605_-	SLC13 family permease	NA	NA	NA	NA
WP_099513282.1\|39815_40070_-	hypothetical protein	NA	NA	NA	NA
WP_099513283.1\|40149_40875_-	DUF2270 domain-containing protein	NA	NA	NA	NA
WP_157934358.1\|41642_42596_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	7.8e-45	37.7
WP_099513285.1\|42781_43984_-	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	2.4e-115	54.5
WP_099514244.1\|44682_45768_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_099514245.1\|46441_47251_-	APH(6) family putative aminoglycoside O-phosphotransferase	NA	NA	NA	NA
WP_099513287.1\|47361_47751_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_099513288.1\|47737_48013_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_175608894.1\|48862_49144_+	hypothetical protein	NA	NA	NA	NA
WP_099513289.1\|49380_50430_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513290.1\|50550_51252_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_157934359.1\|52288_52504_+	hypothetical protein	NA	NA	NA	NA
WP_099513293.1\|56043_57030_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513295.1\|57988_59254_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.1e-97	47.8
57110:57126	attR	NA	NA	NA	NA
WP_157934360.1\|59518_59827_+	hypothetical protein	NA	NA	NA	NA
57110:57126	attR	NA	NA	NA	NA
WP_099513298.1\|60764_61085_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
57110:57126	attR	NA	NA	NA	NA
WP_099513299.1\|61421_62189_+	response regulator transcription factor	NA	NA	NA	NA
WP_099513300.1\|62475_62751_+\|transposase	transposase	NA	NA	NA	NA
WP_157934361.1\|62985_63393_+	HNH endonuclease	NA	NA	NA	NA
WP_099513302.1\|63494_63905_-	hypothetical protein	NA	NA	NA	NA
WP_099513303.1\|64104_65249_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.6e-50	40.7
WP_099513304.1\|65943_67593_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_157934362.1\|69353_69797_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099513307.1\|69869_70181_-	EthD family reductase	NA	NA	NA	NA
WP_099513308.1\|70414_71710_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513309.1\|71862_72207_+	VanZ family protein	NA	NA	NA	NA
WP_157934363.1\|72242_72422_-	hypothetical protein	NA	NA	NA	NA
WP_157934364.1\|73155_74886_-	hypothetical protein	NA	NA	NA	NA
WP_099513311.1\|75611_76580_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_099508289.1\|76727_77474_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.7e-59	49.0
WP_099508288.1\|77487_79026_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.5e-117	44.5
WP_157934365.1\|79410_79575_+	hypothetical protein	NA	NA	NA	NA
WP_099513312.1\|79641_80786_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-52	41.1
WP_099513313.1\|80844_82545_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_099513315.1\|83773_85423_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_099513316.1\|85483_86005_+\|transposase	transposase	NA	NA	NA	NA
WP_099513317.1\|86074_87538_-	M10 family metallopeptidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_099513318.1\|88249_89394_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.5e-53	41.3
WP_099513319.1\|89488_89743_-	hypothetical protein	NA	NA	NA	NA
WP_099513320.1\|91473_92802_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	7.1e-52	48.1
WP_099513321.1\|93194_93905_+	hypothetical protein	F5B430	Synechococcus_phage	1.3e-15	36.4
WP_099513322.1\|95228_96373_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.7e-52	41.5
WP_099513323.1\|96487_97000_-	acyltransferase	NA	NA	NA	NA
WP_099513324.1\|97524_98511_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513325.1\|99120_100365_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_099513326.1\|101955_102423_-	hypothetical protein	NA	NA	NA	NA
WP_173909537.1\|103011_103608_+	sugar transferase	NA	NA	NA	NA
WP_099513327.1\|104103_104610_+	N-acetyltransferase	NA	NA	NA	NA
WP_099513328.1\|104612_105662_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_099513329.1\|105658_106774_+	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	2.3e-40	30.3
WP_099513330.1\|106844_107846_+	SDR family NAD(P)-dependent oxidoreductase	A0A2K9L0I7	Tupanvirus	2.2e-37	31.6
WP_099513331.1\|107845_109009_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	4.8e-36	28.5
WP_099514247.1\|109366_109834_+	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
WP_157934366.1\|109830_110355_+	glucuronosyltransferase	NA	NA	NA	NA
WP_099513333.1\|110784_111705_+	glycosyltransferase	NA	NA	NA	NA
WP_099513334.1\|113111_114017_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_157934367.1\|114280_115033_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099513336.1\|115017_115221_+\|transposase	transposase	NA	NA	NA	NA
WP_099513337.1\|115301_115694_+\|transposase	transposase	NA	NA	NA	NA
WP_099513338.1\|115690_116035_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_099514248.1\|116110_117535_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	7.3e-63	35.0
WP_099513339.1\|117810_117990_+	hypothetical protein	NA	NA	NA	NA
WP_099513340.1\|117976_120049_+	recombinase family protein	NA	NA	NA	NA
WP_099513341.1\|121526_121916_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.1e-16	61.8
WP_099513342.1\|121927_123148_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	6.4e-07	27.5
WP_099513343.1\|123147_124080_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099513344.1\|124076_125078_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	6.8e-15	29.1
WP_157934368.1\|125034_125277_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_099514249.1\|125273_125648_-\|transposase	transposase	NA	NA	NA	NA
WP_162299236.1\|125729_127124_-	recombinase family protein	Q38184	Lactococcus_phage	1.8e-18	28.2
WP_157934369.1\|127336_128341_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513346.1\|128582_129623_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513347.1\|129868_130411_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_099513348.1\|130407_130983_+\|transposase	transposase	NA	NA	NA	NA
WP_099513349.1\|131333_132194_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.5e-34	35.6
WP_099513350.1\|132206_133406_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099513351.1\|133411_133627_-	hypothetical protein	NA	NA	NA	NA
WP_099509450.1\|134428_135190_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.0e-67	52.7
WP_099509451.1\|135208_136747_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099513352.1\|136901_137657_+\|transposase	transposase	NA	NA	NA	NA
WP_099513353.1\|138196_139225_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	7.7e-06	27.4
WP_099513354.1\|139523_141590_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	3.0e-09	25.4
WP_099513355.1\|141963_142973_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099513356.1\|143167_144508_-	M10 family metallopeptidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_099513357.1\|144817_145681_-	hypothetical protein	K4ICS3	Acidithiobacillus_phage	5.0e-14	44.3
WP_099513358.1\|145834_146668_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157934370.1\|146682_146922_-\|transposase	transposase	NA	NA	NA	NA
WP_099513360.1\|146949_147816_-	hypothetical protein	A0A0U4J920	Pseudomonas_phage	2.3e-11	27.7
WP_099513354.1\|148193_150260_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	3.0e-09	25.4
WP_099513361.1\|150268_150925_-	hypothetical protein	A0A0U4J920	Pseudomonas_phage	1.3e-11	37.5
WP_157934371.1\|151026_151410_+	hypothetical protein	NA	NA	NA	NA
WP_099513362.1\|152008_153046_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513363.1\|153803_154379_-\|transposase	transposase	NA	NA	NA	NA
WP_099508187.1\|154699_155851_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513364.1\|155880_156411_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_099513365.1\|158209_159805_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_157934372.1\|160918_161077_+	hypothetical protein	NA	NA	NA	NA
WP_099513366.1\|161057_161417_-	hypothetical protein	NA	NA	NA	NA
WP_099513367.1\|161415_162556_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.9e-52	41.1
WP_157934373.1\|162522_162660_-	hypothetical protein	NA	NA	NA	NA
WP_099513354.1\|162884_164951_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	3.0e-09	25.4
WP_099513340.1\|165663_167736_-	recombinase family protein	NA	NA	NA	NA
WP_099513339.1\|167722_167902_-	hypothetical protein	NA	NA	NA	NA
WP_099513369.1\|168444_168702_+	hypothetical protein	NA	NA	NA	NA
WP_157934374.1\|168742_169009_+	hypothetical protein	NA	NA	NA	NA
WP_099513370.1\|169228_170347_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157934169.1\|170675_170999_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157934170.1\|170959_171778_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099513371.1\|171992_173336_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_157934375.1\|173740_174577_-	glycosyltransferase	NA	NA	NA	NA
WP_099513373.1\|175572_176714_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-52	41.9
WP_099513374.1\|177955_179353_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_099513375.1\|179349_181497_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.6e-40	28.3
WP_099513376.1\|181516_181843_-	hypothetical protein	NA	NA	NA	NA
WP_099513377.1\|181855_186649_-	DUF4082 domain-containing protein	NA	NA	NA	NA
WP_099513378.1\|188021_188288_-	hypothetical protein	NA	NA	NA	NA
WP_157934376.1\|188481_188742_+	hypothetical protein	NA	NA	NA	NA
WP_157934377.1\|188803_190138_+	hypothetical protein	NA	NA	NA	NA
WP_099513380.1\|190299_191343_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099510510.1\|191567_191990_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099510511.1\|191986_192529_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099513304.1\|193769_195419_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_099509451.1\|195980_197519_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099509450.1\|197537_198299_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.0e-67	52.7
WP_099513381.1\|198442_198730_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	34.0
WP_099513382.1\|199323_200919_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_157934495.1\|203021_204335_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513383.1\|204639_205434_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_099513384.1\|205541_207077_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_099513385.1\|207413_208748_+	polysaccharide biosynthesis/export family protein	NA	NA	NA	NA
WP_099514250.1\|209029_210553_+	O-antigen translocase	NA	NA	NA	NA
WP_157934378.1\|210726_211572_+	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_099513387.1\|214654_215026_+\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	4.6e-09	47.8
WP_099513388.1\|215022_215265_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_099513344.1\|215221_216223_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	6.8e-15	29.1
WP_099513343.1\|216219_217152_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099513342.1\|217151_218372_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	6.4e-07	27.5
WP_157934379.1\|218895_219084_+	hypothetical protein	NA	NA	NA	NA
WP_099513389.1\|219061_221146_+	recombinase family protein	R9TP69	Rhizobium_phage	1.2e-05	24.7
WP_099513390.1\|221153_221330_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_099513391.1\|221338_223402_-	recombinase family protein	NA	NA	NA	NA
WP_099513392.1\|223950_225567_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.4e-101	43.9
WP_099513393.1\|225570_225801_-	hypothetical protein	NA	NA	NA	NA
WP_099513394.1\|226921_228070_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099513395.1\|228054_229053_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099513396.1\|229563_229935_-	hypothetical protein	A0A0F7L6S1	uncultured_marine_virus	5.3e-05	32.8
WP_099513397.1\|230271_231112_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099513398.1\|232746_233972_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.2e-101	68.0

DBSCAN-SWA_2

246440 : 312673

Staphylococcus_phage(14.29%)

integrase,transposase

attL 243620:243635|attR 293550:293565

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
243620:243635	attL	NA	NA	NA	NA
WP_099513406.1\|246440_247142_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	7.1e-27	32.0
WP_099513407.1\|247479_248022_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_099514251.1\|248097_248484_+	hypothetical protein	NA	NA	NA	NA
WP_099513408.1\|249225_250233_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099513409.1\|250229_250814_+	SCO family protein	NA	NA	NA	NA
WP_099513410.1\|250800_253425_+	GAF domain-containing protein	A0A1V0SGX0	Hokovirus	3.4e-29	35.4
WP_173909538.1\|253424_253787_+	response regulator	Q6XM27	Feldmannia_irregularis_virus	5.7e-12	37.5
WP_099513412.1\|253802_254981_+	response regulator	W8CYM9	Bacillus_phage	2.5e-16	36.7
WP_099513413.1\|255153_256161_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099513414.1\|257637_258339_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099513289.1\|258459_259509_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513415.1\|260365_261394_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099513416.1\|261735_262731_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_173909543.1\|263541_264417_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099513418.1\|264509_265733_+	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_099514252.1\|265747_266311_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_099513419.1\|266523_267678_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513420.1\|268349_269564_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099509201.1\|269576_270452_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	4.4e-34	34.9
WP_099513421.1\|270796_271855_+	nuclease	NA	NA	NA	NA
WP_099514253.1\|271913_272591_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_099513422.1\|272826_273681_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_099513423.1\|274236_274938_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	7.1e-27	32.0
WP_099513424.1\|275341_276838_+	amidase	NA	NA	NA	NA
WP_099513425.1\|278237_279002_+	creatininase family protein	NA	NA	NA	NA
WP_099513426.1\|279047_280172_+	hydantoinase/carbamoylase family amidase	NA	NA	NA	NA
WP_099513427.1\|280219_281444_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.8e-102	68.4
WP_099513428.1\|282076_283981_-	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_099513429.1\|284744_285428_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	9.1e-11	50.0
WP_099513430.1\|285504_286287_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	3.4e-14	30.4
WP_099514254.1\|286306_286792_-	2,4'-dihydroxyacetophenone dioxygenase family protein	NA	NA	NA	NA
WP_099513431.1\|286821_288318_-	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_099513432.1\|288324_288798_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_099513433.1\|288908_289880_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_099513434.1\|289803_290640_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_099513435.1\|290647_291295_-	RraA family protein	E3T536	Cafeteria_roenbergensis_virus	4.5e-12	22.7
WP_157934388.1\|291413_292328_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_099513437.1\|292643_293447_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_099513438.1\|293564_293999_+	VOC family protein	NA	NA	NA	NA
293550:293565	attR	NA	NA	NA	NA
WP_099513439.1\|294008_295184_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.8e-46	31.9
WP_099513440.1\|295202_296351_+	mannonate dehydratase	NA	NA	NA	NA
WP_099513441.1\|296387_297605_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099514255.1\|297727_298531_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_099514256.1\|298641_299388_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_099513442.1\|299397_300204_+	aldo/keto reductase	A0A1V0SDE7	Indivirus	2.5e-28	31.8
WP_099513443.1\|300229_300967_+	ribonuclease activity regulator RraA	NA	NA	NA	NA
WP_099513444.1\|303906_304284_-	hypothetical protein	NA	NA	NA	NA
WP_157934389.1\|304613_305093_+	hypothetical protein	NA	NA	NA	NA
WP_099513446.1\|306205_306904_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.4e-61	53.4
WP_099513447.1\|306976_307384_+	hypothetical protein	NA	NA	NA	NA
WP_099513448.1\|307516_307741_-	response regulator transcription factor	NA	NA	NA	NA
WP_099513450.1\|308919_309618_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	7.2e-64	55.2
WP_162299237.1\|309656_310064_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_162299238.1\|310240_310876_-	FCD domain-containing protein	NA	NA	NA	NA
WP_099508213.1\|311335_312673_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

320172 : 383528

Escherichia_phage(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513459.1\|320172_320871_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.8e-43	46.5
WP_099513460.1\|321219_321588_-	phasin family protein	NA	NA	NA	NA
WP_099513461.1\|321966_322665_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.7e-60	52.6
WP_099513462.1\|326773_327718_+	pirin family protein	NA	NA	NA	NA
WP_099513463.1\|327891_328200_-	hypothetical protein	NA	NA	NA	NA
WP_099513464.1\|328435_329938_-	amidase	NA	NA	NA	NA
WP_099513465.1\|330018_330696_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.4e-27	43.4
WP_099513466.1\|331179_332112_+	aldo/keto reductase	NA	NA	NA	NA
WP_099513467.1\|332111_332816_+	MFS transporter permease	NA	NA	NA	NA
WP_162299239.1\|332961_334350_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_157934392.1\|334436_334709_-	heme-binding protein	NA	NA	NA	NA
WP_099513470.1\|334955_336233_-	DUF2183 domain-containing protein	NA	NA	NA	NA
WP_099511964.1\|336678_338457_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513471.1\|338498_340421_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513472.1\|340509_341364_-	transporter substrate-binding domain-containing protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.1e-53	41.9
WP_099513473.1\|341766_342681_-	alpha/beta hydrolase	A0A2R8FCY4	Cedratvirus	4.0e-06	30.9
WP_099513474.1\|342808_343573_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-18	31.9
WP_099513475.1\|343691_344618_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099513476.1\|344841_345651_-	aquaporin family protein	NA	NA	NA	NA
WP_099513477.1\|345640_346957_-	family 1 glycosylhydrolase	NA	NA	NA	NA
WP_099513478.1\|347167_347959_-	alpha/beta hydrolase	G1DB77	Mycobacterium_phage	7.0e-07	35.7
WP_099513479.1\|348331_349450_+	serine hydrolase	NA	NA	NA	NA
WP_099514258.1\|349370_350014_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.5e-42	44.7
WP_157934394.1\|350006_350402_+	hypothetical protein	NA	NA	NA	NA
WP_099513481.1\|350855_352184_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513482.1\|353110_353347_+	hypothetical protein	NA	NA	NA	NA
WP_099514259.1\|354239_355445_-	MFS transporter	NA	NA	NA	NA
WP_099513484.1\|355496_356927_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_099513485.1\|356941_357193_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_099513486.1\|357248_357566_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513487.1\|357877_359413_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_099513488.1\|359695_359881_-	hypothetical protein	A0A2H4J5V6	uncultured_Caudovirales_phage	9.2e-11	67.3
WP_099513489.1\|360496_361549_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.9e-05	25.8
WP_099513490.1\|361733_362381_+	hypothetical protein	NA	NA	NA	NA
WP_099513491.1\|362295_363648_-\|transposase	transposase	NA	NA	NA	NA
WP_099513492.1\|363659_365165_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	1.3e-17	33.7
WP_099513493.1\|365321_366257_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-14	38.7
WP_157934395.1\|366448_366919_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.8e-08	40.9
WP_099513495.1\|367410_367800_+	hypothetical protein	NA	NA	NA	NA
WP_099513497.1\|368493_368709_+	hypothetical protein	NA	NA	NA	NA
WP_099514260.1\|369170_369776_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_173909539.1\|370385_371213_-	hypothetical protein	NA	NA	NA	NA
WP_099511788.1\|371591_372360_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099513498.1\|373438_373981_-	YqhA family protein	NA	NA	NA	NA
WP_099513499.1\|374360_374528_+	nitronate monooxygenase	NA	NA	NA	NA
WP_157934396.1\|374610_374739_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_099513501.1\|375197_376385_-	MFS transporter	NA	NA	NA	NA
WP_099513502.1\|376481_377543_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_099513503.1\|377636_379850_+	amylo-alpha-1,6-glucosidase	NA	NA	NA	NA
WP_157933981.1\|380496_380940_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099513504.1\|381221_382247_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513505.1\|382559_383528_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.3e-47	35.6

DBSCAN-SWA_4

455931 : 501375

Streptococcus_phage(28.57%)

integrase,transposase

attL 455643:455662|attR 499705:499724

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
455643:455662	attL	NA	NA	NA	NA
WP_099508970.1\|455931_457386_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099514267.1\|457637_458858_+	DUF1254 domain-containing protein	A0A1J0FA30	Only_Syngen_Nebraska_virus	8.2e-39	28.4
WP_099513570.1\|458903_460370_+	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_099513571.1\|460820_461087_-	hypothetical protein	NA	NA	NA	NA
WP_099513572.1\|461372_462575_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513573.1\|462841_463735_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099513574.1\|463906_464962_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_099513575.1\|465043_466270_+	MFS transporter	NA	NA	NA	NA
WP_099513576.1\|466266_466740_+	MFS transporter	NA	NA	NA	NA
WP_099513419.1\|466946_468101_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513577.1\|468772_469987_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099509486.1\|469999_470875_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.3e-33	34.6
WP_099513578.1\|471224_472121_-	pirin family protein	NA	NA	NA	NA
WP_099513579.1\|472330_473014_+	HAD family phosphatase	A7J6N1	Paramecium_bursaria_Chlorella_virus	3.3e-13	29.2
WP_099513580.1\|473105_474095_-	3',5'-cyclic-nucleotide phosphodiesterase	NA	NA	NA	NA
WP_099514268.1\|474349_474646_+	MliC family protein	NA	NA	NA	NA
WP_099514269.1\|474744_475263_-	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_099513581.1\|475297_475720_-	ester cyclase	NA	NA	NA	NA
WP_099513582.1\|476193_476823_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_173909544.1\|476928_477336_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_099513583.1\|477469_478351_-	VOC family protein	NA	NA	NA	NA
WP_099513584.1\|478672_479821_+	MFS transporter	NA	NA	NA	NA
WP_099513585.1\|479817_480978_-	hypothetical protein	NA	NA	NA	NA
WP_099513586.1\|480989_482750_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513587.1\|482897_483203_-	UBP-type zinc finger domain-containing protein	NA	NA	NA	NA
WP_099514271.1\|483202_484891_-	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	5.5e-25	30.7
WP_099513588.1\|485064_485952_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_099513589.1\|487448_487937_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_099513590.1\|488257_488623_-	hypothetical protein	NA	NA	NA	NA
WP_099513591.1\|488919_489111_+	hypothetical protein	NA	NA	NA	NA
WP_099513592.1\|489243_490308_-	putative zinc-binding peptidase	NA	NA	NA	NA
WP_099513593.1\|490635_491568_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_157934405.1\|491690_491918_-	hypothetical protein	NA	NA	NA	NA
WP_099513594.1\|492041_494021_-	AI-2E family transporter	NA	NA	NA	NA
WP_099513595.1\|494111_494336_-	hypothetical protein	NA	NA	NA	NA
WP_099513596.1\|494387_495566_+	DUF2382 domain-containing protein	NA	NA	NA	NA
WP_099513597.1\|495942_496182_+	hypothetical protein	NA	NA	NA	NA
WP_099513598.1\|496784_498008_+	GAF domain-containing protein	NA	NA	NA	NA
WP_099513599.1\|498357_499383_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	1.3e-05	29.6
WP_099513600.1\|500214_500616_+	tyrosine-protein phosphatase	NA	NA	NA	NA
499705:499724	attR	NA	NA	NA	NA
WP_099513601.1\|500655_501375_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.0e-24	33.5

DBSCAN-SWA_5

539488 : 599287

Rhizobium_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513636.1\|539488_540445_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099513637.1\|540659_541577_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.4e-38	42.4
WP_157934412.1\|541628_542021_+	hypothetical protein	NA	NA	NA	NA
WP_099513639.1\|542152_542425_-	hypothetical protein	NA	NA	NA	NA
WP_157934413.1\|542676_543222_+	hypothetical protein	NA	NA	NA	NA
WP_157934414.1\|543578_543857_+	hypothetical protein	NA	NA	NA	NA
WP_099513641.1\|544020_544227_+	DUF3563 family protein	NA	NA	NA	NA
WP_099513642.1\|544590_545772_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099514274.1\|546271_547492_-	cytochrome C	NA	NA	NA	NA
WP_157934415.1\|547753_548140_+	hypothetical protein	NA	NA	NA	NA
WP_099513644.1\|548453_548837_+	hypothetical protein	L7TKN6	Rhizobium_phage	3.4e-15	43.1
WP_099513645.1\|549052_549301_+	WGR domain-containing protein	NA	NA	NA	NA
WP_099513646.1\|549553_551452_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.3e-103	36.0
WP_099513647.1\|551567_552569_-	3'-5' exonuclease	A0A076YPV2	Rhizobium_phage	1.2e-22	31.6
WP_099513648.1\|552841_554320_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.3e-50	33.4
WP_099513649.1\|554494_555187_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_099513652.1\|556927_559126_-	ATP-dependent RecD-like DNA helicase	U5J9B0	Bacillus_phage	6.2e-61	30.2
WP_099513653.1\|559451_559649_-	stress-induced protein	NA	NA	NA	NA
WP_099513654.1\|560468_560744_-	hypothetical protein	NA	NA	NA	NA
WP_099514275.1\|561023_561608_+	hypothetical protein	NA	NA	NA	NA
WP_157934416.1\|561747_561954_-	hypothetical protein	NA	NA	NA	NA
WP_099513655.1\|561965_565229_-	error-prone DNA polymerase	A0A0K1Y8T6	Streptomyces_phage	1.9e-90	26.1
WP_099513656.1\|565225_566725_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_099513657.1\|566657_567392_-	damage-inducible mutagenesis protein	NA	NA	NA	NA
WP_099514276.1\|567760_568018_+	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_099513658.1\|568380_569349_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.7e-50	37.2
WP_099513659.1\|569652_570513_+	EcsC family protein	NA	NA	NA	NA
WP_099510310.1\|571099_572140_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513660.1\|572256_573249_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513661.1\|573454_574759_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_099513662.1\|574917_575343_+	hypothetical protein	NA	NA	NA	NA
WP_099513663.1\|575339_576056_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.6e-20	35.2
WP_099513664.1\|576073_577315_+	ABC transporter permease	NA	NA	NA	NA
WP_099513665.1\|577468_578824_-	8-oxoguanine deaminase	NA	NA	NA	NA
WP_099513666.1\|579206_579470_+	hypothetical protein	NA	NA	NA	NA
WP_099513667.1\|579557_581468_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	3.1e-64	30.9
WP_099513668.1\|581641_581824_+	hypothetical protein	NA	NA	NA	NA
WP_099513669.1\|581820_582636_-	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_099513670.1\|582672_583665_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_099513671.1\|583689_583917_-	hypothetical protein	NA	NA	NA	NA
WP_099513672.1\|584492_586412_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513673.1\|586717_587350_+	response regulator transcription factor	NA	NA	NA	NA
WP_099514277.1\|587558_588341_-	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_162299240.1\|589694_589841_+	hypothetical protein	NA	NA	NA	NA
WP_099514278.1\|590182_590581_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513675.1\|590866_592618_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099513676.1\|593237_593744_+	hypothetical protein	NA	NA	NA	NA
WP_099513678.1\|594021_594672_+	hypothetical protein	NA	NA	NA	NA
WP_099513679.1\|594843_596049_+	murein L,D-transpeptidase	NA	NA	NA	NA
WP_099513680.1\|597020_597650_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513681.1\|598318_599287_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	5.3e-49	36.8

DBSCAN-SWA_6

659770 : 711986

Bacillus_phage(28.57%)

integrase,transposase

attL 687216:687233|attR 724056:724073

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157933989.1\|659770_661258_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|661254_662022_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_099513730.1\|662275_663010_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099513731.1\|663325_663547_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_173909547.1\|663868_664873_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_099513733.1\|665047_666475_-	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_099514285.1\|666989_668243_+	threonine synthase	NA	NA	NA	NA
WP_099513734.1\|668660_669413_-	damage-inducible mutagenesis protein	NA	NA	NA	NA
WP_099513735.1\|669667_670816_-	DNA polymerase IV	I6RSM4	Salmonella_phage	7.5e-18	27.1
WP_099513736.1\|670888_673006_-	ATP-dependent helicase	A7KV33	Bacillus_phage	6.0e-69	29.5
WP_099513737.1\|673136_674177_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	4.2e-116	63.7
WP_099513738.1\|675985_676558_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_099513739.1\|676677_677007_-	glutathione S-transferase C-terminal domain-containing protein	NA	NA	NA	NA
WP_157934424.1\|677467_679096_-	hypothetical protein	NA	NA	NA	NA
WP_099513741.1\|679466_681260_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099513742.1\|681535_683494_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099513743.1\|683749_684379_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_099513744.1\|684494_685418_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099514286.1\|685788_687057_+	low temperature requirement protein A	NA	NA	NA	NA
687216:687233	attL	NA	NA	NA	NA
WP_099513745.1\|687348_688290_+\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	1.0e-12	25.3
WP_162299242.1\|688434_688785_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099513748.1\|689262_689517_-	hypothetical protein	NA	NA	NA	NA
WP_099513749.1\|689526_689871_-	hypothetical protein	NA	NA	NA	NA
WP_157934425.1\|690122_690662_+	hypothetical protein	NA	NA	NA	NA
WP_099513751.1\|691099_691453_-	hypothetical protein	NA	NA	NA	NA
WP_099513752.1\|692141_692552_+	hypothetical protein	NA	NA	NA	NA
WP_099513753.1\|692907_694203_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513754.1\|694468_695416_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_099513755.1\|695418_696630_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099514287.1\|696875_697292_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162299243.1\|697600_698053_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_099513757.1\|698045_698729_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_099513758.1\|698775_699219_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_099513759.1\|699215_699536_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513760.1\|699638_700112_+	VOC family protein	NA	NA	NA	NA
WP_099513761.1\|700309_700756_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099513762.1\|700823_702068_+	MFS transporter	NA	NA	NA	NA
WP_099513763.1\|702404_703889_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.2e-172	64.2
WP_099514288.1\|704197_705751_-	acetolactate synthase large subunit	NA	NA	NA	NA
WP_099513764.1\|706167_706716_-	hypothetical protein	NA	NA	NA	NA
WP_099513765.1\|706817_707099_-	hypothetical protein	NA	NA	NA	NA
WP_099513766.1\|707230_707833_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_099513419.1\|708057_709212_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513577.1\|709883_711098_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099509486.1\|711110_711986_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.3e-33	34.6
724056:724073	attR	NA	NA	NA	NA

DBSCAN-SWA_7

722531 : 844144

114

Rhizobium_phage(15.38%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513774.1\|722531_723830_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513775.1\|724220_725003_-	porin family protein	NA	NA	NA	NA
WP_099513776.1\|725512_726616_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_099513777.1\|726747_727116_+	hypothetical protein	NA	NA	NA	NA
WP_099514290.1\|727891_728056_+	periplasmic nitrate reductase, NapE protein	NA	NA	NA	NA
WP_099513778.1\|728070_728364_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_099513779.1\|728360_728618_+	chaperone NapD	NA	NA	NA	NA
WP_099513780.1\|728622_731142_+	periplasmic nitrate reductase subunit alpha	A0A077SK27	Escherichia_phage	8.2e-09	22.6
WP_099513781.1\|731138_731612_+	nitrate reductase cytochrome c-type subunit	NA	NA	NA	NA
WP_099513782.1\|731611_732229_+	NapC/NirT family cytochrome c	NA	NA	NA	NA
WP_099513783.1\|732233_732782_+	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_099513784.1\|735291_735810_+	hypothetical protein	NA	NA	NA	NA
WP_099513785.1\|736610_736799_-	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_099513786.1\|736997_737879_+	Ku protein	NA	NA	NA	NA
WP_099513787.1\|737913_740493_+	DNA ligase D	A0A068CDF3	Rhizobium_phage	6.2e-60	41.5
WP_099513788.1\|740957_741431_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_157934429.1\|741444_742083_-	restriction endonuclease	NA	NA	NA	NA
WP_099513791.1\|743190_744339_+	helix-turn-helix domain-containing protein	L7TKN6	Rhizobium_phage	3.0e-59	40.4
WP_099513792.1\|744466_744715_+	hypothetical protein	NA	NA	NA	NA
WP_099513793.1\|745119_745437_+	hypothetical protein	NA	NA	NA	NA
WP_099513794.1\|746249_747091_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157934430.1\|747933_748335_+	response regulator	NA	NA	NA	NA
WP_099513796.1\|748882_749191_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_162299244.1\|749242_749644_-	hypothetical protein	NA	NA	NA	NA
WP_157934432.1\|749718_749889_-	hypothetical protein	NA	NA	NA	NA
WP_157934433.1\|750562_750937_+	DUF433 domain-containing protein	NA	NA	NA	NA
WP_099513799.1\|751055_752282_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_099513800.1\|752889_753924_+	AAA family ATPase	NA	NA	NA	NA
WP_099513801.1\|753920_754418_+	hypothetical protein	NA	NA	NA	NA
WP_157934434.1\|754525_755482_+	hypothetical protein	NA	NA	NA	NA
WP_099513803.1\|755710_756001_+	hypothetical protein	NA	NA	NA	NA
WP_157934435.1\|756106_756265_+	hypothetical protein	NA	NA	NA	NA
WP_099513804.1\|756261_756699_+	hypothetical protein	NA	NA	NA	NA
WP_157934436.1\|756786_758316_-	hypothetical protein	NA	NA	NA	NA
WP_099513806.1\|759644_760565_-	hypothetical protein	NA	NA	NA	NA
WP_099513807.1\|761316_761682_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_099513808.1\|761678_761903_-	antitoxin MazE family protein	NA	NA	NA	NA
WP_099513809.1\|762699_762954_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_099513810.1\|764698_765856_-	hypothetical protein	NA	NA	NA	NA
WP_157934437.1\|766121_766481_+	DUF3572 domain-containing protein	NA	NA	NA	NA
WP_099513812.1\|766617_767061_-	PIN domain-containing protein	NA	NA	NA	NA
WP_099513813.1\|767061_767304_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_099513814.1\|767518_767854_-	hemolysin III family protein	NA	NA	NA	NA
WP_099513815.1\|768034_768262_-	hypothetical protein	NA	NA	NA	NA
WP_099510511.1\|768373_768916_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099510510.1\|768912_769335_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099513774.1\|769627_770926_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513816.1\|771613_771961_-	hypothetical protein	NA	NA	NA	NA
WP_157934438.1\|772060_772279_-	hypothetical protein	T1SAR8	Salmonella_phage	5.6e-07	51.9
WP_099513818.1\|772572_773106_+	hypothetical protein	NA	NA	NA	NA
WP_099513819.1\|773408_774269_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_157934439.1\|775126_775408_+	hypothetical protein	NA	NA	NA	NA
WP_099513821.1\|775564_776254_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_099514291.1\|776520_777372_-	transglycosylase SLT domain-containing protein	A0A0K2CNS6	Brevibacillus_phage	1.9e-05	28.6
WP_099513822.1\|777633_778272_+	hypothetical protein	NA	NA	NA	NA
WP_099509475.1\|778759_779827_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	8.0e-06	28.6
WP_099513823.1\|780096_780537_+	hypothetical protein	NA	NA	NA	NA
WP_099513824.1\|780696_781680_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513824.1\|783096_784080_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099513825.1\|784684_784909_-	DUF3563 family protein	NA	NA	NA	NA
WP_099513826.1\|785053_785332_-	hypothetical protein	NA	NA	NA	NA
WP_099513827.1\|785588_785891_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099513829.1\|786443_786716_+	hypothetical protein	NA	NA	NA	NA
WP_099513830.1\|787003_787273_+	hypothetical protein	NA	NA	NA	NA
WP_099513831.1\|787735_788242_-	hypothetical protein	NA	NA	NA	NA
WP_157934440.1\|788556_788874_+	hypothetical protein	NA	NA	NA	NA
WP_157934441.1\|789047_789407_-	hypothetical protein	NA	NA	NA	NA
WP_099513834.1\|791149_791353_-	hypothetical protein	NA	NA	NA	NA
WP_099508970.1\|791806_793261_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099513835.1\|793474_794701_+\|transposase	transposase	NA	NA	NA	NA
WP_099513836.1\|794650_794971_-	hypothetical protein	NA	NA	NA	NA
WP_099513837.1\|794967_795180_-	hypothetical protein	NA	NA	NA	NA
WP_099513838.1\|795172_795418_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_099513839.1\|795674_796460_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099514292.1\|796905_797931_+	purine nucleoside permease	NA	NA	NA	NA
WP_099514293.1\|798061_799000_+	nucleoside hydrolase	NA	NA	NA	NA
WP_099513841.1\|799161_800460_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513842.1\|800768_801077_+	SWIB/MDM2 domain-containing protein	NA	NA	NA	NA
WP_162299245.1\|801161_801650_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	9.0e-13	45.3
WP_099513845.1\|802053_802347_-	hypothetical protein	NA	NA	NA	NA
WP_162299246.1\|802315_802993_-	hypothetical protein	A0A291AUP8	Sinorhizobium_phage	4.4e-42	40.4
WP_099513847.1\|804426_804924_+	3'-5' exonuclease	A0A1X9SH08	Bradyrhizobium_phage	1.5e-10	28.0
WP_099513848.1\|804923_806975_+	ATP-dependent helicase	S5M596	Bacillus_phage	8.4e-44	27.1
WP_099513849.1\|807008_807329_-	hypothetical protein	NA	NA	NA	NA
WP_099513850.1\|807689_808571_+	alpha/beta hydrolase	A0A1I9SAY0	Mycobacterium_phage	2.4e-16	32.0
WP_099513851.1\|808904_809429_-	cytochrome P460 family protein	NA	NA	NA	NA
WP_099513852.1\|809457_810828_-	peroxidase	NA	NA	NA	NA
WP_099514294.1\|810883_811483_-	hypothetical protein	NA	NA	NA	NA
WP_099513853.1\|811575_812709_-	catalase family protein	NA	NA	NA	NA
WP_099513855.1\|812962_813952_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_099513856.1\|813935_816281_-	ABC transporter permease	NA	NA	NA	NA
WP_099513857.1\|816280_817366_-	HlyD family secretion protein	NA	NA	NA	NA
WP_099513858.1\|817379_818216_-	3-hydroxybutyrate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-07	27.1
WP_099513859.1\|818199_818985_-	acetoacetate decarboxylase	NA	NA	NA	NA
WP_173909548.1\|819116_820250_-	DUF3734 domain-containing protein	NA	NA	NA	NA
WP_099513861.1\|821093_822074_+	catalase family peroxidase	NA	NA	NA	NA
WP_099513862.1\|822212_823358_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_099513863.1\|823354_826519_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_099513864.1\|826846_828355_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_099513865.1\|830023_830278_+	hypothetical protein	NA	NA	NA	NA
WP_099514295.1\|830291_831635_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_099511583.1\|831747_831987_+	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_099513866.1\|831983_832763_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_173909549.1\|833067_833916_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_099513868.1\|833966_835157_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_099513869.1\|835234_835864_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_099513870.1\|835905_836376_+	MaoC family dehydratase	NA	NA	NA	NA
WP_099514296.1\|836379_837033_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_099513871.1\|837153_838365_+	HlyD family secretion protein	NA	NA	NA	NA
WP_099514297.1\|838419_840012_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_099513873.1\|840354_841662_-	family 1 glycosylhydrolase	NA	NA	NA	NA
WP_099513874.1\|841699_842572_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_099514298.1\|842626_843385_-	DMT family transporter	NA	NA	NA	NA
WP_099513875.1\|843433_844144_-\|transposase	IS6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

932860 : 978235

Leptospira_phage(25.0%)

integrase,transposase

attL 937043:937060|attR 983049:983066

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513955.1\|932860_933736_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.3e-33	34.6
WP_099513956.1\|933748_934963_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099513957.1\|935498_935795_-	hypothetical protein	NA	NA	NA	NA
WP_099513958.1\|935827_936646_-	DUF899 domain-containing protein	NA	NA	NA	NA
WP_099513959.1\|936768_937989_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
937043:937060	attL	NA	NA	NA	NA
WP_099513960.1\|937998_938658_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_162299247.1\|938863_939658_-	DUF899 domain-containing protein	NA	NA	NA	NA
WP_157934453.1\|939656_940043_+	hypothetical protein	NA	NA	NA	NA
WP_099513962.1\|940235_940646_-	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_099513963.1\|940629_940836_-	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_099513964.1\|941148_941478_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_099513965.1\|942146_942794_-	glutathione transferase GstA	NA	NA	NA	NA
WP_099513966.1\|942925_943843_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099513967.1\|944422_945295_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	6.7e-35	38.5
WP_099513968.1\|945308_946055_+	DUF4336 domain-containing protein	NA	NA	NA	NA
WP_099513969.1\|946302_946875_-	CarD family transcriptional regulator	NA	NA	NA	NA
WP_099513970.1\|948175_948940_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_099513971.1\|948936_949827_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_099513972.1\|949999_950746_-	response regulator transcription factor	NA	NA	NA	NA
WP_099513974.1\|951515_952073_+	hypothetical protein	NA	NA	NA	NA
WP_157934454.1\|952777_952945_-	hypothetical protein	NA	NA	NA	NA
WP_099513975.1\|953102_953381_+	SemiSWEET transporter	NA	NA	NA	NA
WP_099513976.1\|953384_953726_+	hypothetical protein	NA	NA	NA	NA
WP_099513977.1\|953924_954830_+	DUF2243 domain-containing protein	NA	NA	NA	NA
WP_099513978.1\|954850_955513_-	hypothetical protein	NA	NA	NA	NA
WP_099513979.1\|956124_957036_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_099513980.1\|957110_957590_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_099513981.1\|958454_959732_+	DUF2183 domain-containing protein	NA	NA	NA	NA
WP_099513982.1\|960026_960626_+	cysteine hydrolase	NA	NA	NA	NA
WP_099513983.1\|960752_961034_-	hypothetical protein	NA	NA	NA	NA
WP_099513355.1\|961091_962100_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099513354.1\|962474_964541_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	3.0e-09	25.4
WP_173909542.1\|964765_965935_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_099513985.1\|966179_966674_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_099514313.1\|966852_967917_+	putative zinc-binding peptidase	NA	NA	NA	NA
WP_157934455.1\|967998_968190_-	hypothetical protein	NA	NA	NA	NA
WP_157934456.1\|968226_968535_+	response regulator	NA	NA	NA	NA
WP_099513987.1\|968806_969607_+	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_099513988.1\|969877_970087_+	hypothetical protein	NA	NA	NA	NA
WP_157934457.1\|970144_970432_+	hypothetical protein	NA	NA	NA	NA
WP_157934458.1\|970542_970704_-	hypothetical protein	NA	NA	NA	NA
WP_099513990.1\|970721_971687_-	hypothetical protein	NA	NA	NA	NA
WP_099511638.1\|972774_974070_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099513992.1\|974389_974776_-	hypothetical protein	NA	NA	NA	NA
WP_157934460.1\|974750_977057_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099513993.1\|977047_978235_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J790	uncultured_Caudovirales_phage	1.9e-08	28.5
983049:983066	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1014779 : 1074382

Mycobacterium_phage(33.33%)

integrase,transposase,protease

attL 1026122:1026136|attR 1074232:1074246

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514025.1\|1014779_1015481_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099513884.1\|1015968_1017315_-\|transposase	transposase	NA	NA	NA	NA
WP_157934446.1\|1017377_1017656_+	hypothetical protein	NA	NA	NA	NA
WP_157934464.1\|1017675_1018356_+	hypothetical protein	NA	NA	NA	NA
WP_099514027.1\|1019136_1020549_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_099514028.1\|1020545_1022594_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_099514029.1\|1022574_1024410_-	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_099514030.1\|1024435_1025443_-	NADPH:quinone reductase	NA	NA	NA	NA
WP_099514031.1\|1025475_1026468_-	ABC transporter ATP-binding protein	A0A1V0SI78	Klosneuvirus	2.8e-05	30.6
1026122:1026136	attL	NA	NA	NA	NA
WP_099514032.1\|1026464_1027484_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-11	26.8
WP_099514033.1\|1027480_1028404_-	ABC transporter permease	NA	NA	NA	NA
WP_099514034.1\|1028369_1029347_-	ABC transporter permease	NA	NA	NA	NA
WP_099514315.1\|1029508_1031155_-	twin-arginine translocation pathway signal protein	NA	NA	NA	NA
WP_099514035.1\|1031216_1031972_-	hydrogenase expression protein HupH	NA	NA	NA	NA
WP_099514036.1\|1032095_1032911_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_099514037.1\|1033238_1034966_+	M28 family peptidase	NA	NA	NA	NA
WP_099514038.1\|1036421_1038185_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_099514039.1\|1038199_1038961_-	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_162299249.1\|1038972_1039860_-	c-type cytochrome	NA	NA	NA	NA
WP_099514041.1\|1040844_1042455_-	Na+/H+ antiporter	A0A2H4J178	uncultured_Caudovirales_phage	1.3e-07	30.6
WP_157934465.1\|1042703_1043183_+	hypothetical protein	NA	NA	NA	NA
WP_099514043.1\|1043401_1043656_+	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_099514044.1\|1043777_1044353_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_099514316.1\|1044973_1045375_-	hypothetical protein	NA	NA	NA	NA
WP_099514045.1\|1045752_1046634_+	alpha/beta hydrolase	A0A1I9SAY0	Mycobacterium_phage	2.7e-15	31.2
WP_099514046.1\|1046820_1049019_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_099514047.1\|1049022_1050015_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_099514048.1\|1050017_1050617_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	6.5e-21	37.7
WP_099514049.1\|1052188_1052530_-	hypothetical protein	NA	NA	NA	NA
WP_099514050.1\|1052676_1054110_-	hypothetical protein	NA	NA	NA	NA
WP_099514051.1\|1054503_1055232_-	dimethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_099514052.1\|1055228_1056437_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_099514053.1\|1057131_1058367_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	7.2e-91	46.0
WP_099514054.1\|1059399_1060338_+	nucleoside hydrolase	NA	NA	NA	NA
WP_099514055.1\|1060598_1060808_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.3e-10	54.9
WP_099514056.1\|1061697_1062105_+	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_157934466.1\|1062183_1064112_+\|protease	ATP-dependent zinc metalloprotease FtsH	A9YVR1	Ostreococcus_tauri_virus	9.4e-114	42.7
WP_099514057.1\|1064338_1065307_+	tyrosine recombinase	A0A142K7N4	Mycobacterium_phage	3.0e-15	27.8
WP_099514058.1\|1065570_1065825_-	WGR domain-containing protein	NA	NA	NA	NA
WP_099514059.1\|1065840_1066530_-	hypothetical protein	NA	NA	NA	NA
WP_099514060.1\|1067661_1067931_+	hypothetical protein	NA	NA	NA	NA
WP_099514062.1\|1069634_1070849_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099514063.1\|1071232_1071745_-	hypothetical protein	NA	NA	NA	NA
WP_099514064.1\|1071955_1072219_+	hypothetical protein	NA	NA	NA	NA
WP_157933989.1\|1072894_1074382_+\|transposase	IS21 family transposase	NA	NA	NA	NA
1074232:1074246	attR	NA	NA	NA	NA

DBSCAN-SWA_10

1085743 : 1106773

Escherichia_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514319.1\|1085743_1086289_-\|transposase	transposase	NA	NA	NA	NA
WP_099514077.1\|1086613_1087765_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514078.1\|1088102_1089356_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	4.6e-45	36.5
WP_099514079.1\|1089352_1090081_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.3e-33	43.0
WP_099510694.1\|1090023_1091164_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.9e-54	42.8
WP_099514080.1\|1091943_1092309_-	NUDIX hydrolase	NA	NA	NA	NA
WP_099514081.1\|1092351_1094166_-	hypothetical protein	NA	NA	NA	NA
WP_099514082.1\|1094162_1094885_-	hypothetical protein	NA	NA	NA	NA
WP_099514083.1\|1095067_1095295_+	hypothetical protein	NA	NA	NA	NA
WP_099514084.1\|1095528_1095783_+	hypothetical protein	NA	NA	NA	NA
WP_099514085.1\|1096123_1101079_-	AAA family ATPase	NA	NA	NA	NA
WP_099513636.1\|1101196_1102153_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099514086.1\|1103006_1104152_+	replication protein C	L7TKN6	Rhizobium_phage	3.5e-55	37.4
WP_099514087.1\|1104346_1104967_+	HNH endonuclease	A0A0F6YR61	Sinorhizobium_phage	5.1e-21	45.5
WP_099514088.1\|1105402_1106773_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1149873 : 1272476

Sinorhizobium_phage(11.76%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099510511.1\|1149873_1150416_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157934475.1\|1150693_1151185_+	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	1.3e-11	36.4
WP_099514125.1\|1151568_1151934_+	hypothetical protein	NA	NA	NA	NA
WP_099514126.1\|1151902_1152433_-	hypothetical protein	NA	NA	NA	NA
WP_157934476.1\|1152706_1153057_-	hypothetical protein	NA	NA	NA	NA
WP_157934477.1\|1153067_1153229_+	hypothetical protein	NA	NA	NA	NA
WP_099514129.1\|1153471_1153840_-	hypothetical protein	NA	NA	NA	NA
WP_099514130.1\|1153972_1155007_-	methyltransferase	NA	NA	NA	NA
WP_099514325.1\|1156215_1156560_+	hypothetical protein	NA	NA	NA	NA
WP_099514326.1\|1157051_1157333_+	hypothetical protein	NA	NA	NA	NA
WP_099514133.1\|1157379_1158198_+	transglutaminase family protein	NA	NA	NA	NA
WP_099514134.1\|1158382_1158577_-	hypothetical protein	NA	NA	NA	NA
WP_173909551.1\|1158978_1160016_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.2e-115	63.0
WP_099514136.1\|1160494_1160725_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099514137.1\|1162026_1162809_-	hypothetical protein	NA	NA	NA	NA
WP_099514139.1\|1163327_1164680_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_099514140.1\|1164996_1165236_+	hypothetical protein	NA	NA	NA	NA
WP_157934478.1\|1166558_1166885_+	hypothetical protein	NA	NA	NA	NA
WP_157934479.1\|1166919_1167162_+	hypothetical protein	NA	NA	NA	NA
WP_099514141.1\|1167213_1167960_-	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	1.5e-14	35.1
WP_099514142.1\|1168176_1168362_-	CsbD family protein	NA	NA	NA	NA
WP_099514143.1\|1168463_1170086_-	PAS domain S-box protein	NA	NA	NA	NA
WP_099514144.1\|1170272_1170818_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099514145.1\|1171088_1172231_-	GAF domain-containing protein	NA	NA	NA	NA
WP_162299251.1\|1172332_1172839_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099514146.1\|1173950_1174136_-	hypothetical protein	NA	NA	NA	NA
WP_162299235.1\|1174775_1175291_-	hypothetical protein	NA	NA	NA	NA
WP_099514147.1\|1176816_1177866_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514148.1\|1178109_1178841_-	chromate transporter	A0A219VHC2	Ochrobactrum_phage	1.2e-37	80.4
WP_099508213.1\|1180011_1181349_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099514150.1\|1182754_1183015_-	hypothetical protein	NA	NA	NA	NA
WP_099514151.1\|1183387_1185841_+	DNA topoisomerase	F2Y1B5	Organic_Lake_phycodnavirus	4.1e-05	24.2
WP_099514152.1\|1185927_1186275_-	cupin domain-containing protein	NA	NA	NA	NA
WP_157934480.1\|1186465_1186852_-	hypothetical protein	NA	NA	NA	NA
WP_099514154.1\|1186936_1188319_-	cytochrome P450	I6WI04	Cotesia_sesamiae_Mombasa_bracovirus	2.0e-28	26.1
WP_099514155.1\|1189341_1189767_-	hypothetical protein	NA	NA	NA	NA
WP_099509086.1\|1191303_1191681_-	response regulator	NA	NA	NA	NA
WP_099514156.1\|1194892_1195201_-	hypothetical protein	NA	NA	NA	NA
WP_099514157.1\|1195335_1196532_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.0e-89	46.2
WP_099514158.1\|1196459_1196978_-	hypothetical protein	NA	NA	NA	NA
WP_099514159.1\|1197671_1198388_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.8e-54	45.0
WP_099514160.1\|1198685_1199177_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_157934481.1\|1199198_1199954_+	hypothetical protein	NA	NA	NA	NA
WP_099514162.1\|1200084_1200969_-	TonB-dependent receptor	NA	NA	NA	NA
WP_099514328.1\|1201220_1201418_-	hypothetical protein	NA	NA	NA	NA
WP_099514164.1\|1202314_1202701_-	hypothetical protein	NA	NA	NA	NA
WP_157934482.1\|1203320_1204127_+	hypothetical protein	NA	NA	NA	NA
WP_157934483.1\|1206337_1207555_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.7e-23	33.9
WP_099514168.1\|1208995_1209241_-	hypothetical protein	NA	NA	NA	NA
WP_099509451.1\|1209436_1210975_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099509450.1\|1210993_1211755_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.0e-67	52.7
WP_099514329.1\|1211893_1212154_+	hypothetical protein	NA	NA	NA	NA
WP_099514330.1\|1212927_1213401_-\|transposase	transposase	NA	NA	NA	NA
WP_099510694.1\|1213397_1214539_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.9e-54	42.8
WP_099512701.1\|1214735_1215161_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099510694.1\|1215502_1216643_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.9e-54	42.8
WP_099514169.1\|1217133_1217481_+	hypothetical protein	NA	NA	NA	NA
WP_099511788.1\|1217470_1218240_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099514170.1\|1218387_1218612_+	hypothetical protein	NA	NA	NA	NA
WP_099514171.1\|1218644_1218830_-	hypothetical protein	NA	NA	NA	NA
WP_157934484.1\|1218885_1219050_-	hypothetical protein	NA	NA	NA	NA
WP_099514172.1\|1219437_1219872_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_099514175.1\|1221558_1223661_-	penicillin-binding protein 1C	NA	NA	NA	NA
WP_099514176.1\|1223657_1228862_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_157933989.1\|1228793_1230281_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|1230277_1231045_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_099514177.1\|1231890_1233552_-	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_099514331.1\|1233595_1234723_-	serine hydrolase	NA	NA	NA	NA
WP_099514178.1\|1234862_1235807_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099514179.1\|1235859_1237074_+	4-oxalomesaconate tautomerase	NA	NA	NA	NA
WP_099514332.1\|1237180_1238062_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_099514180.1\|1238348_1239017_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_099514181.1\|1239016_1240522_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_099514182.1\|1240578_1241865_+	carboxylate--amine ligase	NA	NA	NA	NA
WP_099514183.1\|1241902_1244605_+	CoA-binding protein	NA	NA	NA	NA
WP_099514184.1\|1244638_1245292_+	TerC family protein	W8EBD0	Pseudomonas_phage	4.0e-16	36.0
WP_099514185.1\|1245302_1245689_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_099514333.1\|1245816_1246680_+	trans-aconitate 2-methyltransferase	NA	NA	NA	NA
WP_099510353.1\|1247502_1248228_-	acetoacetyl-CoA reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-09	28.2
WP_099514107.1\|1248318_1249491_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_099514334.1\|1249609_1250992_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_099514187.1\|1251018_1252398_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_099514188.1\|1252425_1254771_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_099514189.1\|1254853_1255264_-	phasin family protein	NA	NA	NA	NA
WP_099514190.1\|1255314_1257468_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.1e-49	29.2
WP_099514191.1\|1257510_1258809_-	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
WP_099514192.1\|1258848_1261509_-	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_099514193.1\|1261954_1262929_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_099514195.1\|1263672_1265619_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_036359725.1\|1265723_1265963_+	hypothetical protein	NA	NA	NA	NA
WP_157934485.1\|1267472_1267721_-	hypothetical protein	NA	NA	NA	NA
WP_099514197.1\|1267915_1268710_-	potassium channel family protein	NA	NA	NA	NA
WP_099514198.1\|1271309_1272476_+\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016616

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016616_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016616_1

669144-669234

Orphan

Consensus_repeat	Method
ACATAATCACGTAGGTTTAAGTCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016616_1

>merge|NZ_CP016616|1|669144-669234|CRISPRCasFinder
ACATAATCACGTAGGTTTAAGTCGCGGTTCGCACCCATTTCCCTGACGTGCCATCCTGATTGCTACAGAATCACGTAGGTTTAAGTCGCGT

>NZ_CP016616|1|1|669144-669234|CRISPRCasFinder
ACATAATCACGTAGGTTTAAGTCGCG	GTTCGCACCCATTTCCCTGACGTGCCATCCTGATTGCT
ACAGAATCACGTAGGTTTAAGTCGCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016616.1\|WP_099508298.1\|672371_672587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508290.1\|662364_662733_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223736
NZ_CP016616.1\|WP_157933993.1\|672576_673827_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373044
NZ_CP016616.1\|WP_099508293.1\|665309_666329_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508287.1\|658869_659637_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224401
NZ_CP016616.1\|WP_157933989.1\|657385_658873_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP016616.1\|WP_099508300.1\|673832_674402_+\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|224442
NZ_CP016616.1\|WP_099508297.1\|671230_671419_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_157933991.1\|669688_669826_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508295.1\|670182_670587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508285.1\|657118_657328_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_157933990.1\|666752_667160_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508288.1\|659918_661457_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP016616.1\|WP_162299137.1\|675734_676805_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508301.1\|674661_675726_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508294.1\|669957_670146_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508289.1\|661470_662217_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP016616.1\|WP_157933992.1\|670600_670783_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508292.1\|663872_664115_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|379947
NZ_CP016616.1\|WP_099512601.1\|667413_668769_+\|IS1380-family-transposase	unknown	unknown	gnl\|CDD\|379340

Protein	Function_ID	Function_description	E-value
NZ_CP016616.1\|WP_099508288.1\|659918_661457_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.61108e-43
NZ_CP016616.1\|WP_099508290.1\|662364_662733_-\|hypothetical-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	0.000288783
NZ_CP016616.1\|WP_157933993.1\|672576_673827_-\|hypothetical-protein	gnl\|CDD\|373044	pfam14394, DUF4423, Domain of unknown function (DUF4423). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 170 amino acids in length.	0.000242288
NZ_CP016616.1\|WP_099508287.1\|658869_659637_+\|ATP-binding-protein	gnl\|CDD\|224401	COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair].	1.71336e-71
NZ_CP016616.1\|WP_099508289.1\|661470_662217_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	2.67397e-66
NZ_CP016616.1\|WP_099508300.1\|673832_674402_+\|thermonuclease-family-protein	gnl\|CDD\|224442	COG1525, COG1525, Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair].	5.26323e-31
NZ_CP016616.1\|WP_157933989.1\|657385_658873_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.96875e-42
NZ_CP016616.1\|WP_099508292.1\|663872_664115_-\|RNA-chaperone-Hfq	gnl\|CDD\|379947	pfam17209, Hfq, Hfq protein.	4.04985e-30
NZ_CP016616.1\|WP_099512601.1\|667413_668769_+\|IS1380-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	0

>NZ_CP016616.1|WP_099512601.1|667413_668769_+|IS1380-family-transposase
MTDDTTATFPFPAVSRKKITAAFDGGRLSSDGGVMFLAQAERRLGIAERLARFIPDRRDPGRVKHAITDMIRARIFAIACGYEDCNDFGPLRADPAFKLACGHLPETGADLASQPTLSRLENAPSLRDAIRLTYALVDQWMESYATAPDGVVLDIDDTCDVVHGHQQLSLFNAHYDERCFLPIHVYDSATGRPVAVVLRPGKTPSGIEVRAHLRRLVRRIRMRWPLTRITIRGDSHYARPEAMDFCEQNGLSYLFGLTGTRPLMAKVQDMADAVRTQRAVEDRDVVRDFAETTHRAKSWSCERRAVARIEATRLGLDIRFVVTNLTGTSPRVVYESLYCARGQAENWIKFHKAQLASDRTSCRRAVANQVRLVLHTAAYWLMLSVREAIPAARDLARAEFATLRLRLLKIAVRVQETTSRIRLAYASCCPEADLFRRLAWALAPRPRTASP
>NZ_CP016616.1|WP_157933990.1|666752_667160_-|hypothetical-protein
MANWLRLSITCSMAVMPSIVHAELLNFQCSFYNEVPIGVTVDDQARTVSTKEGYSYDLGGGAFKVLKITKEAIWFIAHEKDADDASLKITVLERSNSGNRRKGGSLSTAVVGGGQEPFSSAPPGGVCWELPQKQP
>NZ_CP016616.1|WP_099508293.1|665309_666329_-|hypothetical-protein
MYRAAACVMMGAVLLSSTKPASAFILTFRDVSDALDTCAGGKTPKTEAVKGEVFAFINSSIAAGSGNLMTLRRNFNLTKGSFGEDDAYEPFTQCATEKATDILKQAGARLVRKIPDLDPEYKNRSFAFFPTLLGQSISAYQLVRVRKDYKTIINIDNITCDATFSVAYVVYPEDSLQPGLEPSVAVQQPVKARFQIELTRASKEVAQAIQETADAIKSAQWITDKASYNAELENFVQTHSDELWLWVNLMSKDKTCSALVSVREERSPHWTSHHTRYEPRPVSWRGLVPRSLMNLRTASSPARPIVHFRNAGCHADINDLPLSPRKHQAWISSLALGGQ
>NZ_CP016616.1|WP_099508292.1|663872_664115_-|RNA-chaperone-Hfq
MPTQKTSSLQDKFLKYLRDKRSEVTIFLANGIRLQGQIRSFDNFTIQLVRGNGTQIVYKHAISTILPAEPIQLADSASFE
>NZ_CP016616.1|WP_099508290.1|662364_662733_-|hypothetical-protein
MILPKGTILYETDETIRYIYFPHDIIVSLVDVMEDGGSAEMTVFGCEAVIGFISAVVTRESVGRYIVQVPGTASRIATDKMHEAISTRPKLRRLILHYTEALIAQLVSTAVQKSTTGRRKTG
>NZ_CP016616.1|WP_099508289.1|661470_662217_+|ATP-binding-protein
MLTHPTLDQLHALGLHGMAKGFKALGANPEADALGHAEWLGLILDHEVTTRQQKRFETRAKTAKLRHPASVEDVDFRAARGLDRALFLKLASCDWIRERRNLLITGPCGVGKSWLACALGHRACREDLSVLYHRVPRLFAALDLARSDGRYSRLLRTLARAKLLVLDDWGPEALTGEQQRDLLEIVEDRYDAGSLLITSQVPVENWYAMIGSLPTLADAILDRVVHNAYRITLTGESLRKTRHAQADA
>NZ_CP016616.1|WP_099508288.1|659918_661457_+|IS21-family-transposase
MPANREMTMRQMRQVLRLHASGTSDRAIGRIVGAARSTVRDAIQRAKAAGLIWPLPEDLSDTALEEKLFARAGARIGTRRRPEPDWAHLVQELKRPGVSIAILHEEYLADHPDGYGYSRFCDLFRSFERRLTPTMRQHHVAGDKVFVDYSGKKLPIVDPLTGEIRHAEIFVAVLGASNLTYAEATWTQTLPDWIEAHVRMFRFHGGVTKLVVPDNLKSGVHKASFYDPEINRSYGKMAAHYEVGILPARPRRPKDKAKVESGVRFAQFYILGRLRHRTFFSLQEANAAIAEAVTRMNSVPMRRLGVSRRQVFETIEKPALAPLPAQDYVFAHWQFARVGLDYHIEVEGFFYSVPFGLIGQQVEVRVTQRTIEAFHKGGRVAAHARRFAGRAHGTQAEHMPSSHRRYAAWSPERFRSWAAVIGPHTEGLIAAILSARRHPEQGFRTCIGVLQHMRGIPKERVEAVAAKALAIRALTYKSIVSLLDTYHERAPAPAADTPVITHPNVRGPGYFH
>NZ_CP016616.1|WP_099508287.1|658869_659637_+|ATP-binding-protein
MSAEAPEILLAHHLKALKLPTFLREHQKLARQCATEGLDHVRFLARLVEMELIDRERRMVERRIKTAKFPAVKSLDSFDFAAIPRLNKMQVLELARGEWIERRENVIALGPSGTGKTHIALGLGLAACQRGLSVGFTTASALVSEMMEARDERRLLRLQRQMAGYKLLIIDELGFVPLSKTGAELLFELISRRYERGATLITSNLPFDEWTETLGSERLTGALLDRLTHHVSILEMNGESYRLAHSRSRKRQTSS
>NZ_CP016616.1|WP_157933989.1|657385_658873_+|IS21-family-transposase
MELYRKVRLACSEGMSQREAAKHFNISRDSVRKMMAYAEPPGYRRHAPVRRPKLETFVPIIDAWLEGDRSVHRKQRHTAKRVFDRLREEHGFTGGYTTIKDYIRERERRCQEMFVPLSHPPGHAQADFGEAVVVIGGVEQKAHFFVLDLPHSDACFVRAYPAAVSEAWVDGHIQAFAFFGAVPQSVLYDNDRCLVAKILPDGTRKRAALFSGFLSHYVIRDRYGRPGKGNDKGNVEGLVGYSRRNFMVPIPNFPSWETFNTWLEGQCRKRQDDKLRGPAETIGQRLQRDTAAMRPLPASPFEACDQASGRVSSQSLVRYKTNDYSVPVAWGHQDVWIRGYVDEVVIGCRSEVIARHPRSYEREEVIFNPLHYLPLIENKINALDQAAPLQGWDLPEEFATLRGLMEVRMNKQGRREYVQVLRLLELFNLPDLHAAVKQALQMGAIGFDAVKHLVLCRVERRPPRLDLDVYPYLPKARVEKTSAAAYMCLISEDAA
>NZ_CP016616.1|WP_099508285.1|657118_657328_+|hypothetical-protein
MQPETRYARSGDLHIAYQVFGAGSVDLVIVPGFISNVEETWDNPSAARCENGGAKFDHGSGGIDPLRAA
>NZ_CP016616.1|WP_157933991.1|669688_669826_-|hypothetical-protein
MSPKLGGGPPGKKPIKKWVIPACGKDHDLFGIVPVKEEKDEEGWD
>NZ_CP016616.1|WP_099508294.1|669957_670146_-|hypothetical-protein
MKTAALHILTNLTIIIVAVTLTAQGWDGASLVYVLAMLATVIFVSALVVWRPVRVLRRSSDL
>NZ_CP016616.1|WP_099508295.1|670182_670587_-|hypothetical-protein
MSPPSGKVNTRIHFSRLALLALTISVLSYAIEDFLIFRVDIWGTWFGDRRVTFVVYMIVLMPLVEEIVRVLLVRVAEKRRWLEQPVSLQTAIFLGALIGTFEWVAKSIWLEPALTRKTILGLITHFSSFPIHIA
>NZ_CP016616.1|WP_157933992.1|670600_670783_+|hypothetical-protein
MKTLHEWERKLKAKLRERGCPMDGLNRWDDELMRPVFRPERTEALRNYQCDLKDTFLRRN
>NZ_CP016616.1|WP_099508297.1|671230_671419_+|hypothetical-protein
MIPDRLDFVIVGAMRLAPTPAFAKLPFEIPVADLFSGKIMTIDDVGCRGATGIIDKAELGTG
>NZ_CP016616.1|WP_099508298.1|672371_672587_-|hypothetical-protein
MPREVLRDPAGRVIGSYEDNAVSGRITARDASGRWLGYYDTRRDETRDAAGRFLAKGNVLASLIFGCEGRR
>NZ_CP016616.1|WP_157933993.1|672576_673827_-|hypothetical-protein
MTPKNQSIVQSGSKKQLPKCGHVRVFSHPRQLRSLRLVRSPASQHLRPRSFSGWPLSLAIELDTSSPNFISFTFRASTLRRQAIFAALAVLTRDGPESLASSLQSLVPAECHAYKSPHERIARAVMASPRAKEIVRSVFGAVPEGLLGVLNRVGGDPLPDPSLYFSLFETFTDPQHRVRRDVLHQQSGPVSAIQIKIIQHLHPVLVHNHILTRLHSVSEAKDANAAFTLIRNAVSSATEEAFRQSVENLGDKTDLATFFSRWIQKIDCPPTLPMIPENDPDIVVMTSGHEIAALGRRFRNCSSTRVVHAAIGYETLLEWKPSPGLVAQCRRLTDGQWILTDIHAKGNGQVEPSAAAAFRRKLQELGIPALSPGDLFPRARGVLSMIGVWHGLGNNLGFEDEDVVDDEDFAEVGNAA
>NZ_CP016616.1|WP_099508300.1|673832_674402_+|thermonuclease-family-protein
MRLFLLPVLLFSFSAEAQQFAGQASVIDGDTIEIAGTRFRLHGIDAPESSQICQDAGGRDYRCGQKSAFALADWIGRATVSCERRDTDRYGRVVAVCRVRGKDMNQWMIQQGWAVAYREYSQDYVPDELTARRVRAGIWTGNFVLPSEWRKGRRIDHYPRDVPGYAVGRSLELEPNNMLIVTDALIVCE
>NZ_CP016616.1|WP_099508301.1|674661_675726_+|hypothetical-protein
MKYLSIAFVSEGLVIILSLLGAVLFAIQYGHQDWILMGFMFLAPIGYAVVELTRVPLAILVRTQPNYLLKLLFFVGILCASAVTTKSLSQLGEMMFRPRMMDVNKARHDFEEAKGKRDAFQGEYAARKAVLDQANASLTSANELSSKQVDALKETGKPQMCPITYTYRDRNGKTQRGTRTAPCPESAASKEIRATMTDQRGTVTAAREKVDEANKALRTLGTAEEVEANVVATRKVYDDAIAHSQLHAFTGMFFAKDPAQVTEGELSNFLRLFVFIPAICASLASTLLAMGSVTRIKPKKFKAVASQKVVPVEGGRYVLDPFHKTVVEKAIDTVVDGMKKPETSPQATPSLKVA
>NZ_CP016616.1|WP_162299137.1|675734_676805_+|hypothetical-protein
MSDAPNYIFEGTSEQKAYAAEQVHNRLRAETRLTTGKAALWWLGGAGLFLALLGIGIGAGLWGYSKVADVTNTAEHLADTLKTVLERVNVQTTGEVKLADGGTVKLDADGETVGVQPGGTVRVEGGTVKVDGSLGRSSALTSPSASASPILSAPSTAQMQAAAPYAQDKDGRLVVEFTRFANRPFADGKVTTGWKYHDNTEERPYSQYCYYRPAGAFSDTIIDLAEDGKLIPNSSSPTIDRYAAAQECRWFDGSSTRTTAITPGEDQLLPAPSAPATPQPFAPSTMAKPPAGASYSDWQNWCRATYPATIQEWCLKEFAPKTLRAEQAPQSQSQPKQAVPVVNERLRMDPVQRKVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016616_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016616_2

669365-669442

Orphan

Consensus_repeat	Method
ACATAATCACGTAGGTTTAAGTCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016616_2

>merge|NZ_CP016616|2|669365-669442|CRISPRCasFinder
AAGGAGTTAGGTGGGTTTAAGTCGCACTTCCCACTCCGTCAGACCAGCCGATACAAAATCACGTGGGTTTAAGTCGCG

>NZ_CP016616|2|2|669365-669442|CRISPRCasFinder
AAGGAGTTAGGTGGGTTTAAGTCGCA	CTTCCCACTCCGTCAGACCAGCCGAT
ACAAAATCACGTGGGTTTAAGTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016616.1\|WP_099508298.1\|672371_672587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508290.1\|662364_662733_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223736
NZ_CP016616.1\|WP_157933993.1\|672576_673827_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373044
NZ_CP016616.1\|WP_099508293.1\|665309_666329_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508287.1\|658869_659637_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224401
NZ_CP016616.1\|WP_157933989.1\|657385_658873_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP016616.1\|WP_099508300.1\|673832_674402_+\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|224442
NZ_CP016616.1\|WP_099508297.1\|671230_671419_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_157933991.1\|669688_669826_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508295.1\|670182_670587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508285.1\|657118_657328_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_157933990.1\|666752_667160_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508288.1\|659918_661457_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP016616.1\|WP_162299137.1\|675734_676805_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508301.1\|674661_675726_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508294.1\|669957_670146_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508289.1\|661470_662217_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP016616.1\|WP_157933992.1\|670600_670783_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016616.1\|WP_099508292.1\|663872_664115_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|379947
NZ_CP016616.1\|WP_099512601.1\|667413_668769_+\|IS1380-family-transposase	unknown	unknown	gnl\|CDD\|379340

Protein	Function_ID	Function_description	E-value
NZ_CP016616.1\|WP_099508288.1\|659918_661457_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.61108e-43
NZ_CP016616.1\|WP_099508290.1\|662364_662733_-\|hypothetical-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	0.000288783
NZ_CP016616.1\|WP_157933993.1\|672576_673827_-\|hypothetical-protein	gnl\|CDD\|373044	pfam14394, DUF4423, Domain of unknown function (DUF4423). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 170 amino acids in length.	0.000242288
NZ_CP016616.1\|WP_099508287.1\|658869_659637_+\|ATP-binding-protein	gnl\|CDD\|224401	COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair].	1.71336e-71
NZ_CP016616.1\|WP_099508289.1\|661470_662217_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	2.67397e-66
NZ_CP016616.1\|WP_099508300.1\|673832_674402_+\|thermonuclease-family-protein	gnl\|CDD\|224442	COG1525, COG1525, Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair].	5.26323e-31
NZ_CP016616.1\|WP_157933989.1\|657385_658873_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.96875e-42
NZ_CP016616.1\|WP_099508292.1\|663872_664115_-\|RNA-chaperone-Hfq	gnl\|CDD\|379947	pfam17209, Hfq, Hfq protein.	4.04985e-30
NZ_CP016616.1\|WP_099512601.1\|667413_668769_+\|IS1380-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	0

>NZ_CP016616.1|WP_099512601.1|667413_668769_+|IS1380-family-transposase
MTDDTTATFPFPAVSRKKITAAFDGGRLSSDGGVMFLAQAERRLGIAERLARFIPDRRDPGRVKHAITDMIRARIFAIACGYEDCNDFGPLRADPAFKLACGHLPETGADLASQPTLSRLENAPSLRDAIRLTYALVDQWMESYATAPDGVVLDIDDTCDVVHGHQQLSLFNAHYDERCFLPIHVYDSATGRPVAVVLRPGKTPSGIEVRAHLRRLVRRIRMRWPLTRITIRGDSHYARPEAMDFCEQNGLSYLFGLTGTRPLMAKVQDMADAVRTQRAVEDRDVVRDFAETTHRAKSWSCERRAVARIEATRLGLDIRFVVTNLTGTSPRVVYESLYCARGQAENWIKFHKAQLASDRTSCRRAVANQVRLVLHTAAYWLMLSVREAIPAARDLARAEFATLRLRLLKIAVRVQETTSRIRLAYASCCPEADLFRRLAWALAPRPRTASP
>NZ_CP016616.1|WP_157933990.1|666752_667160_-|hypothetical-protein
MANWLRLSITCSMAVMPSIVHAELLNFQCSFYNEVPIGVTVDDQARTVSTKEGYSYDLGGGAFKVLKITKEAIWFIAHEKDADDASLKITVLERSNSGNRRKGGSLSTAVVGGGQEPFSSAPPGGVCWELPQKQP
>NZ_CP016616.1|WP_099508293.1|665309_666329_-|hypothetical-protein
MYRAAACVMMGAVLLSSTKPASAFILTFRDVSDALDTCAGGKTPKTEAVKGEVFAFINSSIAAGSGNLMTLRRNFNLTKGSFGEDDAYEPFTQCATEKATDILKQAGARLVRKIPDLDPEYKNRSFAFFPTLLGQSISAYQLVRVRKDYKTIINIDNITCDATFSVAYVVYPEDSLQPGLEPSVAVQQPVKARFQIELTRASKEVAQAIQETADAIKSAQWITDKASYNAELENFVQTHSDELWLWVNLMSKDKTCSALVSVREERSPHWTSHHTRYEPRPVSWRGLVPRSLMNLRTASSPARPIVHFRNAGCHADINDLPLSPRKHQAWISSLALGGQ
>NZ_CP016616.1|WP_099508292.1|663872_664115_-|RNA-chaperone-Hfq
MPTQKTSSLQDKFLKYLRDKRSEVTIFLANGIRLQGQIRSFDNFTIQLVRGNGTQIVYKHAISTILPAEPIQLADSASFE
>NZ_CP016616.1|WP_099508290.1|662364_662733_-|hypothetical-protein
MILPKGTILYETDETIRYIYFPHDIIVSLVDVMEDGGSAEMTVFGCEAVIGFISAVVTRESVGRYIVQVPGTASRIATDKMHEAISTRPKLRRLILHYTEALIAQLVSTAVQKSTTGRRKTG
>NZ_CP016616.1|WP_099508289.1|661470_662217_+|ATP-binding-protein
MLTHPTLDQLHALGLHGMAKGFKALGANPEADALGHAEWLGLILDHEVTTRQQKRFETRAKTAKLRHPASVEDVDFRAARGLDRALFLKLASCDWIRERRNLLITGPCGVGKSWLACALGHRACREDLSVLYHRVPRLFAALDLARSDGRYSRLLRTLARAKLLVLDDWGPEALTGEQQRDLLEIVEDRYDAGSLLITSQVPVENWYAMIGSLPTLADAILDRVVHNAYRITLTGESLRKTRHAQADA
>NZ_CP016616.1|WP_099508288.1|659918_661457_+|IS21-family-transposase
MPANREMTMRQMRQVLRLHASGTSDRAIGRIVGAARSTVRDAIQRAKAAGLIWPLPEDLSDTALEEKLFARAGARIGTRRRPEPDWAHLVQELKRPGVSIAILHEEYLADHPDGYGYSRFCDLFRSFERRLTPTMRQHHVAGDKVFVDYSGKKLPIVDPLTGEIRHAEIFVAVLGASNLTYAEATWTQTLPDWIEAHVRMFRFHGGVTKLVVPDNLKSGVHKASFYDPEINRSYGKMAAHYEVGILPARPRRPKDKAKVESGVRFAQFYILGRLRHRTFFSLQEANAAIAEAVTRMNSVPMRRLGVSRRQVFETIEKPALAPLPAQDYVFAHWQFARVGLDYHIEVEGFFYSVPFGLIGQQVEVRVTQRTIEAFHKGGRVAAHARRFAGRAHGTQAEHMPSSHRRYAAWSPERFRSWAAVIGPHTEGLIAAILSARRHPEQGFRTCIGVLQHMRGIPKERVEAVAAKALAIRALTYKSIVSLLDTYHERAPAPAADTPVITHPNVRGPGYFH
>NZ_CP016616.1|WP_099508287.1|658869_659637_+|ATP-binding-protein
MSAEAPEILLAHHLKALKLPTFLREHQKLARQCATEGLDHVRFLARLVEMELIDRERRMVERRIKTAKFPAVKSLDSFDFAAIPRLNKMQVLELARGEWIERRENVIALGPSGTGKTHIALGLGLAACQRGLSVGFTTASALVSEMMEARDERRLLRLQRQMAGYKLLIIDELGFVPLSKTGAELLFELISRRYERGATLITSNLPFDEWTETLGSERLTGALLDRLTHHVSILEMNGESYRLAHSRSRKRQTSS
>NZ_CP016616.1|WP_157933989.1|657385_658873_+|IS21-family-transposase
MELYRKVRLACSEGMSQREAAKHFNISRDSVRKMMAYAEPPGYRRHAPVRRPKLETFVPIIDAWLEGDRSVHRKQRHTAKRVFDRLREEHGFTGGYTTIKDYIRERERRCQEMFVPLSHPPGHAQADFGEAVVVIGGVEQKAHFFVLDLPHSDACFVRAYPAAVSEAWVDGHIQAFAFFGAVPQSVLYDNDRCLVAKILPDGTRKRAALFSGFLSHYVIRDRYGRPGKGNDKGNVEGLVGYSRRNFMVPIPNFPSWETFNTWLEGQCRKRQDDKLRGPAETIGQRLQRDTAAMRPLPASPFEACDQASGRVSSQSLVRYKTNDYSVPVAWGHQDVWIRGYVDEVVIGCRSEVIARHPRSYEREEVIFNPLHYLPLIENKINALDQAAPLQGWDLPEEFATLRGLMEVRMNKQGRREYVQVLRLLELFNLPDLHAAVKQALQMGAIGFDAVKHLVLCRVERRPPRLDLDVYPYLPKARVEKTSAAAYMCLISEDAA
>NZ_CP016616.1|WP_099508285.1|657118_657328_+|hypothetical-protein
MQPETRYARSGDLHIAYQVFGAGSVDLVIVPGFISNVEETWDNPSAARCENGGAKFDHGSGGIDPLRAA
>NZ_CP016616.1|WP_157933991.1|669688_669826_-|hypothetical-protein
MSPKLGGGPPGKKPIKKWVIPACGKDHDLFGIVPVKEEKDEEGWD
>NZ_CP016616.1|WP_099508294.1|669957_670146_-|hypothetical-protein
MKTAALHILTNLTIIIVAVTLTAQGWDGASLVYVLAMLATVIFVSALVVWRPVRVLRRSSDL
>NZ_CP016616.1|WP_099508295.1|670182_670587_-|hypothetical-protein
MSPPSGKVNTRIHFSRLALLALTISVLSYAIEDFLIFRVDIWGTWFGDRRVTFVVYMIVLMPLVEEIVRVLLVRVAEKRRWLEQPVSLQTAIFLGALIGTFEWVAKSIWLEPALTRKTILGLITHFSSFPIHIA
>NZ_CP016616.1|WP_157933992.1|670600_670783_+|hypothetical-protein
MKTLHEWERKLKAKLRERGCPMDGLNRWDDELMRPVFRPERTEALRNYQCDLKDTFLRRN
>NZ_CP016616.1|WP_099508297.1|671230_671419_+|hypothetical-protein
MIPDRLDFVIVGAMRLAPTPAFAKLPFEIPVADLFSGKIMTIDDVGCRGATGIIDKAELGTG
>NZ_CP016616.1|WP_099508298.1|672371_672587_-|hypothetical-protein
MPREVLRDPAGRVIGSYEDNAVSGRITARDASGRWLGYYDTRRDETRDAAGRFLAKGNVLASLIFGCEGRR
>NZ_CP016616.1|WP_157933993.1|672576_673827_-|hypothetical-protein
MTPKNQSIVQSGSKKQLPKCGHVRVFSHPRQLRSLRLVRSPASQHLRPRSFSGWPLSLAIELDTSSPNFISFTFRASTLRRQAIFAALAVLTRDGPESLASSLQSLVPAECHAYKSPHERIARAVMASPRAKEIVRSVFGAVPEGLLGVLNRVGGDPLPDPSLYFSLFETFTDPQHRVRRDVLHQQSGPVSAIQIKIIQHLHPVLVHNHILTRLHSVSEAKDANAAFTLIRNAVSSATEEAFRQSVENLGDKTDLATFFSRWIQKIDCPPTLPMIPENDPDIVVMTSGHEIAALGRRFRNCSSTRVVHAAIGYETLLEWKPSPGLVAQCRRLTDGQWILTDIHAKGNGQVEPSAAAAFRRKLQELGIPALSPGDLFPRARGVLSMIGVWHGLGNNLGFEDEDVVDDEDFAEVGNAA
>NZ_CP016616.1|WP_099508300.1|673832_674402_+|thermonuclease-family-protein
MRLFLLPVLLFSFSAEAQQFAGQASVIDGDTIEIAGTRFRLHGIDAPESSQICQDAGGRDYRCGQKSAFALADWIGRATVSCERRDTDRYGRVVAVCRVRGKDMNQWMIQQGWAVAYREYSQDYVPDELTARRVRAGIWTGNFVLPSEWRKGRRIDHYPRDVPGYAVGRSLELEPNNMLIVTDALIVCE
>NZ_CP016616.1|WP_099508301.1|674661_675726_+|hypothetical-protein
MKYLSIAFVSEGLVIILSLLGAVLFAIQYGHQDWILMGFMFLAPIGYAVVELTRVPLAILVRTQPNYLLKLLFFVGILCASAVTTKSLSQLGEMMFRPRMMDVNKARHDFEEAKGKRDAFQGEYAARKAVLDQANASLTSANELSSKQVDALKETGKPQMCPITYTYRDRNGKTQRGTRTAPCPESAASKEIRATMTDQRGTVTAAREKVDEANKALRTLGTAEEVEANVVATRKVYDDAIAHSQLHAFTGMFFAKDPAQVTEGELSNFLRLFVFIPAICASLASTLLAMGSVTRIKPKKFKAVASQKVVPVEGGRYVLDPFHKTVVEKAIDTVVDGMKKPETSPQATPSLKVA
>NZ_CP016616.1|WP_162299137.1|675734_676805_+|hypothetical-protein
MSDAPNYIFEGTSEQKAYAAEQVHNRLRAETRLTTGKAALWWLGGAGLFLALLGIGIGAGLWGYSKVADVTNTAEHLADTLKTVLERVNVQTTGEVKLADGGTVKLDADGETVGVQPGGTVRVEGGTVKVDGSLGRSSALTSPSASASPILSAPSTAQMQAAAPYAQDKDGRLVVEFTRFANRPFADGKVTTGWKYHDNTEERPYSQYCYYRPAGAFSDTIIDLAEDGKLIPNSSSPTIDRYAAAQECRWFDGSSTRTTAITPGEDQLLPAPSAPATPQPFAPSTMAKPPAGASYSDWQNWCRATYPATIQEWCLKEFAPKTLRAEQAPQSQSQPKQAVPVVNERLRMDPVQRKVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10454 : 17968

Hokovirus(16.67%)

tRNA,integrase

attL 6397:6410|attR 21670:21683

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6397:6410	attL	NA	NA	NA	NA
WP_099507735.1\|10454_12005_-\|tRNA	methionine--tRNA ligase	A0A1V0SEZ7	Hokovirus	5.8e-98	38.8
WP_099507737.1\|12063_13128_-	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	6.6e-08	27.6
WP_099507739.1\|13117_13792_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.0e-35	43.9
WP_099507740.1\|13791_14997_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-50	36.2
WP_099507743.1\|15125_16121_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.2e-19	56.0
WP_099507745.1\|16735_17968_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	7.7e-85	44.9
21670:21683	attR	NA	NA	NA	NA

DBSCAN-SWA_2

96842 : 170185

Paramecium_bursaria_Chlorella_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099507858.1\|96842_98372_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_157933942.1\|105935_106094_+	hypothetical protein	NA	NA	NA	NA
WP_099507862.1\|106247_107603_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_099507863.1\|107987_108872_+	DMT family transporter	NA	NA	NA	NA
WP_099507865.1\|109004_110063_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_099507867.1\|110059_111925_+	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_162299201.1\|111951_112935_+	hydroxyacid dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	6.0e-16	35.0
WP_099507872.1\|112931_113732_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_099507873.1\|113813_115112_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099507875.1\|115174_116524_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_099512560.1\|116523_118326_-	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	7.2e-15	31.1
WP_099507877.1\|118453_118702_-	hypothetical protein	NA	NA	NA	NA
WP_157933943.1\|119653_119830_+	hypothetical protein	NA	NA	NA	NA
WP_099507880.1\|120871_122521_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_099507882.1\|122495_123122_+	response regulator transcription factor	NA	NA	NA	NA
WP_099507884.1\|123891_124500_+	hypothetical protein	NA	NA	NA	NA
WP_099507886.1\|124794_126159_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_099507888.1\|126169_127504_+	NAD-dependent dihydropyrimidine dehydrogenase subunit PreA	NA	NA	NA	NA
WP_099507890.1\|127578_128250_-	TetR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_099512561.1\|128597_129377_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-30	36.6
WP_099507892.1\|129366_130296_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_099507894.1\|130292_131252_+	ABC transporter permease	NA	NA	NA	NA
WP_099507896.1\|131286_132276_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099507898.1\|132358_133798_+	dihydropyrimidinase	NA	NA	NA	NA
WP_099507900.1\|133882_135124_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_157933945.1\|135174_135561_-	hypothetical protein	NA	NA	NA	NA
WP_099512562.1\|135671_136286_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_099507904.1\|136483_137500_+	thioesterase	NA	NA	NA	NA
WP_099507906.1\|140646_141888_+	hypothetical protein	NA	NA	NA	NA
WP_162299129.1\|141975_143145_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_157934343.1\|143203_144667_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.5e-50	29.9
WP_099507909.1\|146049_147822_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_099507910.1\|148991_150251_-	polysaccharide biosynthesis/export family protein	NA	NA	NA	NA
WP_099507911.1\|150425_151814_-	glycosyltransferase	NA	NA	NA	NA
WP_162299130.1\|151810_152995_-	glycosyltransferase	NA	NA	NA	NA
WP_099507913.1\|152997_154299_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_157933946.1\|154791_157443_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_157933947.1\|157466_158867_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_162299131.1\|159519_160536_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_157933948.1\|160718_161837_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099507918.1\|162083_163160_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_099507919.1\|163411_164059_-	sugar transferase	NA	NA	NA	NA
WP_099507920.1\|164506_165790_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_099507921.1\|166294_166639_+	VanZ family protein	NA	NA	NA	NA
WP_099507922.1\|166747_168043_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_157933949.1\|168176_168875_-	hypothetical protein	NA	NA	NA	NA
WP_099507924.1\|168898_170185_+\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

299607 : 368311

Planktothrix_phage(13.33%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508024.1\|299607_300777_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099508025.1\|300962_301637_-	ParA family protein	NA	NA	NA	NA
WP_099508026.1\|301979_302387_+	DUF1236 domain-containing protein	NA	NA	NA	NA
WP_099508027.1\|302441_303515_-	COX15/CtaA family protein	NA	NA	NA	NA
WP_099512576.1\|303651_303861_+	DUF2842 domain-containing protein	NA	NA	NA	NA
WP_099508028.1\|303949_304144_-	hypothetical protein	NA	NA	NA	NA
WP_099508029.1\|304775_305831_-	response regulator	W8CYM9	Bacillus_phage	2.8e-11	36.2
WP_099508030.1\|305831_307976_-	PAS domain-containing protein	Q6XLV6	Feldmannia_irregularis_virus	4.4e-11	28.3
WP_099508031.1\|307978_308485_-	hypothetical protein	NA	NA	NA	NA
WP_099508032.1\|308896_309319_+	BA14K family protein	NA	NA	NA	NA
WP_099508033.1\|309504_309777_+	hypothetical protein	NA	NA	NA	NA
WP_099508034.1\|309801_310791_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_157933959.1\|310870_311581_-	extensin family protein	NA	NA	NA	NA
WP_157933960.1\|311745_312270_+	hypothetical protein	NA	NA	NA	NA
WP_099508037.1\|312456_314733_+	CDC48 family AAA ATPase	R4TQL5	Phaeocystis_globosa_virus	4.6e-51	47.3
WP_099508038.1\|314816_315254_-	hypothetical protein	NA	NA	NA	NA
WP_173909411.1\|315557_316448_-	DMT family transporter	NA	NA	NA	NA
WP_099508040.1\|316444_317383_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157933961.1\|317504_318527_-	acyltransferase family protein	Q9MC93	Pseudomonas_phage	2.0e-06	26.9
WP_099512577.1\|318750_319092_-	RidA family protein	NA	NA	NA	NA
WP_099508042.1\|319179_320184_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.9e-13	32.7
WP_099508043.1\|320180_321173_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-17	29.3
WP_099508044.1\|321187_322138_-	ABC transporter permease	NA	NA	NA	NA
WP_099508045.1\|322148_323129_-	ABC transporter permease	NA	NA	NA	NA
WP_099508046.1\|323234_324833_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099512578.1\|324985_326140_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_157933962.1\|326376_327348_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_157933963.1\|327468_327675_-	hypothetical protein	NA	NA	NA	NA
WP_099508049.1\|327763_328009_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_157933964.1\|328704_329217_-	hypothetical protein	NA	NA	NA	NA
WP_099508052.1\|329873_330152_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.1e-18	55.1
WP_099508053.1\|330346_332773_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-193	48.4
WP_099508054.1\|333003_334272_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.5e-133	59.5
WP_099508055.1\|334494_335127_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	5.5e-63	61.9
WP_099512579.1\|335204_336572_-	trigger factor	NA	NA	NA	NA
WP_099508056.1\|336942_338280_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_099508057.1\|338272_339760_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_036360409.1\|339943_340282_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_099508058.1\|340354_341764_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_157933965.1\|341970_342228_+	hypothetical protein	NA	NA	NA	NA
WP_099508024.1\|342435_343605_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099508060.1\|343845_344490_-	porin family protein	NA	NA	NA	NA
WP_099508061.1\|344799_345498_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_099508062.1\|345686_347246_+	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	1.9e-51	33.8
WP_099508063.1\|347238_347613_-	TfoX/Sxy family protein	NA	NA	NA	NA
WP_099508064.1\|347616_347997_-	iron-sulfur cluster assembly accessory protein	A0A0P0CQC4	Ostreococcus_lucimarinus_virus	3.6e-17	38.7
WP_099508065.1\|348167_350057_+	Kef family K(+) transporter	NA	NA	NA	NA
WP_099508066.1\|350290_350662_-	SUF system Fe-S cluster assembly protein	NA	NA	NA	NA
WP_099508067.1\|350673_351909_-	cysteine desulfurase	Q2XUY6	environmental_halophage	8.5e-92	38.8
WP_099508068.1\|352026_353340_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_099508069.1\|353341_354094_-	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	1.1e-09	26.9
WP_099508070.1\|354216_355689_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_099508071.1\|355755_356928_-	cysteine desulfurase	NA	NA	NA	NA
WP_099512580.1\|357163_357820_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_099508072.1\|357967_360487_-	M10 family metallopeptidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_099508073.1\|360864_362127_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	8.5e-55	33.3
WP_099508074.1\|362140_365611_-	hypothetical protein	NA	NA	NA	NA
WP_099508075.1\|365817_366285_+	peroxiredoxin	NA	NA	NA	NA
WP_099508076.1\|366374_366977_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_099508077.1\|367024_368311_-\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

383451 : 429632

Stx2-converting_phage(40.0%)

tRNA,transposase,integrase

attL 371631:371647|attR 430946:430962

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
371631:371647	attL	NA	NA	NA	NA
WP_099508088.1\|383451_384123_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_099512582.1\|384125_384737_-	DUF2155 domain-containing protein	NA	NA	NA	NA
WP_099508089.1\|384986_385610_+	hypothetical protein	NA	NA	NA	NA
WP_099508090.1\|385615_386416_+	aldo/keto reductase	NA	NA	NA	NA
WP_157933966.1\|386483_387254_-	DUF4239 domain-containing protein	NA	NA	NA	NA
WP_099508092.1\|387923_388964_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099508093.1\|389080_390073_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099508094.1\|390170_390392_-	hypothetical protein	NA	NA	NA	NA
WP_099512583.1\|390413_390827_-	NADH:ubiquinone oxidoreductase subunit NDUFA12	NA	NA	NA	NA
WP_099508095.1\|391493_395201_+	vitamin B12-dependent ribonucleotide reductase	A0A1X9SGV9	Bradyrhizobium_phage	0.0e+00	57.7
WP_099508096.1\|395519_396656_+	hypothetical protein	NA	NA	NA	NA
WP_099508097.1\|396655_398944_+	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_099508098.1\|398940_400104_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_099508099.1\|400103_401060_+	hypothetical protein	NA	NA	NA	NA
WP_099508100.1\|401467_402397_-	HNH endonuclease	NA	NA	NA	NA
WP_099508101.1\|402446_404627_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_099508102.1\|404681_408338_-	DNA helicase	NA	NA	NA	NA
WP_157933968.1\|410044_411343_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_099512584.1\|411405_413418_+	hypothetical protein	NA	NA	NA	NA
WP_157933969.1\|413803_415462_+\|integrase	integrase	NA	NA	NA	NA
WP_099508105.1\|415445_415997_+	hypothetical protein	NA	NA	NA	NA
WP_099508106.1\|415996_416467_+	hypothetical protein	NA	NA	NA	NA
WP_099508107.1\|416463_418701_+	AAA family ATPase	A0A1W6JKX1	Lactococcus_phage	5.4e-20	23.4
WP_099508109.1\|419757_420186_-\|transposase	transposase	NA	NA	NA	NA
WP_157933970.1\|420392_421067_+	hypothetical protein	NA	NA	NA	NA
WP_157933971.1\|421122_421740_+	DUF2293 domain-containing protein	NA	NA	NA	NA
WP_099508112.1\|421841_422702_+	hypothetical protein	NA	NA	NA	NA
WP_157933972.1\|422702_422879_+	hypothetical protein	NA	NA	NA	NA
WP_099508113.1\|422940_424038_-	HAD family hydrolase	NA	NA	NA	NA
WP_099508114.1\|424034_425261_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_099508115.1\|425914_426100_+	hypothetical protein	NA	NA	NA	NA
WP_099508116.1\|426124_426802_+	GTP cyclohydrolase I	A0A1C3NFQ1	Phage_NCTB	3.2e-40	38.9
WP_099508117.1\|426856_427069_+	hypothetical protein	NA	NA	NA	NA
WP_099508118.1\|427141_427567_+\|transposase	transposase	NA	NA	NA	NA
WP_099508119.1\|427563_427914_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	3.4e-30	51.9
WP_099508120.1\|427961_429632_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.3e-98	41.0
430946:430962	attR	NA	NA	NA	NA

DBSCAN-SWA_5

475830 : 538845

Paramecium_bursaria_Chlorella_virus(28.57%)

transposase,integrase

attL 483392:483408|attR 501112:501128

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508146.1\|475830_476493_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_157933976.1\|476661_477309_-	hypothetical protein	NA	NA	NA	NA
WP_099508149.1\|477635_478118_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_099508150.1\|478442_479414_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_099508151.1\|479478_479805_-	DUF1476 domain-containing protein	NA	NA	NA	NA
WP_157933977.1\|480648_480846_+	hypothetical protein	NA	NA	NA	NA
WP_162299202.1\|480920_481403_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_099508154.1\|481411_482911_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_099512586.1\|483080_484019_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
483392:483408	attL	NA	NA	NA	NA
WP_099508155.1\|484168_485572_-	sensor histidine kinase	NA	NA	NA	NA
WP_099508156.1\|485568_486234_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.4e-26	33.3
WP_099508157.1\|486456_487743_+	carboxylate--amine ligase	NA	NA	NA	NA
WP_099508158.1\|487778_490481_+	CoA-binding protein	NA	NA	NA	NA
WP_099508159.1\|490514_491168_+	TerC family protein	W8EBD0	Pseudomonas_phage	6.8e-16	35.5
WP_099508160.1\|491177_491564_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_173909500.1\|491691_492555_+	trans-aconitate 2-methyltransferase	NA	NA	NA	NA
WP_157933978.1\|492564_494217_-	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_157933979.1\|494605_494752_-	hypothetical protein	NA	NA	NA	NA
WP_099512588.1\|495167_496631_+	AAA family ATPase	NA	NA	NA	NA
WP_099508162.1\|496998_498438_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_178005135.1\|498779_499640_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.0e-28	31.7
WP_099512589.1\|499650_500847_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_099508164.1\|501441_502929_-	DUF1254 domain-containing protein	M1HNU9	Paramecium_bursaria_Chlorella_virus	2.2e-09	21.3
501112:501128	attR	NA	NA	NA	NA
WP_099508166.1\|504053_504350_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_099508167.1\|505756_506062_-	Dabb family protein	NA	NA	NA	NA
WP_099508168.1\|506990_507683_-	CoA transferase subunit B	NA	NA	NA	NA
WP_099508169.1\|507682_508417_-	CoA transferase subunit A	NA	NA	NA	NA
WP_099508170.1\|508476_509364_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_099508171.1\|509462_510266_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	6.7e-21	32.6
WP_099508172.1\|510364_511165_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_099512590.1\|511183_512164_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099508173.1\|512326_513307_-	ABC transporter permease	NA	NA	NA	NA
WP_173909412.1\|513317_514340_-	ABC transporter permease	NA	NA	NA	NA
WP_099508174.1\|516260_517040_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099508175.1\|517231_517519_-	YciI family protein	NA	NA	NA	NA
WP_099508176.1\|517904_518735_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_099508177.1\|521542_522493_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_099508178.1\|522555_523563_-	ABC transporter permease	NA	NA	NA	NA
WP_099508179.1\|523599_525156_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-08	23.4
WP_099508180.1\|525241_526189_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_099508181.1\|526246_527311_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_099512592.1\|527456_528329_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_099508182.1\|528391_529303_-	intradiol ring-cleavage dioxygenase	NA	NA	NA	NA
WP_099508183.1\|529417_530488_-	maleylacetate reductase	NA	NA	NA	NA
WP_099508184.1\|531062_531557_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_099512593.1\|532167_533610_+	DUF1254 domain-containing protein	M1I2Z8	Paramecium_bursaria_Chlorella_virus	1.8e-117	48.5
WP_099512594.1\|533832_534780_-	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_099508185.1\|535056_536664_+\|transposase	transposase	NA	NA	NA	NA
WP_099508187.1\|537693_538845_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

657385 : 690435

Lactococcus_phage(33.33%)

transposase,integrase

attL 653678:653694|attR 690625:690641

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
653678:653694	attL	NA	NA	NA	NA
WP_157933989.1\|657385_658873_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|658869_659637_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_099508288.1\|659918_661457_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.5e-117	44.5
WP_099508289.1\|661470_662217_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.7e-59	49.0
WP_099508290.1\|662364_662733_-	hypothetical protein	NA	NA	NA	NA
WP_099508292.1\|663872_664115_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_099508293.1\|665309_666329_-	hypothetical protein	NA	NA	NA	NA
WP_157933990.1\|666752_667160_-	hypothetical protein	NA	NA	NA	NA
WP_099512601.1\|667413_668769_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_157933991.1\|669688_669826_-	hypothetical protein	NA	NA	NA	NA
WP_099508294.1\|669957_670146_-	hypothetical protein	NA	NA	NA	NA
WP_099508295.1\|670182_670587_-	hypothetical protein	NA	NA	NA	NA
WP_157933992.1\|670600_670783_+	hypothetical protein	NA	NA	NA	NA
WP_099508297.1\|671230_671419_+	hypothetical protein	NA	NA	NA	NA
WP_099508298.1\|672371_672587_-	hypothetical protein	NA	NA	NA	NA
WP_157933993.1\|672576_673827_-	hypothetical protein	NA	NA	NA	NA
WP_099508300.1\|673832_674402_+	thermonuclease family protein	NA	NA	NA	NA
WP_099508301.1\|674661_675726_+	hypothetical protein	NA	NA	NA	NA
WP_162299137.1\|675734_676805_+	hypothetical protein	NA	NA	NA	NA
WP_162299204.1\|677128_678367_+	trypsin-like peptidase domain-containing protein	A0A1B1IRH0	uncultured_Mediterranean_phage	5.8e-08	24.9
WP_099508303.1\|678378_678636_+	hypothetical protein	NA	NA	NA	NA
WP_099508304.1\|678670_678970_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_157934347.1\|679838_680630_-	hypothetical protein	NA	NA	NA	NA
WP_157933994.1\|681284_683798_-	hypothetical protein	NA	NA	NA	NA
WP_099508310.1\|684024_684390_-\|transposase	transposase	NA	NA	NA	NA
WP_099508311.1\|684409_684601_-	hypothetical protein	NA	NA	NA	NA
WP_157933995.1\|685102_685375_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_099508313.1\|685421_685619_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_099508314.1\|685766_686303_+	hypothetical protein	NA	NA	NA	NA
WP_099508315.1\|686319_686637_-	DoxX family protein	NA	NA	NA	NA
WP_157933989.1\|686804_688292_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|688288_689056_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_157933996.1\|689226_690435_+\|integrase	tyrosine-type recombinase/integrase	B0VK72	Azospirillum_phage	5.1e-17	33.5
690625:690641	attR	NA	NA	NA	NA

DBSCAN-SWA_7

923604 : 982364

Acinetobacter_phage(21.05%)

tRNA,tail,head,portal,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508524.1\|923604_924309_+\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_099508525.1\|924573_925572_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_099508526.1\|925807_926116_+	hypothetical protein	NA	NA	NA	NA
WP_099508527.1\|926183_926654_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_099508528.1\|926670_927318_-	urease accessory protein UreE	NA	NA	NA	NA
WP_099508529.1\|927373_927856_-	nucleoside deaminase	S4VYT2	Pandoravirus	1.2e-20	38.8
WP_099508530.1\|927961_928930_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.4e-41	36.4
WP_099508531.1\|928926_931257_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	2.5e-222	53.0
WP_099508532.1\|931261_932743_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	3.1e-96	42.2
WP_099508533.1\|932864_933305_-	VOC family protein	NA	NA	NA	NA
WP_099508534.1\|933499_936151_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	7.8e-18	25.9
WP_099508535.1\|936342_938670_+	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	8.4e-24	32.6
WP_157934029.1\|939797_941276_-	hypothetical protein	NA	NA	NA	NA
WP_099508539.1\|941517_941706_-	hypothetical protein	NA	NA	NA	NA
WP_099508540.1\|942019_943099_-	calcium-binding protein	NA	NA	NA	NA
WP_157934030.1\|943386_945780_-	hypothetical protein	NA	NA	NA	NA
WP_099508542.1\|945971_947327_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_157934031.1\|947432_948350_-	hypothetical protein	NA	NA	NA	NA
WP_099508544.1\|948574_951526_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_173909420.1\|951617_953039_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_099508546.1\|953205_953904_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.9e-28	32.6
WP_099508547.1\|954052_955264_-	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.0e-21	29.4
WP_099508548.1\|955393_955792_-	hypothetical protein	NA	NA	NA	NA
WP_099508549.1\|955959_956418_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_099508550.1\|956422_958405_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_099508551.1\|958434_958893_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_099508552.1\|958889_959981_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_099508553.1\|960213_961611_-	sensor histidine kinase	NA	NA	NA	NA
WP_099508554.1\|961607_962279_-	response regulator transcription factor	NA	NA	NA	NA
WP_099508555.1\|962293_962608_-	hypothetical protein	NA	NA	NA	NA
WP_099508556.1\|962691_962901_-	hypothetical protein	NA	NA	NA	NA
WP_099508557.1\|962914_963451_-	glycoside hydrolase family 108 protein	A0A088F6V6	Sulfitobacter_phage	1.2e-37	50.3
WP_157934032.1\|963460_964999_-	DUF2793 domain-containing protein	A0A0K1LM04	Rhodobacter_phage	3.2e-40	42.7
WP_157934033.1\|965003_965171_+	hypothetical protein	NA	NA	NA	NA
WP_099508559.1\|965151_969012_-\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	1.3e-239	39.0
WP_099508560.1\|969011_969440_-	C40 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	2.5e-35	49.3
WP_099508561.1\|969604_970495_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	2.0e-66	42.9
WP_099508562.1\|970780_971419_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	7.6e-52	51.9
WP_099508563.1\|971498_971744_+	YdcH family protein	NA	NA	NA	NA
WP_099508564.1\|971812_972499_-\|tail	phage tail tape measure protein	G9JXH3	Shigella_phage	2.5e-08	46.2
WP_099508565.1\|972644_972938_+	hypothetical protein	NA	NA	NA	NA
WP_099508566.1\|972980_973190_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_099508567.1\|973138_973522_-	gene transfer agent family protein	NA	NA	NA	NA
WP_099508568.1\|973679_974090_-\|tail	phage major tail protein, TP901-1 family	I3UM07	Rhodobacter_phage	1.3e-20	42.3
WP_099508569.1\|974507_974918_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_099508570.1\|974914_975250_-\|head	phage head closure protein	NA	NA	NA	NA
WP_099508571.1\|975438_976005_-\|head,tail	phage head-tail connector protein	A0A0F7L420	uncultured_marine_virus	1.4e-12	32.1
WP_099508572.1\|976029_976782_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_099508573.1\|976914_977712_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_099508574.1\|979415_979619_-	hypothetical protein	NA	NA	NA	NA
WP_099508575.1\|979728_980265_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.1e-30	49.4
WP_099508576.1\|980533_980734_-	hypothetical protein	NA	NA	NA	NA
WP_157934034.1\|981006_981156_+	hypothetical protein	NA	NA	NA	NA
WP_099508577.1\|981188_982364_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.5e-77	42.6

DBSCAN-SWA_8

1123186 : 1140415

Burkholderia_phage(25.0%)

transposase,integrase

attL 1137029:1137067|attR 1140450:1140488

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508688.1\|1123186_1124542_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_099508689.1\|1124756_1125707_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_099508690.1\|1125787_1127437_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_157934045.1\|1128863_1129556_+	hypothetical protein	NA	NA	NA	NA
WP_099508693.1\|1129534_1130122_+	glycosyltransferase	NA	NA	NA	NA
WP_099508694.1\|1130298_1131414_+	acyltransferase	A9YX16	Burkholderia_phage	3.9e-27	33.2
WP_099508695.1\|1131555_1135110_+	FkbM family methyltransferase	G9E6G5	Micromonas_pusilla_virus	5.8e-08	26.3
WP_099508696.1\|1135317_1136397_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099508697.1\|1136600_1136972_+\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	1.9e-10	35.0
1137029:1137067	attL	NA	NA	NA	NA
WP_099508698.1\|1138490_1139405_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099508699.1\|1139401_1140415_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	1.9e-12	22.5
1140450:1140488	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2045404 : 2097638

Acidithiobacillus_phage(22.22%)

protease,transposase,integrase

attL 2052302:2052356|attR 2082284:2082338

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099509421.1\|2045404_2046112_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_099509422.1\|2046255_2047005_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_099509423.1\|2047017_2047962_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_099509424.1\|2048032_2048914_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_162299152.1\|2049147_2049717_+	HNH endonuclease	A0A1P8DIY8	Virus_Rctr197k	3.7e-26	44.3
WP_099509426.1\|2049744_2050830_-	D-TA family PLP-dependent enzyme	NA	NA	NA	NA
WP_099509427.1\|2050921_2051422_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_099509428.1\|2051432_2052014_-	DedA family protein	NA	NA	NA	NA
2052302:2052356	attL	NA	NA	NA	NA
WP_099509429.1\|2052561_2053377_+	hypothetical protein	NA	NA	NA	NA
WP_157934105.1\|2054250_2054493_+	hypothetical protein	NA	NA	NA	NA
WP_099509431.1\|2054485_2054743_+	WGR domain-containing protein	NA	NA	NA	NA
WP_099509433.1\|2055285_2055765_-	hypothetical protein	NA	NA	NA	NA
WP_099509434.1\|2055844_2056063_-	hypothetical protein	NA	NA	NA	NA
WP_099509435.1\|2056571_2056970_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099509436.1\|2057130_2057646_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099509437.1\|2058070_2058793_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099509438.1\|2058879_2059128_+	hypothetical protein	NA	NA	NA	NA
WP_099508287.1\|2059338_2060106_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_157933989.1\|2060102_2061590_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099509441.1\|2062683_2063667_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099509442.1\|2063833_2064346_-	hypothetical protein	NA	NA	NA	NA
WP_099509443.1\|2065187_2065415_+	WGR domain-containing protein	NA	NA	NA	NA
WP_157934106.1\|2065694_2066009_+	hypothetical protein	NA	NA	NA	NA
WP_157934107.1\|2066081_2066630_+	hypothetical protein	NA	NA	NA	NA
WP_099509446.1\|2067174_2067366_-	hypothetical protein	NA	NA	NA	NA
WP_099509447.1\|2067994_2068225_+	hypothetical protein	NA	NA	NA	NA
WP_157934108.1\|2069725_2070469_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_157934109.1\|2071124_2071346_-	hypothetical protein	NA	NA	NA	NA
WP_099509449.1\|2071640_2071928_+	hypothetical protein	NA	NA	NA	NA
WP_099509450.1\|2072096_2072858_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.0e-67	52.7
WP_099509451.1\|2072876_2074415_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099509452.1\|2074563_2074749_+	hypothetical protein	NA	NA	NA	NA
WP_099509453.1\|2074976_2075198_-	hypothetical protein	NA	NA	NA	NA
WP_157934110.1\|2075788_2076625_-	hypothetical protein	NA	NA	NA	NA
WP_099509455.1\|2076706_2076970_-	hypothetical protein	NA	NA	NA	NA
WP_099509456.1\|2077221_2079009_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	4.9e-48	33.8
WP_099509457.1\|2079009_2079576_-	hypothetical protein	NA	NA	NA	NA
WP_099509458.1\|2079844_2080072_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099509459.1\|2080074_2080263_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157934111.1\|2080331_2080814_+	hypothetical protein	NA	NA	NA	NA
WP_099509461.1\|2080909_2082127_-\|integrase	site-specific integrase	A0A2R4AQW5	Mycobacterium_phage	6.8e-09	25.5
WP_099509462.1\|2082675_2082870_+	hypothetical protein	NA	NA	NA	NA
2082284:2082338	attR	NA	NA	NA	NA
WP_099509463.1\|2083034_2083583_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_099509464.1\|2083805_2085122_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	3.7e-29	30.8
WP_099509465.1\|2085121_2086474_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_099509466.1\|2086477_2086972_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_099509467.1\|2087045_2087426_-	ribosome silencing factor	NA	NA	NA	NA
WP_099509468.1\|2087524_2088181_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_099509469.1\|2088177_2089464_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.4e-84	45.5
WP_099509470.1\|2089614_2090733_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.1e-57	40.2
WP_099509471.1\|2090729_2091764_-	GTPase ObgE	NA	NA	NA	NA
WP_099509472.1\|2091916_2092567_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_036355650.1\|2092746_2093013_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_099509473.1\|2093048_2093441_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_099509475.1\|2096570_2097638_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

2957371 : 3025005

Leptospira_phage(16.67%)

protease,transposase,integrase

attL 2951978:2952037|attR 2972046:2972155

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2951978:2952037	attL	NA	NA	NA	NA
WP_099509451.1\|2957371_2958910_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_157934165.1\|2959601_2960078_+	hypothetical protein	NA	NA	NA	NA
WP_099510182.1\|2960071_2962177_+	recombinase family protein	NA	NA	NA	NA
WP_157934166.1\|2962943_2963162_+	hypothetical protein	NA	NA	NA	NA
WP_157934167.1\|2963307_2963700_-	hypothetical protein	NA	NA	NA	NA
WP_099512853.1\|2963972_2964641_+	recombinase family protein	A0A0F7L6S1	uncultured_marine_virus	7.0e-32	44.5
WP_099510185.1\|2967306_2967888_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_157934168.1\|2968943_2969333_-	hypothetical protein	NA	NA	NA	NA
WP_099510187.1\|2969741_2970635_-\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	1.0e-46	38.3
WP_157934169.1\|2970667_2970991_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157934170.1\|2970951_2971770_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	6.0e-09	24.0
WP_099510190.1\|2972305_2972596_+	YggT family protein	NA	NA	NA	NA
2972046:2972155	attR	NA	NA	NA	NA
WP_099510191.1\|2972600_2972927_+	DUF167 domain-containing protein	NA	NA	NA	NA
WP_099510192.1\|2972923_2973835_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.2e-23	34.2
WP_099512854.1\|2974109_2974739_-	hypothetical protein	NA	NA	NA	NA
WP_099510193.1\|2974912_2975800_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099510194.1\|2976003_2976399_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_099510195.1\|2976411_2976831_+	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_099510196.1\|2976842_2978666_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_099510197.1\|2978680_2979463_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_099510198.1\|2979634_2980222_+\|protease	AprI/Inh family metalloprotease inhibitor	NA	NA	NA	NA
WP_099508970.1\|2980352_2981807_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099512856.1\|2982158_2983364_+	cell division protein ZapE	NA	NA	NA	NA
WP_099510199.1\|2983360_2983990_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_099510200.1\|2984211_2985174_+	malate dehydrogenase	NA	NA	NA	NA
WP_099510201.1\|2985278_2986478_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_099510202.1\|2986490_2987378_+	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_099510203.1\|2987436_2990397_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_099510204.1\|2990410_2990731_+	hypothetical protein	NA	NA	NA	NA
WP_099510205.1\|2990757_2991996_+	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_099510206.1\|2992115_2993516_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-47	29.4
WP_099510207.1\|2993525_2994149_+	thymidine kinase	A0A248SL10	Salicola_phage	1.4e-42	44.7
WP_157934171.1\|2994240_2994495_+	hypothetical protein	NA	NA	NA	NA
WP_099510208.1\|2994523_2995507_-	tyrosine recombinase XerC	S5W9T9	Leptospira_phage	6.7e-15	26.3
WP_099510209.1\|2995553_2997716_+	primosomal protein N'	NA	NA	NA	NA
WP_099510210.1\|2997747_2998308_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_099510211.1\|2998517_2999090_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_099510212.1\|2999089_3000619_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_099510213.1\|3000674_3001547_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_099510214.1\|3001569_3003012_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_099510215.1\|3003126_3003528_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_099510216.1\|3003586_3004156_+	2'-5' RNA ligase family protein	NA	NA	NA	NA
WP_099510217.1\|3004264_3007363_-	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_099510218.1\|3007477_3007939_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_099510219.1\|3008154_3009165_-	TerC family protein	K7QKE8	Escherichia_phage	3.4e-38	33.5
WP_099510220.1\|3009392_3010505_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_162299218.1\|3010680_3011454_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.6e-30	35.1
WP_099510221.1\|3011462_3012230_+	ABC transporter permease	NA	NA	NA	NA
WP_099510222.1\|3012510_3013647_-	GTP-binding protein	NA	NA	NA	NA
WP_099510223.1\|3013651_3014557_-	DMT family transporter	NA	NA	NA	NA
WP_099510224.1\|3014689_3016114_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_099510225.1\|3016302_3017205_+	EamA family transporter	NA	NA	NA	NA
WP_157934172.1\|3017277_3017775_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_157934173.1\|3017844_3018009_+	hypothetical protein	NA	NA	NA	NA
WP_157934174.1\|3018320_3018551_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_099510227.1\|3018916_3019483_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_099510228.1\|3020146_3021478_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.5e-29	31.0
WP_099510230.1\|3022071_3023184_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_099510231.1\|3023382_3023829_+	hypothetical protein	NA	NA	NA	NA
WP_099510232.1\|3023778_3025005_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

4702409 : 4734476

Pseudomonas_phage(33.33%)

transposase,integrase

attL 4699201:4699222|attR 4734700:4734721

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4699201:4699222	attL	NA	NA	NA	NA
WP_099511638.1\|4702409_4703705_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099511639.1\|4704148_4704475_+	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	6.4e-23	56.7
WP_099511641.1\|4704519_4704744_-	hypothetical protein	NA	NA	NA	NA
WP_099511642.1\|4704862_4705069_-	hypothetical protein	NA	NA	NA	NA
WP_099511646.1\|4705574_4705760_-	hypothetical protein	NA	NA	NA	NA
WP_157934272.1\|4706072_4706477_-	hypothetical protein	NA	NA	NA	NA
WP_157934273.1\|4706804_4707107_+	hypothetical protein	NA	NA	NA	NA
WP_099511652.1\|4708295_4708649_+	hypothetical protein	NA	NA	NA	NA
WP_099511654.1\|4708741_4709185_+	GFA family protein	NA	NA	NA	NA
WP_099513153.1\|4709287_4710058_-	porin family protein	NA	NA	NA	NA
WP_099511638.1\|4710475_4711771_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099511656.1\|4712438_4713560_-	calcium-binding protein	NA	NA	NA	NA
WP_099508982.1\|4713822_4714101_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_099511657.1\|4714159_4715299_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_162299183.1\|4716495_4717572_-	AraC family transcriptional regulator ligand-binding domain-containing protein	NA	NA	NA	NA
WP_157934275.1\|4717750_4717900_+	hypothetical protein	NA	NA	NA	NA
WP_099511661.1\|4719056_4719521_+\|transposase	transposase	NA	NA	NA	NA
WP_157934276.1\|4719512_4721048_-	hypothetical protein	NA	NA	NA	NA
WP_099511662.1\|4721061_4722198_-	glycosyltransferase family 2 protein	A0A0N9P7Z4	Sulfolobales_Virus_YNP2	1.1e-26	37.4
WP_157934277.1\|4723212_4723368_+	hypothetical protein	NA	NA	NA	NA
WP_099511664.1\|4723645_4723978_+	hypothetical protein	NA	NA	NA	NA
WP_099511666.1\|4724001_4724328_-	hypothetical protein	NA	NA	NA	NA
WP_099511667.1\|4725027_4727070_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	3.8e-28	26.9
WP_099511669.1\|4727066_4728602_-	hypothetical protein	Q2NP91	Xanthomonas_phage	1.0e-09	28.9
WP_099511671.1\|4728605_4729910_-	AAA family ATPase	A0A0S0N5C8	Pseudomonas_phage	3.7e-61	35.9
WP_099511673.1\|4729913_4730261_-	hypothetical protein	NA	NA	NA	NA
WP_099511675.1\|4730257_4730803_-	hypothetical protein	NA	NA	NA	NA
WP_175608889.1\|4730914_4731202_-	hypothetical protein	NA	NA	NA	NA
WP_099511677.1\|4731277_4731940_-	hypothetical protein	NA	NA	NA	NA
WP_099511679.1\|4731936_4733037_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	3.3e-79	47.4
WP_099508982.1\|4732999_4733278_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_099511657.1\|4733336_4734476_+\|transposase	IS630 family transposase	NA	NA	NA	NA
4734700:4734721	attR	NA	NA	NA	NA

DBSCAN-SWA_12

4935205 : 4992938

uncultured_Mediterranean_phage(50.0%)

tRNA,transposase,integrase

attL 4946630:4946645|attR 4993816:4993831

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099513180.1\|4935205_4937014_+\|tRNA	aspartate--tRNA ligase	A0A2I2L4Y8	Orpheovirus	2.1e-06	30.2
WP_099511878.1\|4937010_4937883_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_099511879.1\|4937879_4938977_+	acyltransferase	A9YX16	Burkholderia_phage	2.1e-17	29.0
WP_099511880.1\|4938948_4939569_-	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	2.3e-29	46.7
WP_099511881.1\|4939782_4942086_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_099511882.1\|4942262_4943267_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.3e-15	25.1
WP_099511883.1\|4943325_4945185_-	hypothetical protein	NA	NA	NA	NA
WP_099511884.1\|4945273_4945600_-	iron-sulfur cluster insertion protein ErpA	NA	NA	NA	NA
WP_099511885.1\|4945688_4946903_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
4946630:4946645	attL	NA	NA	NA	NA
WP_099511886.1\|4947101_4948862_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_099511887.1\|4948970_4950389_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_099511888.1\|4950460_4951480_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.5e-25	40.2
WP_099513181.1\|4951519_4952320_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.3e-32	35.7
WP_099513182.1\|4952333_4953041_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.8e-41	51.5
WP_099511889.1\|4953037_4954162_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	6.7e-11	38.5
WP_099511890.1\|4954219_4954465_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	7.4e-08	70.0
WP_099511891.1\|4954538_4955132_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_099511892.1\|4955128_4955932_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.9e-53	46.2
WP_099511893.1\|4956032_4957394_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.0e-95	44.2
WP_099511894.1\|4957395_4958160_+	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_099511895.1\|4958174_4958858_+	methyltransferase domain-containing protein	A0A1J0MC37	Streptomyces_phage	6.7e-06	37.8
WP_099511896.1\|4958973_4960032_+	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	2.7e-14	38.2
WP_099511898.1\|4961409_4962300_-	ATP-binding protein	NA	NA	NA	NA
WP_173909488.1\|4962528_4962807_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	6.7e-13	50.6
WP_099511900.1\|4962896_4964504_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_099513183.1\|4964516_4965455_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-52	39.2
WP_099511901.1\|4965459_4965846_+	hypothetical protein	NA	NA	NA	NA
WP_099511902.1\|4965847_4966693_+	squalene/phytoene synthase family protein	NA	NA	NA	NA
WP_099511903.1\|4966909_4968328_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_099513184.1\|4968414_4969173_+	glucose 1-dehydrogenase	B5U431	Mycobacterium_phage	1.4e-07	28.4
WP_099511904.1\|4969257_4969413_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_099511905.1\|4969657_4970542_-	calcium-binding protein	NA	NA	NA	NA
WP_099511906.1\|4970812_4971619_+	hypothetical protein	NA	NA	NA	NA
WP_099511907.1\|4971716_4972037_+	hypothetical protein	NA	NA	NA	NA
WP_099511908.1\|4972070_4972355_-	porin	NA	NA	NA	NA
WP_099511909.1\|4972683_4973013_+	hypothetical protein	NA	NA	NA	NA
WP_157934291.1\|4973040_4973712_+	diguanylate cyclase	NA	NA	NA	NA
WP_173909489.1\|4973953_4974385_+	hypothetical protein	NA	NA	NA	NA
WP_099511912.1\|4974465_4974693_+	hypothetical protein	NA	NA	NA	NA
WP_099511913.1\|4974960_4975851_+	hypothetical protein	NA	NA	NA	NA
WP_099511914.1\|4975927_4976737_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_099511915.1\|4976881_4979878_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	63.7
WP_099511916.1\|4980083_4980758_+	hypothetical protein	NA	NA	NA	NA
WP_099511917.1\|4980892_4981432_+	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	1.6e-42	71.9
WP_099511918.1\|4981765_4981993_+	hypothetical protein	NA	NA	NA	NA
WP_099511919.1\|4982046_4983477_-	calcium-binding protein	NA	NA	NA	NA
WP_099511920.1\|4983674_4984790_+	M20 family metallopeptidase	NA	NA	NA	NA
WP_099511921.1\|4984786_4985299_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_173909527.1\|4986175_4986616_-	hypothetical protein	NA	NA	NA	NA
WP_099511923.1\|4986810_4987848_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_099511924.1\|4988078_4989431_-\|transposase	transposase	NA	NA	NA	NA
WP_099511925.1\|4989692_4990268_-\|transposase	transposase	NA	NA	NA	NA
WP_099511926.1\|4990264_4990807_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_099511788.1\|4990941_4991711_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157934292.1\|4992151_4992349_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_162299187.1\|4992452_4992938_+\|transposase	transposase	NA	NA	NA	NA
4993816:4993831	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP016619

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82679 : 122294

Acidithiobacillus_phage(33.33%)

transposase,integrase

attL 98244:98258|attR 129129:129143

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099512061.1\|82679_83821_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-54	41.0
WP_099514949.1\|83819_84095_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_099514950.1\|85195_86518_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_099515625.1\|86584_87772_+	aminotransferase class V-fold PLP-dependent enzyme	A0A2K9L679	Tupanvirus	4.4e-13	25.6
WP_099514951.1\|87805_88687_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099514952.1\|88729_90166_+	aspartate ammonia-lyase	NA	NA	NA	NA
WP_099514953.1\|90178_91288_+	alanine dehydrogenase	NA	NA	NA	NA
WP_157934588.1\|91655_91865_-	hypothetical protein	NA	NA	NA	NA
WP_099514955.1\|92524_93550_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514956.1\|93679_93994_-	cytochrome c	NA	NA	NA	NA
WP_099514957.1\|94669_94951_+	hypothetical protein	NA	NA	NA	NA
WP_099514958.1\|96017_96272_+	hypothetical protein	NA	NA	NA	NA
WP_099514959.1\|96271_98884_+	tyrosinase family protein	NA	NA	NA	NA
98244:98258	attL	NA	NA	NA	NA
WP_099514960.1\|99602_100457_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_099514961.1\|100616_101411_+	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_099508288.1\|102779_104318_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.5e-117	44.5
WP_099508289.1\|104331_105078_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.7e-59	49.0
WP_099514962.1\|106188_106464_+	hypothetical protein	NA	NA	NA	NA
WP_099514963.1\|107054_107366_-	hypothetical protein	NA	NA	NA	NA
WP_162299263.1\|107362_114874_-	hypothetical protein	NA	NA	NA	NA
WP_099515626.1\|115440_115845_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_157934589.1\|115979_116438_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099514966.1\|116595_118920_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.4e-119	33.2
WP_099515627.1\|119121_121023_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099514967.1\|121172_122294_-\|integrase	tyrosine-type recombinase/integrase	A0A1Y0T0H2	Sinorhizobium_phage	4.1e-08	31.8
129129:129143	attR	NA	NA	NA	NA

DBSCAN-SWA_2

185572 : 245198

Planktothrix_phage(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515024.1\|185572_186910_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099515025.1\|187310_188174_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_099515026.1\|188326_189670_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_099515630.1\|189789_190635_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_099515027.1\|190636_191470_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_099515028.1\|191511_192582_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.9e-23	34.5
WP_162299268.1\|192670_193495_+	NAD-binding protein	NA	NA	NA	NA
WP_099515030.1\|193545_194562_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_099515031.1\|194585_195728_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.1e-45	32.9
WP_099515032.1\|196654_197920_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	4.5e-96	47.2
WP_099515033.1\|198494_199265_-	calcium-binding protein	NA	NA	NA	NA
WP_099515034.1\|199457_199937_-	fasciclin domain-containing protein	NA	NA	NA	NA
WP_099515035.1\|200152_201346_+	PAS domain-containing protein	NA	NA	NA	NA
WP_099515036.1\|201396_202044_+	response regulator transcription factor	NA	NA	NA	NA
WP_099515037.1\|202073_202835_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	6.5e-34	37.8
WP_099515038.1\|202851_204213_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_099515039.1\|204606_206157_+	phytoene desaturase	NA	NA	NA	NA
WP_099515040.1\|206280_207363_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_099515631.1\|207445_208981_+	phytoene desaturase	NA	NA	NA	NA
WP_099515041.1\|209076_209817_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_099515042.1\|209813_210926_+	glycosyltransferase	NA	NA	NA	NA
WP_162299269.1\|210922_212581_+	squalene/phytoene synthase family protein	NA	NA	NA	NA
WP_099515044.1\|212577_213864_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_099515045.1\|213860_214829_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_099515046.1\|215020_216226_-	ABC transporter permease	NA	NA	NA	NA
WP_099515047.1\|216222_217212_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	25.1
WP_099515632.1\|217214_217628_-	DUF2141 domain-containing protein	NA	NA	NA	NA
WP_162299259.1\|217976_218291_-	hypothetical protein	NA	NA	NA	NA
WP_099515049.1\|219207_219426_+	hypothetical protein	NA	NA	NA	NA
WP_099515051.1\|219667_219994_+	hypothetical protein	NA	NA	NA	NA
WP_157934597.1\|220233_220746_+	hypothetical protein	NA	NA	NA	NA
WP_099515053.1\|221031_221418_-	restriction endonuclease	NA	NA	NA	NA
WP_099515054.1\|221550_222030_-	DUF427 domain-containing protein	NA	NA	NA	NA
WP_099515055.1\|222175_222385_+	DUF2945 domain-containing protein	NA	NA	NA	NA
WP_099515056.1\|222506_222887_+	DUF4174 domain-containing protein	NA	NA	NA	NA
WP_099515057.1\|222927_224331_+	deoxyribodipyrimidine photo-lyase	B3TZ20	Ampelophaga_rubiginosa_nucleopolyhedrovirus	1.5e-73	36.9
WP_099515058.1\|224579_225047_+	hypothetical protein	NA	NA	NA	NA
WP_099515059.1\|225033_225732_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	6.3e-44	46.1
WP_175608900.1\|225742_225994_+	hypothetical protein	NA	NA	NA	NA
WP_099515060.1\|226132_227698_-	hypothetical protein	NA	NA	NA	NA
WP_099515633.1\|227888_228503_+	glutathione S-transferase	NA	NA	NA	NA
WP_099515061.1\|228788_228980_+	hypothetical protein	NA	NA	NA	NA
WP_099515062.1\|230288_230999_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515063.1\|231298_232060_-	NADPH-dependent F420 reductase	NA	NA	NA	NA
WP_099515064.1\|232112_232577_-	SRPBCC family protein	NA	NA	NA	NA
WP_099515065.1\|232579_232894_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099515067.1\|233589_234300_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.7e-26	36.2
WP_099515068.1\|235042_235399_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_157934598.1\|236857_237004_+	hypothetical protein	NA	NA	NA	NA
WP_099515069.1\|237558_238620_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_099513503.1\|238713_240927_+	amylo-alpha-1,6-glucosidase	NA	NA	NA	NA
WP_099515070.1\|241346_241580_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099515634.1\|242135_243083_-	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_099512264.1\|243548_245198_-\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

316112 : 355485

Acidithiobacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508542.1\|316112_317468_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	4.9e-32	30.2
WP_099515641.1\|318427_319186_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_157934608.1\|319722_320313_+	LemA family protein	NA	NA	NA	NA
WP_099515131.1\|320360_320687_+	hypothetical protein	NA	NA	NA	NA
WP_099515132.1\|320985_321921_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_099515133.1\|322047_322743_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_099515642.1\|323306_324023_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	6.9e-54	45.9
WP_157934609.1\|325848_326229_-	hypothetical protein	NA	NA	NA	NA
WP_099515135.1\|326836_327805_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-50	37.2
WP_099515138.1\|328484_328733_-	hypothetical protein	NA	NA	NA	NA
WP_099515139.1\|328870_331000_-	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_099515140.1\|331514_332675_+	FIST C-terminal domain-containing protein	NA	NA	NA	NA
WP_099515643.1\|333301_334507_+	response regulator	NA	NA	NA	NA
WP_099515141.1\|334929_335637_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515142.1\|335827_336970_+	GAF domain-containing protein	NA	NA	NA	NA
WP_099515143.1\|337488_337680_+	hypothetical protein	NA	NA	NA	NA
WP_157934610.1\|337788_338001_+	hypothetical protein	NA	NA	NA	NA
WP_099515145.1\|338320_338530_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.5e-09	51.6
WP_099515146.1\|338651_338843_+	hypothetical protein	NA	NA	NA	NA
WP_099515644.1\|338874_339216_+	hypothetical protein	NA	NA	NA	NA
WP_099515147.1\|339282_340479_+	PAS domain-containing protein	NA	NA	NA	NA
WP_173909572.1\|340552_340939_+	response regulator	NA	NA	NA	NA
WP_099515646.1\|340994_341729_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099515148.1\|342048_342270_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_099515149.1\|342392_342869_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	5.3e-10	38.0
WP_099515150.1\|343061_343370_+	zf-TFIIB domain-containing protein	NA	NA	NA	NA
WP_099515151.1\|343540_344764_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_099515152.1\|345147_345564_+	DUF1236 domain-containing protein	NA	NA	NA	NA
WP_157934611.1\|345553_345742_-	hypothetical protein	NA	NA	NA	NA
WP_099515647.1\|345974_347015_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_099515153.1\|346958_347447_+	GTPase RsgA	NA	NA	NA	NA
WP_099509450.1\|347477_348239_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.0e-67	52.7
WP_099509451.1\|348257_349796_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099515154.1\|351455_351695_-	hypothetical protein	NA	NA	NA	NA
WP_157933981.1\|351832_352276_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099515155.1\|353291_353546_-	hypothetical protein	NA	NA	NA	NA
WP_099515649.1\|354129_355485_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_4

368348 : 438523

Streptococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099509475.1\|368348_369416_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	8.0e-06	28.6
WP_157934614.1\|369687_370338_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162299271.1\|370389_371778_-	PAS domain-containing protein	NA	NA	NA	NA
WP_099515167.1\|371956_372739_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099515168.1\|373092_373416_+	hypothetical protein	NA	NA	NA	NA
WP_099515169.1\|374567_375056_-	DNA starvation/stationary phase protection protein Dps	A0A222YTY5	Streptomyces_phage	1.8e-08	30.2
WP_099515170.1\|375151_375547_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_099515171.1\|375808_376117_-	hypothetical protein	NA	NA	NA	NA
WP_157934615.1\|376369_376816_-	response regulator	NA	NA	NA	NA
WP_099515173.1\|376906_377401_-	fasciclin domain-containing protein	NA	NA	NA	NA
WP_099515174.1\|377594_378182_+	cupin domain-containing protein	NA	NA	NA	NA
WP_099515176.1\|379869_380865_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515177.1\|381183_382482_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099507922.1\|382642_383938_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099515178.1\|384154_384592_-	hypothetical protein	NA	NA	NA	NA
WP_099515180.1\|385227_385530_+	hypothetical protein	NA	NA	NA	NA
WP_099515181.1\|385608_385899_-	hypothetical protein	NA	NA	NA	NA
WP_099512246.1\|386461_387793_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.6e-30	31.3
WP_157934616.1\|388918_389779_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_099515183.1\|389865_391686_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_157934617.1\|392029_392599_+	hypothetical protein	NA	NA	NA	NA
WP_099515185.1\|392807_393230_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_099515650.1\|393256_393439_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_099515186.1\|394165_394420_+	hypothetical protein	NA	NA	NA	NA
WP_099515187.1\|394480_395371_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099515188.1\|395526_395895_-	phasin family protein	NA	NA	NA	NA
WP_099515189.1\|396657_398352_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.8e-23	28.8
WP_173909563.1\|398626_399439_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_099515190.1\|399468_399729_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_157934618.1\|400177_400738_+	hypothetical protein	NA	NA	NA	NA
WP_157934619.1\|401309_402302_+	phasin family protein	NA	NA	NA	NA
WP_099515192.1\|403045_404287_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_099515193.1\|405767_406823_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513340.1\|407502_409575_-	recombinase family protein	NA	NA	NA	NA
WP_099513339.1\|409561_409741_-	hypothetical protein	NA	NA	NA	NA
WP_099515195.1\|411224_411482_-	WGR domain-containing protein	NA	NA	NA	NA
WP_157934620.1\|411496_412030_-	DUF551 domain-containing protein	NA	NA	NA	NA
WP_099515652.1\|412741_412927_+	hypothetical protein	NA	NA	NA	NA
WP_099515197.1\|413017_413266_-	hypothetical protein	NA	NA	NA	NA
WP_099515198.1\|413268_413484_-	WGR domain-containing protein	NA	NA	NA	NA
WP_099515199.1\|413613_413826_-	hypothetical protein	NA	NA	NA	NA
WP_099515200.1\|413858_414101_-	hypothetical protein	NA	NA	NA	NA
WP_099515201.1\|414956_415901_+	amidoligase family protein	NA	NA	NA	NA
WP_099515202.1\|416035_416566_-	hypothetical protein	NA	NA	NA	NA
WP_099515203.1\|416669_417515_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_099515653.1\|417533_418601_-	DUF3616 domain-containing protein	NA	NA	NA	NA
WP_099515204.1\|418998_420390_+	phospholipase	NA	NA	NA	NA
WP_099515206.1\|421113_422016_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_099515207.1\|422047_422455_+	DUF2000 family protein	NA	NA	NA	NA
WP_099515208.1\|422665_423673_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_099515209.1\|423676_425098_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_099515210.1\|425099_425684_-	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_099515211.1\|425929_426424_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_157934621.1\|427133_427490_+	hypothetical protein	NA	NA	NA	NA
WP_099515213.1\|428815_429886_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099515214.1\|430406_431405_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_099515215.1\|431563_432547_-	hypothetical protein	NA	NA	NA	NA
WP_099515217.1\|433480_434122_+	hypothetical protein	NA	NA	NA	NA
WP_099515218.1\|437170_438523_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

445838 : 500199

Acidithiobacillus_phage(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099509451.1\|445838_447377_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.5e-127	45.5
WP_099510182.1\|448040_450146_-	recombinase family protein	NA	NA	NA	NA
WP_162299260.1\|450139_450676_-	hypothetical protein	NA	NA	NA	NA
WP_099515230.1\|452164_452449_-	hypothetical protein	NA	NA	NA	NA
WP_173909564.1\|453524_453740_+	hypothetical protein	NA	NA	NA	NA
WP_157934626.1\|453812_454130_-	hypothetical protein	NA	NA	NA	NA
WP_099515233.1\|455457_458328_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_157934627.1\|458444_458891_+	hypothetical protein	NA	NA	NA	NA
WP_099515235.1\|459083_459473_+	hypothetical protein	NA	NA	NA	NA
WP_173909565.1\|459675_459948_-	hypothetical protein	NA	NA	NA	NA
WP_099515237.1\|460091_460361_-	hypothetical protein	NA	NA	NA	NA
WP_099515238.1\|460472_460814_+	hypothetical protein	NA	NA	NA	NA
WP_099515239.1\|461508_462198_+	hypothetical protein	NA	NA	NA	NA
WP_099515240.1\|462601_463387_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099515241.1\|463493_463688_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_157934628.1\|463976_464180_+	hypothetical protein	NA	NA	NA	NA
WP_099515243.1\|464254_464692_+	hypothetical protein	NA	NA	NA	NA
WP_099515244.1\|464998_465664_-	ParA family protein	A2I303	Vibrio_virus	1.7e-14	26.6
WP_099515245.1\|465993_467289_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_157934629.1\|467442_467829_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_099515247.1\|468156_468426_+	hypothetical protein	NA	NA	NA	NA
WP_099515248.1\|468553_468757_-	hypothetical protein	NA	NA	NA	NA
WP_099515249.1\|468913_469162_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_099515654.1\|469391_470213_-	SHOCT domain-containing protein	NA	NA	NA	NA
WP_099515250.1\|471877_472081_-	hypothetical protein	NA	NA	NA	NA
WP_099515251.1\|472264_473083_-	transglutaminase family protein	NA	NA	NA	NA
WP_099515655.1\|473130_473400_-	hypothetical protein	NA	NA	NA	NA
WP_099515252.1\|473860_474070_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.0e-10	52.9
WP_099515253.1\|474544_475314_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157934630.1\|475927_476698_-	hypothetical protein	NA	NA	NA	NA
WP_099515255.1\|476743_477091_+	hypothetical protein	NA	NA	NA	NA
WP_099515256.1\|477350_478364_-	hydroxyacid dehydrogenase	M1I636	Acanthocystis_turfacea_Chlorella_virus	4.8e-16	30.8
WP_099512750.1\|478514_479570_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.4e-26	35.0
WP_157934631.1\|479596_480658_-	hypothetical protein	NA	NA	NA	NA
WP_099515258.1\|480671_481679_-	hypothetical protein	NA	NA	NA	NA
WP_157934632.1\|481954_483253_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_099515260.1\|483349_484282_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_157934633.1\|484344_485151_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_099515262.1\|485161_486181_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_099515263.1\|486852_487551_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.7e-65	55.2
WP_099515264.1\|487609_489391_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_099515265.1\|489541_490351_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_099515266.1\|490677_490935_-	hypothetical protein	NA	NA	NA	NA
WP_099515268.1\|491503_491806_-	SWIB/MDM2 domain-containing protein	NA	NA	NA	NA
WP_099515269.1\|491841_492549_-	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	1.8e-09	29.6
WP_099515270.1\|492704_493157_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_099515272.1\|493862_494651_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099515273.1\|494756_495041_+	hypothetical protein	NA	NA	NA	NA
WP_099508342.1\|495807_497073_-	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_162299272.1\|497572_498724_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099508970.1\|498744_500199_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2

DBSCAN-SWA_6

503862 : 562135

Escherichia_phage(16.67%)

transposase,integrase

attL 495281:495296|attR 563903:563918

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
495281:495296	attL	NA	NA	NA	NA
WP_099514513.1\|503862_504561_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.6e-63	55.2
WP_099515278.1\|506671_507601_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_099515279.1\|507612_509058_-	amidohydrolase family protein	NA	NA	NA	NA
WP_099515280.1\|509054_510524_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515281.1\|510523_511552_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.8e-21	34.1
WP_099515282.1\|511548_512529_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-12	27.4
WP_099515283.1\|512549_513422_-	ABC transporter permease	NA	NA	NA	NA
WP_099515284.1\|513429_514395_-	ABC transporter permease	NA	NA	NA	NA
WP_099515285.1\|514485_516054_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515286.1\|516101_516500_-	VOC family protein	NA	NA	NA	NA
WP_099515287.1\|516496_517876_-	amidohydrolase family protein	NA	NA	NA	NA
WP_099515288.1\|517872_518532_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_099515289.1\|518726_519434_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_173909566.1\|519960_520827_+	hypothetical protein	NA	NA	NA	NA
WP_099515291.1\|522277_523759_-	dihydropyrimidinase	NA	NA	NA	NA
WP_099515292.1\|523787_524462_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_099515293.1\|524461_525136_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_173909573.1\|525145_525871_-	ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	4.2e-06	25.1
WP_099515656.1\|525912_526764_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515295.1\|526899_527826_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099515296.1\|527945_529067_+	DUF917 family protein	NA	NA	NA	NA
WP_099515297.1\|529179_530529_+	amidohydrolase family protein	NA	NA	NA	NA
WP_099515657.1\|530534_531779_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_099515298.1\|531783_532455_+	flavin reductase family protein	NA	NA	NA	NA
WP_099515299.1\|532451_533141_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_099515300.1\|533137_534562_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_099515301.1\|534575_535502_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_099515302.1\|535501_536287_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_157934671.1\|536773_537970_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_173909574.1\|537980_538841_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	5.5e-21	28.1
WP_157934672.1\|539184_540309_-	hypothetical protein	K4JS89	Caulobacter_virus	4.2e-05	34.1
WP_099515304.1\|542085_543417_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.5e-29	31.0
WP_157934635.1\|544990_545848_+	glutaredoxin 3	I1TRQ4	Cronobacter_phage	1.9e-05	43.8
WP_157934636.1\|546425_547181_-\|transposase	transposase	NA	NA	NA	NA
WP_099514078.1\|547354_548608_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	4.6e-45	36.5
WP_099514429.1\|548604_549477_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.1e-52	47.2
WP_099515306.1\|549964_550828_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	7.6e-31	33.0
WP_175608902.1\|551623_551902_-	hypothetical protein	NA	NA	NA	NA
WP_099515660.1\|553985_555005_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	2.0e-70	41.5
WP_099515308.1\|555061_555427_+	hypothetical protein	NA	NA	NA	NA
WP_099515309.1\|555423_555831_-	hypothetical protein	NA	NA	NA	NA
WP_099515310.1\|556062_556380_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_099515311.1\|556483_557485_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157934170.1\|557881_558700_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157934169.1\|558660_558984_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099515312.1\|559440_560007_+	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_099514570.1\|560839_562135_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
563903:563918	attR	NA	NA	NA	NA

DBSCAN-SWA_7

571218 : 635336

Planktothrix_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515323.1\|571218_571929_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515324.1\|572348_573767_-	amidohydrolase	NA	NA	NA	NA
WP_099515325.1\|573816_574686_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_099515326.1\|574682_575687_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.3e-17	31.0
WP_099515327.1\|575683_576667_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-18	35.1
WP_099515328.1\|576666_577578_-	ABC transporter permease	NA	NA	NA	NA
WP_099515329.1\|577574_578552_-	ABC transporter permease	NA	NA	NA	NA
WP_099515330.1\|578590_580201_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515331.1\|580302_581175_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_099515332.1\|581684_582077_+	hypothetical protein	NA	NA	NA	NA
WP_099515333.1\|582243_582741_-	RidA family protein	NA	NA	NA	NA
WP_099515661.1\|582785_583193_-	cytochrome c	NA	NA	NA	NA
WP_099515334.1\|583264_584866_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_157934638.1\|585073_586477_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_162299273.1\|586715_587042_-	hypothetical protein	NA	NA	NA	NA
WP_099515337.1\|587210_588224_+	cadherin-like domain-containing protein	NA	NA	NA	NA
WP_157934640.1\|588147_590490_+	hypothetical protein	NA	NA	NA	NA
WP_099515339.1\|590635_591025_+	hypothetical protein	NA	NA	NA	NA
WP_157934641.1\|591937_592654_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_099515341.1\|592687_594190_+	peptide ABC transporter	NA	NA	NA	NA
WP_099515342.1\|594209_595139_+	ABC transporter permease	NA	NA	NA	NA
WP_099515343.1\|595135_596002_+	ABC transporter permease	NA	NA	NA	NA
WP_099515344.1\|596009_596801_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.5e-22	34.8
WP_099515345.1\|596812_597706_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_173909567.1\|597705_599262_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_099515347.1\|599251_600250_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.2e-12	25.3
WP_099515348.1\|600246_601233_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.5e-18	33.0
WP_099515349.1\|601264_601666_+	RidA family protein	NA	NA	NA	NA
WP_099515350.1\|602095_602338_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_099515253.1\|602502_603271_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099515351.1\|603679_604387_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_099515352.1\|604386_605112_-	hypothetical protein	NA	NA	NA	NA
WP_099515353.1\|605509_606276_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099515354.1\|606432_609165_+	UPF0182 family protein	NA	NA	NA	NA
WP_099515355.1\|609564_609888_-	cytochrome c	NA	NA	NA	NA
WP_099515357.1\|610331_610838_+	DUF2267 domain-containing protein	NA	NA	NA	NA
WP_099515358.1\|610970_611417_+	CBS domain-containing protein	NA	NA	NA	NA
WP_099515359.1\|611550_611841_+	hypothetical protein	NA	NA	NA	NA
WP_099515360.1\|611945_612686_+	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	2.3e-12	35.3
WP_099515361.1\|612706_612952_+	hypothetical protein	NA	NA	NA	NA
WP_162299274.1\|614508_614661_+\|transposase	transposase	NA	NA	NA	NA
WP_162299275.1\|614608_615046_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	7.3e-06	33.3
WP_099515363.1\|615086_615746_-	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_099515662.1\|615795_616650_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_157934642.1\|616818_617112_+	hypothetical protein	NA	NA	NA	NA
WP_099515365.1\|617313_618252_-	transglutaminase domain-containing protein	NA	NA	NA	NA
WP_099515663.1\|618850_619318_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_099515664.1\|619467_620895_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_099515665.1\|621347_621671_-	cytosolic protein	NA	NA	NA	NA
WP_099515366.1\|621738_622209_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_099515367.1\|622381_623218_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.8e-05	28.5
WP_099515368.1\|623396_624227_-	PAS domain-containing protein	NA	NA	NA	NA
WP_175608903.1\|625232_626045_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_099515667.1\|626072_626315_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_099515369.1\|626412_627024_+	hypothetical protein	NA	NA	NA	NA
WP_099515370.1\|627265_629968_+	DEAD/DEAH box helicase	A0A2I7MM20	Spilosoma_obliqua_nucleopolyhedrosis_virus	1.1e-38	29.1
WP_157934643.1\|629973_631059_+	SWIM zinc finger family protein	NA	NA	NA	NA
WP_099515371.1\|631163_631601_+	hypothetical protein	NA	NA	NA	NA
WP_099515372.1\|632099_633431_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.5e-29	31.0
WP_099508077.1\|634049_635336_-\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

652291 : 718577

Pseudomonas_phage(14.29%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515385.1\|652291_653305_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099515386.1\|653872_655762_+	sensor histidine kinase	A0A1B0VMK3	Pseudomonas_phage	6.8e-08	25.4
WP_099515387.1\|656088_656655_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_162299276.1\|656880_658056_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_099515389.1\|658849_660355_-	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_099515390.1\|660354_661026_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_099515391.1\|661149_662205_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_099515392.1\|662296_663142_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_099515393.1\|663166_663586_-	hypothetical protein	NA	NA	NA	NA
WP_099515394.1\|663596_665426_-	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_099515395.1\|665422_667513_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_099515396.1\|667584_668178_-	hypothetical protein	NA	NA	NA	NA
WP_099515397.1\|668424_669372_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_099515398.1\|669604_670522_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099508287.1\|671531_672299_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_157933989.1\|672295_673783_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099513495.1\|674074_674464_-	hypothetical protein	NA	NA	NA	NA
WP_175608904.1\|674761_675364_+	hypothetical protein	NA	NA	NA	NA
WP_157934646.1\|676015_676225_+	cytochrome c	NA	NA	NA	NA
WP_157934647.1\|676184_676817_-	hypothetical protein	NA	NA	NA	NA
WP_157934648.1\|676947_678705_+	adenylate cyclase	NA	NA	NA	NA
WP_099515401.1\|678783_679764_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_099515402.1\|679991_681722_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_157934649.1\|681785_682139_-	hypothetical protein	NA	NA	NA	NA
WP_099515404.1\|682223_682976_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_157934650.1\|683177_683342_+	hypothetical protein	NA	NA	NA	NA
WP_099511749.1\|683602_684889_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_099515406.1\|685431_685674_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_099515407.1\|686154_686361_+	hypothetical protein	NA	NA	NA	NA
WP_099515408.1\|687178_688744_+	hypothetical protein	NA	NA	NA	NA
WP_099515409.1\|689879_690512_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099515410.1\|691607_691892_-	hypothetical protein	NA	NA	NA	NA
WP_099515411.1\|692039_692810_-	porin family protein	Q94M22	Bartonella_quintana_phage	2.8e-08	32.4
WP_099515668.1\|693986_696152_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	5.9e-80	44.2
WP_099515413.1\|696569_697010_-	hypothetical protein	NA	NA	NA	NA
WP_099515414.1\|697363_697981_-	hypothetical protein	NA	NA	NA	NA
WP_099515669.1\|698243_699095_+	transglycosylase SLT domain-containing protein	A0A0K2CNS6	Brevibacillus_phage	2.4e-05	28.6
WP_099515415.1\|699361_700051_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_099515416.1\|701136_701643_-	3'-5' exonuclease	NA	NA	NA	NA
WP_099515417.1\|702186_703374_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_099515418.1\|703541_703760_-	hypothetical protein	NA	NA	NA	NA
WP_099515419.1\|704132_705164_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_099515420.1\|705271_705499_-	hypothetical protein	NA	NA	NA	NA
WP_099515421.1\|705742_706408_-	ParA family protein	A2I303	Vibrio_virus	6.5e-14	26.6
WP_099515422.1\|706737_708033_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_157934629.1\|708186_708573_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_099515247.1\|708900_709170_+	hypothetical protein	NA	NA	NA	NA
WP_099515248.1\|709297_709501_-	hypothetical protein	NA	NA	NA	NA
WP_099515249.1\|709657_709906_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_099515654.1\|710135_710957_-	SHOCT domain-containing protein	NA	NA	NA	NA
WP_036349065.1\|712622_712826_-	hypothetical protein	NA	NA	NA	NA
WP_099515423.1\|713009_713828_-	transglutaminase family protein	NA	NA	NA	NA
WP_099515424.1\|713875_714145_-	hypothetical protein	NA	NA	NA	NA
WP_099515425.1\|714283_714496_+	hypothetical protein	NA	NA	NA	NA
WP_099515426.1\|714595_714805_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	3.0e-10	52.9
WP_157934651.1\|715224_715407_+	hypothetical protein	NA	NA	NA	NA
WP_157934652.1\|715741_716593_-	hypothetical protein	NA	NA	NA	NA
WP_099515428.1\|716638_716986_+	hypothetical protein	NA	NA	NA	NA
WP_099515429.1\|717278_718577_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP016620

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9137 : 74949

Lactococcus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157933989.1\|9137_10625_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|10621_11389_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_099515704.1\|11619_12060_-	hypothetical protein	NA	NA	NA	NA
WP_099515705.1\|12873_13767_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099515706.1\|13854_15201_+	DUF1446 domain-containing protein	NA	NA	NA	NA
WP_099515707.1\|15202_15547_+	hypothetical protein	NA	NA	NA	NA
WP_099515708.1\|15572_16544_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_099515709.1\|16583_18632_+	D-(-)-3-hydroxybutyrate oligomer hydrolase	NA	NA	NA	NA
WP_099515710.1\|18932_19955_-	DUF2279 domain-containing protein	NA	NA	NA	NA
WP_099515711.1\|20281_22015_-	recombinase family protein	E9P5U5	Wolbachia_endosymbiont_wVitA_of_Nasonia_vitripennis_phage	2.0e-94	37.4
WP_099514215.1\|22007_22205_-	hypothetical protein	NA	NA	NA	NA
WP_099515712.1\|24358_24949_-	hypothetical protein	NA	NA	NA	NA
WP_099515713.1\|25201_25600_+	hypothetical protein	NA	NA	NA	NA
WP_099515714.1\|26790_27888_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_099515715.1\|28182_29466_-	ATP-binding protein	NA	NA	NA	NA
WP_099516115.1\|29685_29901_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_157933989.1\|30019_31507_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|31503_32271_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_157934676.1\|32535_34230_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_099515717.1\|34568_35549_+	quinone oxidoreductase	A0A0K0KVL7	Prochlorococcus_phage	9.6e-06	28.5
WP_099515718.1\|35933_36233_+	DUF3303 family protein	NA	NA	NA	NA
WP_157934677.1\|36519_36687_+	hypothetical protein	NA	NA	NA	NA
WP_099515719.1\|36721_37012_+	hypothetical protein	NA	NA	NA	NA
WP_157934678.1\|37159_37810_+	hypothetical protein	NA	NA	NA	NA
WP_099516116.1\|38094_39042_+	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_157934679.1\|39776_40217_+	hypothetical protein	NA	NA	NA	NA
WP_099515721.1\|42861_43524_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_099515722.1\|43520_44546_+	HupE/UreJ family protein	NA	NA	NA	NA
WP_099515723.1\|44637_46272_+	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_099515724.1\|46343_47762_+	DUF1254 domain-containing protein	M1H738	Paramecium_bursaria_Chlorella_virus	4.3e-79	39.4
WP_099515725.1\|48041_49373_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-29	31.3
WP_099516117.1\|50034_50484_+	DUF3597 domain-containing protein	NA	NA	NA	NA
WP_099515726.1\|50601_51252_-	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	7.0e-45	41.0
WP_099515727.1\|51536_52664_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_157934680.1\|52762_52969_-	hypothetical protein	NA	NA	NA	NA
WP_157934681.1\|53164_53971_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.9e-16	38.0
WP_099515729.1\|54003_54939_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_157934682.1\|55209_55827_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157934683.1\|55828_56338_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_099515732.1\|56392_57085_+	NnrU family protein	NA	NA	NA	NA
WP_099515733.1\|57088_57529_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_099515734.1\|57617_58010_+	hypothetical protein	NA	NA	NA	NA
WP_099515735.1\|58399_59758_+	hypothetical protein	NA	NA	NA	NA
WP_099515736.1\|59796_60612_+	inositol monophosphatase	NA	NA	NA	NA
WP_099515737.1\|60608_61223_+	hypothetical protein	NA	NA	NA	NA
WP_157934684.1\|61480_62554_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_099516118.1\|62657_63356_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.8e-45	46.5
WP_099515739.1\|63626_65582_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_099516119.1\|65682_66054_+	response regulator	NA	NA	NA	NA
WP_157934685.1\|66628_66850_-	hypothetical protein	NA	NA	NA	NA
WP_099516120.1\|67068_67566_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099515741.1\|67633_68032_+	hypothetical protein	NA	NA	NA	NA
WP_099515742.1\|69568_70351_+	maleate cis-trans isomerase	NA	NA	NA	NA
WP_099514582.1\|70557_70764_+	hypothetical protein	NA	NA	NA	NA
WP_157934534.1\|70797_70965_+	hypothetical protein	NA	NA	NA	NA
WP_099515743.1\|71186_71435_-	hypothetical protein	NA	NA	NA	NA
WP_099515744.1\|71554_71875_-	hypothetical protein	NA	NA	NA	NA
WP_099508970.1\|72442_73897_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099515745.1\|74238_74949_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.2e-28	37.6

DBSCAN-SWA_2

84648 : 137247

Escherichia_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515756.1\|84648_85359_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515757.1\|85739_86147_-	cupin domain-containing protein	NA	NA	NA	NA
WP_173909578.1\|86175_86880_-	FCD domain-containing protein	NA	NA	NA	NA
WP_099515758.1\|87400_88387_+	hypothetical protein	NA	NA	NA	NA
WP_099515759.1\|88489_89572_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_099515760.1\|89641_90718_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_099515761.1\|91268_92363_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_099515762.1\|92670_92925_+	hypothetical protein	NA	NA	NA	NA
WP_099515763.1\|92985_93876_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099515764.1\|94513_94816_-	hypothetical protein	NA	NA	NA	NA
WP_099515765.1\|95008_95707_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.0e-62	54.3
WP_162299285.1\|95825_97556_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-08	29.3
WP_099515767.1\|98148_98784_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099516124.1\|99690_100617_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_099515768.1\|100639_101572_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_099515769.1\|101592_104109_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-13	29.0
WP_099515770.1\|104114_104990_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_099515771.1\|105116_106367_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515772.1\|106441_107167_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_099515773.1\|107257_108034_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.1e-09	34.1
WP_099515774.1\|108114_108813_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	8.0e-63	54.7
WP_157934689.1\|109704_109860_-	hypothetical protein	NA	NA	NA	NA
WP_099516125.1\|110467_112270_+	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_099515775.1\|112393_115846_-	response regulator	B5LWN8	Feldmannia_species_virus	1.2e-05	32.1
WP_099515776.1\|116191_116383_+	hypothetical protein	NA	NA	NA	NA
WP_157934690.1\|116521_116827_+	response regulator	NA	NA	NA	NA
WP_099515778.1\|116826_117222_+	response regulator	NA	NA	NA	NA
WP_099515779.1\|117250_117550_-	hypothetical protein	NA	NA	NA	NA
WP_099515780.1\|117598_117805_-	hypothetical protein	NA	NA	NA	NA
WP_157934691.1\|117891_118047_+	hypothetical protein	NA	NA	NA	NA
WP_099515781.1\|118079_118778_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.0e-62	53.9
WP_099515782.1\|120019_120571_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_099516126.1\|120814_122314_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515783.1\|123171_124302_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_099515784.1\|124301_125345_-	SIS domain-containing protein	M1I1B8	Acanthocystis_turfacea_Chlorella_virus	1.4e-18	29.1
WP_099515785.1\|125384_126998_-	putative N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_099515786.1\|126994_128038_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_099515787.1\|128034_129006_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_099516127.1\|129133_129856_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_099515788.1\|129868_131452_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515789.1\|131528_132488_+	ABC transporter permease	NA	NA	NA	NA
WP_099515790.1\|132490_133372_+	ABC transporter permease	NA	NA	NA	NA
WP_099515791.1\|133392_134310_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_099515792.1\|134314_135325_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-09	29.9
WP_099515793.1\|135327_136296_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.6e-23	33.3
WP_099515794.1\|136536_137247_-\|transposase	IS6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

201154 : 330282

110

Escherichia_phage(15.0%)

protease,transposase,terminase,integrase

attL 283469:283528|attR 337175:338231

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515839.1\|201154_201856_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515841.1\|202603_203098_+	DUF2382 domain-containing protein	NA	NA	NA	NA
WP_099515842.1\|203094_204060_+	DUF2382 domain-containing protein	NA	NA	NA	NA
WP_099515843.1\|204167_204443_+	response regulator	NA	NA	NA	NA
WP_099516134.1\|206173_207184_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_157934703.1\|207345_207522_-	hypothetical protein	NA	NA	NA	NA
WP_099515845.1\|207588_207840_+	hypothetical protein	NA	NA	NA	NA
WP_157934704.1\|208347_208821_-	hypothetical protein	NA	NA	NA	NA
WP_099515848.1\|209277_209463_+	hypothetical protein	NA	NA	NA	NA
WP_099515849.1\|209491_210166_+	GTP cyclohydrolase I	A0A1C3NFQ1	Phage_NCTB	5.7e-42	40.4
WP_099516135.1\|210220_210670_+	PACE efflux transporter	NA	NA	NA	NA
WP_099509797.1\|210728_211118_-	6-carboxytetrahydropterin synthase	NA	NA	NA	NA
WP_173909580.1\|211623_212418_-	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_099515850.1\|212454_213447_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_173909493.1\|213469_213697_-	hypothetical protein	NA	NA	NA	NA
WP_099515851.1\|214012_214192_+	hypothetical protein	NA	NA	NA	NA
WP_099515852.1\|214315_215998_+	histidine kinase	NA	NA	NA	NA
WP_099515853.1\|218162_218345_-	hypothetical protein	NA	NA	NA	NA
WP_099515854.1\|218493_218751_+	hypothetical protein	NA	NA	NA	NA
WP_157934705.1\|218821_219040_+	hypothetical protein	NA	NA	NA	NA
WP_099515856.1\|219398_219644_+	hypothetical protein	NA	NA	NA	NA
WP_099515859.1\|222827_224321_-	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_099515860.1\|224466_225354_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099515861.1\|225482_226730_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515862.1\|226827_227715_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_099515863.1\|227722_228538_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_099515864.1\|228557_229874_+	sulfatase-like hydrolase/transferase	A0A2K9L727	Tupanvirus	1.4e-15	22.1
WP_099515865.1\|229961_230954_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_099516137.1\|231067_232987_-	beta-galactosidase	NA	NA	NA	NA
WP_099515866.1\|233012_235181_-	alpha-galactosidase	NA	NA	NA	NA
WP_099515867.1\|235278_236322_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.9e-12	24.3
WP_162299287.1\|236318_237794_-	sulfatase-like hydrolase/transferase	A0A2K9L1A5	Tupanvirus	9.4e-13	23.4
WP_099515869.1\|237928_239245_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_099515870.1\|239344_240370_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_099515871.1\|240366_241221_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_162299288.1\|241306_243961_+	family 78 glycoside hydrolase catalytic domain	NA	NA	NA	NA
WP_099515873.1\|243972_244938_+	formylglycine-generating enzyme family protein	A0A7H6	Microcystis_virus	5.6e-14	27.7
WP_099515874.1\|245398_247075_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	7.7e-96	39.4
WP_099515875.1\|248181_248880_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.2e-64	56.0
WP_099515876.1\|249542_250460_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_099516138.1\|250668_251622_+	ABC transporter permease	NA	NA	NA	NA
WP_099515877.1\|251618_252383_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	30.0
WP_099515878.1\|252461_253379_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515879.1\|253548_254259_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515880.1\|254408_255395_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_099515881.1\|255443_256424_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_099515882.1\|256662_257406_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-16	29.2
WP_099515883.1\|257438_258437_+	ABC transporter permease	NA	NA	NA	NA
WP_157934707.1\|258667_258961_+\|transposase	transposase	NA	NA	NA	NA
WP_099515885.1\|259787_260498_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099515886.1\|260533_261337_-	universal stress protein	NA	NA	NA	NA
WP_099513339.1\|262075_262255_+	hypothetical protein	NA	NA	NA	NA
WP_099515887.1\|262241_264314_+	recombinase family protein	NA	NA	NA	NA
WP_099515888.1\|264638_264893_-	hypothetical protein	A0A2I7RHB5	Vibrio_phage	5.7e-11	53.5
WP_157934708.1\|264885_265257_-\|terminase	terminase small subunit	A0A088C409	Shewanella_sp._phage	1.2e-17	45.3
WP_099515890.1\|267134_267903_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099515891.1\|268179_268941_-	transglycosylase SLT domain-containing protein	W6ARS2	Escherichia_phage	5.7e-06	33.7
WP_157934709.1\|270667_270844_-	hypothetical protein	NA	NA	NA	NA
WP_157934383.1\|271484_271901_+	hypothetical protein	NA	NA	NA	NA
WP_099515893.1\|271961_272228_+	hypothetical protein	NA	NA	NA	NA
WP_099513402.1\|272262_272502_+	hypothetical protein	NA	NA	NA	NA
WP_099515894.1\|272515_272881_-	hypothetical protein	NA	NA	NA	NA
WP_099515895.1\|273810_274488_+	hypothetical protein	NA	NA	NA	NA
WP_099516139.1\|274609_274873_+	hypothetical protein	NA	NA	NA	NA
WP_157934710.1\|274889_275150_-	hypothetical protein	NA	NA	NA	NA
WP_099515897.1\|275577_276267_+	hypothetical protein	NA	NA	NA	NA
WP_099515898.1\|276288_276495_+	hypothetical protein	NA	NA	NA	NA
WP_099515899.1\|277502_277760_+	hypothetical protein	NA	NA	NA	NA
WP_099516140.1\|277900_279160_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_099516141.1\|279436_280480_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_099515900.1\|280601_280814_+	dodecin domain-containing protein	NA	NA	NA	NA
WP_099515901.1\|280935_281292_-	hypothetical protein	NA	NA	NA	NA
WP_099515902.1\|281527_281851_+	hypothetical protein	NA	NA	NA	NA
WP_099515904.1\|282741_282990_-	hypothetical protein	NA	NA	NA	NA
WP_157934712.1\|283269_283488_+	hypothetical protein	NA	NA	NA	NA
283469:283528	attL	NA	NA	NA	NA
WP_099515905.1\|284895_285771_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_099515906.1\|285767_287366_-	L-aspartate oxidase	NA	NA	NA	NA
WP_099515907.1\|287375_288374_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_099515908.1\|288532_289513_-	hypothetical protein	NA	NA	NA	NA
WP_099515910.1\|291279_291447_+	WGR domain-containing protein	NA	NA	NA	NA
WP_099515911.1\|291852_293454_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515912.1\|293476_294457_+	ABC transporter permease	NA	NA	NA	NA
WP_157934713.1\|296018_296654_+	ABC transporter permease	NA	NA	NA	NA
WP_157934714.1\|296706_298137_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_099516142.1\|298139_299792_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-16	32.3
WP_099515915.1\|299820_300165_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_157934715.1\|301180_301627_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.8e-10	35.3
WP_099516143.1\|301887_302532_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.4e-37	41.7
WP_099515917.1\|303921_305187_+	porin	NA	NA	NA	NA
WP_157934716.1\|305219_305795_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157934717.1\|306128_306563_+	VanZ family protein	NA	NA	NA	NA
WP_157934718.1\|307721_307994_+	hypothetical protein	NA	NA	NA	NA
WP_099515921.1\|308262_309594_+	hypothetical protein	NA	NA	NA	NA
WP_099515922.1\|309642_310014_-	hypothetical protein	NA	NA	NA	NA
WP_099515923.1\|310677_311631_-\|integrase	tyrosine-type recombinase/integrase	A0A142K7N4	Mycobacterium_phage	1.9e-14	26.2
WP_099513993.1\|311816_313004_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J790	uncultured_Caudovirales_phage	1.9e-08	28.5
WP_157934460.1\|312994_315301_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099513992.1\|315275_315662_+	hypothetical protein	NA	NA	NA	NA
WP_157934719.1\|316079_316805_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_099515924.1\|316801_317389_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_099510067.1\|320118_320778_-	hypothetical protein	NA	NA	NA	NA
WP_099512825.1\|320823_322179_+\|transposase	transposase	NA	NA	NA	NA
WP_157934720.1\|323133_324087_+	hypothetical protein	NA	NA	NA	NA
WP_099515926.1\|324425_324710_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	2.7e-09	43.9
WP_157934721.1\|325054_325996_-	hypothetical protein	NA	NA	NA	NA
WP_099515928.1\|326103_326322_-	hypothetical protein	NA	NA	NA	NA
WP_099508288.1\|326467_328006_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.5e-117	44.5
WP_099508289.1\|328019_328766_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.7e-59	49.0
WP_099515929.1\|328816_329251_-	hypothetical protein	NA	NA	NA	NA
WP_099515930.1\|329247_330282_-\|protease	ATP-dependent Clp protease ATP-binding subunit	NA	NA	NA	NA
337175:338231	attR	NA	NA	NA	NA

DBSCAN-SWA_4

367129 : 439611

Ochrobactrum_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099515955.1\|367129_368164_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099515956.1\|368407_369526_-	thioredoxin family protein	NA	NA	NA	NA
WP_099515957.1\|369718_370375_-	glyoxalase	NA	NA	NA	NA
WP_099515958.1\|370426_370840_-	cupin domain-containing protein	NA	NA	NA	NA
WP_099515959.1\|370961_372170_-	epoxide hydrolase	NA	NA	NA	NA
WP_099515960.1\|372319_373630_-	epoxide hydrolase	NA	NA	NA	NA
WP_099515961.1\|373890_374628_-	hypothetical protein	NA	NA	NA	NA
WP_099515962.1\|374653_375946_-	epoxide hydrolase	NA	NA	NA	NA
WP_099515963.1\|376559_377072_+	response regulator	NA	NA	NA	NA
WP_157934728.1\|377146_377290_+	hypothetical protein	NA	NA	NA	NA
WP_099515964.1\|377554_377989_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_099515965.1\|378011_379106_-	calcium/proton exchanger	NA	NA	NA	NA
WP_099514567.1\|379345_380869_-	heme peroxidase	NA	NA	NA	NA
WP_099515966.1\|381544_382528_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099515967.1\|382683_383703_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	7.8e-67	37.8
WP_099516147.1\|383881_385303_-	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
WP_099515968.1\|385532_388904_-	adenylate/guanylate cyclase domain-containing protein	A0A218MLZ2	uncultured_virus	6.3e-12	29.3
WP_162299290.1\|389063_392345_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099516148.1\|392675_393623_-	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_099515970.1\|394317_395379_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	4.5e-41	34.4
WP_099515971.1\|395378_396599_-	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	4.0e-126	58.1
WP_099515972.1\|397614_398970_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	4.6e-30	28.7
WP_099515973.1\|399173_399458_+	hypothetical protein	NA	NA	NA	NA
WP_099515974.1\|399454_399796_+	HTH domain-containing protein	NA	NA	NA	NA
WP_099515975.1\|400066_400987_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	2.7e-26	45.8
WP_157934729.1\|401035_401341_-	hypothetical protein	NA	NA	NA	NA
WP_157934730.1\|401471_401861_+	hypothetical protein	NA	NA	NA	NA
WP_099515978.1\|401847_402960_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_099515979.1\|403285_405775_-	hypothetical protein	NA	NA	NA	NA
WP_099515981.1\|408049_409195_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_099515665.1\|409590_409914_-	cytosolic protein	NA	NA	NA	NA
WP_099515366.1\|409981_410452_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_099515367.1\|410624_411461_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.8e-05	28.5
WP_099515982.1\|411639_412479_-	PAS domain-containing protein	NA	NA	NA	NA
WP_175608903.1\|413484_414297_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_099515667.1\|414324_414567_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_099515369.1\|414664_415276_+	hypothetical protein	NA	NA	NA	NA
WP_099515983.1\|415766_417866_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.8e-08	29.3
WP_099515984.1\|418090_418732_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_099516149.1\|419425_420124_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	45.6
WP_099511788.1\|420493_421263_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099515985.1\|422048_422795_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_099513669.1\|423473_424289_-	DUF1194 domain-containing protein	NA	NA	NA	NA
WP_099513670.1\|424325_425318_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_099515987.1\|425342_425570_-	hypothetical protein	NA	NA	NA	NA
WP_157934732.1\|426670_428044_+	metallophosphoesterase	NA	NA	NA	NA
WP_099515989.1\|429419_430574_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-22	30.9
WP_099515990.1\|430566_431502_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_099515991.1\|431498_432335_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_173909581.1\|432385_433651_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_099515992.1\|433991_434690_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	8.3e-44	46.5
WP_099515993.1\|434802_435003_+	hypothetical protein	NA	NA	NA	NA
WP_157934733.1\|435100_435382_-	hypothetical protein	NA	NA	NA	NA
WP_099516151.1\|435504_436260_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_173909582.1\|436600_436963_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_099515995.1\|438265_438784_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_099515996.1\|438900_439611_-\|transposase	IS6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

445430 : 503318

Escherichia_phage(18.18%)

transposase,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099516002.1\|445430_446129_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.7e-60	53.9
WP_099516003.1\|446210_446696_+	hypothetical protein	NA	NA	NA	NA
WP_099516005.1\|447131_447617_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.6e-22	44.3
WP_099516006.1\|448329_448836_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099516007.1\|449064_449523_+	hypothetical protein	NA	NA	NA	NA
WP_162299291.1\|449677_450154_-	hypothetical protein	NA	NA	NA	NA
WP_099516008.1\|450624_451029_+	DoxX family protein	NA	NA	NA	NA
WP_099516009.1\|454134_454758_+	hypothetical protein	NA	NA	NA	NA
WP_099516010.1\|455635_456031_+	hypothetical protein	NA	NA	NA	NA
WP_099516011.1\|456396_456894_+	hypothetical protein	NA	NA	NA	NA
WP_099516012.1\|458551_458896_-	integration host factor subunit beta	Q2A099	Sodalis_phage	4.3e-09	40.2
WP_099516013.1\|458996_459278_-	hypothetical protein	NA	NA	NA	NA
WP_099516014.1\|460203_460932_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.8e-50	42.9
WP_099516015.1\|461236_461449_-\|terminase	terminase small subunit	A0A0M3LSU1	Mannheimia_phage	2.4e-18	73.5
WP_099516154.1\|461909_462140_-	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_099516016.1\|462837_463212_-	hypothetical protein	NA	NA	NA	NA
WP_099516155.1\|463952_465917_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.7e-36	35.8
WP_099516017.1\|466571_468221_-	chaperonin GroEL	A0A219YK78	uncultured_virus	7.9e-170	59.5
WP_099509915.1\|468264_468579_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	2.3e-22	58.5
WP_099516019.1\|470656_471442_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099516020.1\|471534_471753_+	dodecin domain-containing protein	NA	NA	NA	NA
WP_162299292.1\|472028_472595_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_099516022.1\|472916_473633_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	1.6e-50	49.3
WP_099516156.1\|473679_474246_+	VUT family protein	A0A1P8DJD3	Virus_Rctr71	1.1e-38	55.8
WP_162299293.1\|474409_475390_+	DMT family transporter	NA	NA	NA	NA
WP_099516024.1\|475922_476381_-	translation initiation factor 2	NA	NA	NA	NA
WP_099516025.1\|476760_477303_+	hypothetical protein	NA	NA	NA	NA
WP_099513308.1\|477526_478822_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_157934736.1\|479134_479665_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_099516027.1\|480503_480761_+	hypothetical protein	NA	NA	NA	NA
WP_157934737.1\|481133_481886_+	hypothetical protein	NA	NA	NA	NA
WP_099516029.1\|481985_482330_-	hypothetical protein	NA	NA	NA	NA
WP_157934738.1\|482311_482461_-	hypothetical protein	NA	NA	NA	NA
WP_099516030.1\|484335_484707_+	hypothetical protein	NA	NA	NA	NA
WP_162299295.1\|485158_485428_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	1.0e-13	46.1
WP_099516032.1\|486022_486481_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_099516033.1\|487068_489966_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_099516034.1\|490354_491500_+	hypothetical protein	NA	NA	NA	NA
WP_099516035.1\|491865_492903_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099516036.1\|493019_494012_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099516037.1\|494182_494860_+	thermonuclease family protein	NA	NA	NA	NA
WP_099516157.1\|494870_495152_+	excalibur calcium-binding domain-containing protein	NA	NA	NA	NA
WP_099516039.1\|496039_496534_+	cytochrome c	NA	NA	NA	NA
WP_099516040.1\|496601_496880_+	hypothetical protein	NA	NA	NA	NA
WP_099516041.1\|497015_497561_-	CarD family transcriptional regulator	NA	NA	NA	NA
WP_099516042.1\|498303_498873_+	hypothetical protein	NA	NA	NA	NA
WP_099514059.1\|499649_500339_-	hypothetical protein	NA	NA	NA	NA
WP_099516043.1\|501010_501352_-	hypothetical protein	NA	NA	NA	NA
WP_099516044.1\|501462_501732_+	hypothetical protein	NA	NA	NA	NA
WP_099516045.1\|501869_502148_+	hypothetical protein	NA	NA	NA	NA
WP_099516046.1\|502325_503318_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP016618

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11322 : 65314

Bacillus_virus(25.0%)

transposase,integrase

attL 9581:9596|attR 38871:38886

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
9581:9596	attL	NA	NA	NA	NA
WP_162299257.1\|11322_12354_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157934499.1\|13393_13558_+	hypothetical protein	NA	NA	NA	NA
WP_099514846.1\|14476_14686_-	DUF2165 family protein	NA	NA	NA	NA
WP_099514847.1\|15412_15910_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	2.9e-06	33.3
WP_099514848.1\|16041_17475_+	hypothetical protein	NA	NA	NA	NA
WP_099514343.1\|17558_17897_+	hypothetical protein	NA	NA	NA	NA
WP_099514344.1\|18157_18316_+	DUF1127 domain-containing protein	A0A0F6YPC3	Sinorhizobium_phage	6.5e-05	59.0
WP_099514345.1\|18574_19906_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.7e-77	40.3
WP_099514346.1\|19976_20441_+	hypothetical protein	NA	NA	NA	NA
WP_099514347.1\|20655_20850_-	hypothetical protein	NA	NA	NA	NA
WP_099514348.1\|20935_21319_+\|transposase	transposase	NA	NA	NA	NA
WP_099514349.1\|21638_22574_+	hypothetical protein	NA	NA	NA	NA
WP_099514351.1\|23449_23659_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	8.9e-10	52.9
WP_099514353.1\|24150_24441_-	hypothetical protein	NA	NA	NA	NA
WP_099514354.1\|24944_25199_-	WGR domain-containing protein	NA	NA	NA	NA
WP_099514355.1\|25211_25901_-	hypothetical protein	NA	NA	NA	NA
WP_157934500.1\|27649_27841_-	hypothetical protein	NA	NA	NA	NA
WP_157934501.1\|28260_28479_-	hypothetical protein	NA	NA	NA	NA
WP_099514358.1\|30429_31785_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099514359.1\|31958_32588_+	LysE family translocator	NA	NA	NA	NA
WP_157934502.1\|32642_32789_-	hypothetical protein	NA	NA	NA	NA
WP_099514361.1\|33307_34153_-	metal-dependent phosphohydrolase	A0A2I2L3U5	Orpheovirus	1.5e-47	36.9
WP_157934503.1\|34245_35220_-	hypothetical protein	NA	NA	NA	NA
WP_099514363.1\|35453_36209_+	hypothetical protein	NA	NA	NA	NA
WP_099514364.1\|36690_37377_+	transglutaminase-like cysteine peptidase	V9QJI1	Rhizobium_phage	9.4e-16	35.3
WP_099514365.1\|37582_37798_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_157934504.1\|37962_38121_-	hypothetical protein	NA	NA	NA	NA
WP_099514366.1\|38406_38712_-	hypothetical protein	NA	NA	NA	NA
WP_157934505.1\|39148_39577_+	hypothetical protein	NA	NA	NA	NA
38871:38886	attR	NA	NA	NA	NA
WP_099514368.1\|39646_40672_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514369.1\|42592_43903_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099513293.1\|44047_45034_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_099514370.1\|45224_46490_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_099513491.1\|46764_48117_+\|transposase	transposase	NA	NA	NA	NA
WP_099514203.1\|48271_49540_-	PHB depolymerase family esterase	NA	NA	NA	NA
WP_099514371.1\|49636_50056_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_099514372.1\|50333_51734_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_157934506.1\|52026_53004_+	hypothetical protein	NA	NA	NA	NA
WP_099514374.1\|53379_54441_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_099514375.1\|54637_54871_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_099513884.1\|54836_56183_-\|transposase	transposase	NA	NA	NA	NA
WP_157934446.1\|56245_56524_+	hypothetical protein	NA	NA	NA	NA
WP_099514849.1\|56494_57355_-	quinone oxidoreductase	E3SJ82	Synechococcus_phage	7.2e-05	26.4
WP_099514376.1\|57735_57984_-	DUF3422 family protein	NA	NA	NA	NA
WP_099514377.1\|58344_59355_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-22	38.4
WP_099514378.1\|59396_60680_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_099514850.1\|60753_61632_+	ABC transporter permease	NA	NA	NA	NA
WP_099514379.1\|61636_62539_+	ABC transporter permease	NA	NA	NA	NA
WP_099514380.1\|62543_63275_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_099514381.1\|63435_64137_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099514147.1\|64264_65314_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

88723 : 126278

Escherichia_phage(33.33%)

transposase,integrase

attL 96290:96306|attR 138146:138162

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514399.1\|88723_89476_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-18	30.0
WP_099514400.1\|89598_90618_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	8.5e-21	31.6
WP_099514401.1\|90686_91385_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.8e-62	54.7
WP_099514402.1\|91567_92803_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.9e-91	46.6
WP_157934511.1\|92864_94298_+	hypothetical protein	NA	NA	NA	NA
WP_099514343.1\|94381_94720_+	hypothetical protein	NA	NA	NA	NA
WP_099514344.1\|94980_95139_+	DUF1127 domain-containing protein	A0A0F6YPC3	Sinorhizobium_phage	6.5e-05	59.0
WP_099514345.1\|95397_96729_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.7e-77	40.3
96290:96306	attL	NA	NA	NA	NA
WP_099514346.1\|96799_97264_+	hypothetical protein	NA	NA	NA	NA
WP_099514405.1\|97763_98123_-	hypothetical protein	NA	NA	NA	NA
WP_099514406.1\|98544_99822_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_099514409.1\|101039_101681_-	hypothetical protein	NA	NA	NA	NA
WP_099514410.1\|102112_102373_+	hypothetical protein	NA	NA	NA	NA
WP_099514411.1\|102561_102780_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_099514412.1\|103480_103699_-	hypothetical protein	NA	NA	NA	NA
WP_099514413.1\|103931_104552_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_099514414.1\|104843_105044_+	hypothetical protein	NA	NA	NA	NA
WP_099514415.1\|106966_107218_+	hypothetical protein	NA	NA	NA	NA
WP_099514416.1\|107672_107936_-	hypothetical protein	NA	NA	NA	NA
WP_099514417.1\|107932_108145_-	hypothetical protein	NA	NA	NA	NA
WP_099514852.1\|108137_108383_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_099514419.1\|109082_110639_-	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
WP_099514420.1\|110708_111932_-	LL-diaminopimelate aminotransferase	NA	NA	NA	NA
WP_099508077.1\|112086_113373_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_099514421.1\|113887_114106_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_099514423.1\|115394_116801_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099514424.1\|117116_117815_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	8.3e-60	52.8
WP_099514426.1\|119245_119449_+	hypothetical protein	NA	NA	NA	NA
WP_099514428.1\|121062_122085_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_099514078.1\|123399_124653_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	4.6e-45	36.5
WP_099514429.1\|124649_125522_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.1e-52	47.2
WP_157934512.1\|126155_126278_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
138146:138162	attR	NA	NA	NA	NA

DBSCAN-SWA_3

163275 : 218438

Acinetobacter_phage(37.5%)

transposase,integrase

attL 174654:174670|attR 226839:226855

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514456.1\|163275_164232_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099514457.1\|165308_166502_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.3e-108	51.8
WP_099514458.1\|166501_167521_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	9.0e-47	34.7
WP_099514459.1\|168438_169149_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099514461.1\|169906_170170_-	hypothetical protein	NA	NA	NA	NA
WP_099514462.1\|170473_170701_-	hypothetical protein	NA	NA	NA	NA
WP_157934516.1\|171848_174965_+	AAA family ATPase	NA	NA	NA	NA
174654:174670	attL	NA	NA	NA	NA
WP_157934517.1\|175090_175321_-	hypothetical protein	NA	NA	NA	NA
WP_157934518.1\|175575_175812_-	hypothetical protein	NA	NA	NA	NA
WP_099514465.1\|175950_177171_-	VWA domain-containing protein	NA	NA	NA	NA
WP_099514466.1\|177167_178082_-	MoxR family ATPase	NA	NA	NA	NA
WP_099514467.1\|178158_178962_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_099514468.1\|178974_181338_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_099514469.1\|181474_181969_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	6.5e-19	35.5
WP_099514470.1\|182145_182607_-	carbon monoxide dehydrogenase subunit G	NA	NA	NA	NA
WP_099514471.1\|182710_183172_-	iron-sulfur cluster assembly scaffold protein	NA	NA	NA	NA
WP_099514855.1\|183359_183683_+	XdhC/CoxI family protein	NA	NA	NA	NA
WP_099514472.1\|183688_184381_+	XdhC family protein	NA	NA	NA	NA
WP_173909553.1\|184377_185397_+	molybdopterin-binding protein	NA	NA	NA	NA
WP_173909554.1\|185393_185981_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_099514473.1\|186250_188476_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	A0A0P0I429	Acinetobacter_phage	2.7e-19	22.7
WP_099514474.1\|188481_189498_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_099514475.1\|189494_190016_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	A0A0P0IVM8	Acinetobacter_phage	3.9e-22	38.1
WP_099514478.1\|192094_193093_-	radical SAM protein	NA	NA	NA	NA
WP_099514479.1\|193259_196619_+	adenylate/guanylate cyclase domain-containing protein	A0A218MLZ2	uncultured_virus	1.2e-15	28.1
WP_099514480.1\|197375_197774_+	cupin domain-containing protein	NA	NA	NA	NA
WP_099514481.1\|198207_198606_-	hypothetical protein	NA	NA	NA	NA
WP_099514483.1\|198971_199670_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.2e-63	55.6
WP_099514484.1\|199866_200274_-	DUF1236 domain-containing protein	NA	NA	NA	NA
WP_099514485.1\|200770_203101_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_157934519.1\|203227_204607_-	calcium-binding protein	NA	NA	NA	NA
WP_099514487.1\|204871_206644_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099514488.1\|207244_207529_+	hypothetical protein	NA	NA	NA	NA
WP_099514489.1\|207642_208143_-	transcriptional repressor	NA	NA	NA	NA
WP_099514492.1\|209690_209960_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099514493.1\|210213_210534_+	DUF2829 domain-containing protein	A0A1X9HVT2	Ruegeria_phage	8.2e-15	41.2
WP_175608897.1\|211624_211888_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099514495.1\|217154_218438_+\|transposase	IS66 family transposase	NA	NA	NA	NA
226839:226855	attR	NA	NA	NA	NA

DBSCAN-SWA_4

243009 : 292490

Wolbachia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099508970.1\|243009_244464_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099514513.1\|244673_245372_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.6e-63	55.2
WP_099514514.1\|245393_245765_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_099514515.1\|246137_246434_-	hypothetical protein	NA	NA	NA	NA
WP_099510511.1\|246493_247036_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099510510.1\|247032_247455_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099514516.1\|248090_249821_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099514517.1\|249855_251622_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_162299255.1\|251763_253533_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_099514520.1\|254443_256207_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_099514521.1\|256203_257958_+	adenylate cyclase	NA	NA	NA	NA
WP_099514522.1\|259195_260221_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099508981.1\|260334_261474_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099508982.1\|261532_261811_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_099514523.1\|262008_262407_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_099514524.1\|262449_265821_+	adenylate/guanylate cyclase domain-containing protein	A0A1B1IWY2	uncultured_Mediterranean_phage	1.5e-10	24.9
WP_157934521.1\|266521_267733_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.8e-22	35.9
WP_157934522.1\|268251_268617_-	hypothetical protein	NA	NA	NA	NA
WP_157934523.1\|268855_269086_+	hypothetical protein	NA	NA	NA	NA
WP_157934524.1\|269902_270568_+	hypothetical protein	NA	NA	NA	NA
WP_157934385.1\|271339_272986_+	hypothetical protein	NA	NA	NA	NA
WP_157934525.1\|273147_273321_+	hypothetical protein	NA	NA	NA	NA
WP_099514527.1\|273604_274381_+	transglycosylase SLT domain-containing protein	W6ARS2	Escherichia_phage	5.8e-06	33.7
WP_099514528.1\|274456_275158_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099514529.1\|275279_276329_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157934526.1\|276813_277197_-	hypothetical protein	NA	NA	NA	NA
WP_157934527.1\|277317_279390_+	hypothetical protein	A0A1B1IWY2	uncultured_Mediterranean_phage	2.6e-16	29.6
WP_099514533.1\|279544_279739_-	hypothetical protein	NA	NA	NA	NA
WP_099514534.1\|279784_280597_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-23	35.4
WP_099514535.1\|281015_281321_+	hypothetical protein	NA	NA	NA	NA
WP_157934528.1\|281573_281732_+	hypothetical protein	NA	NA	NA	NA
WP_099514536.1\|281896_282112_+	dodecin family protein	NA	NA	NA	NA
WP_099514537.1\|282189_282426_-	hypothetical protein	NA	NA	NA	NA
WP_099508970.1\|282517_283972_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.2e-59	32.2
WP_099514538.1\|284555_285200_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_099514539.1\|287651_288362_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	4.8e-23	36.7
WP_099508092.1\|288567_289608_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099513884.1\|291143_292490_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

366932 : 417213

Salmonella_phage(16.67%)

transposase,integrase

attL 375929:375943|attR 417922:417936

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514595.1\|366932_367990_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_099514596.1\|368927_369329_+	hypothetical protein	NA	NA	NA	NA
WP_099514597.1\|369766_370117_-	hypothetical protein	NA	NA	NA	NA
WP_157934536.1\|370546_371521_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_099514599.1\|372824_373298_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_099514600.1\|373372_374227_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
WP_157934537.1\|374709_375333_-	DUF4142 domain-containing protein	NA	NA	NA	NA
375929:375943	attL	NA	NA	NA	NA
WP_157934538.1\|376567_376705_-	hypothetical protein	NA	NA	NA	NA
WP_099514603.1\|378277_379246_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	8.5e-47	35.4
WP_099514604.1\|379300_379909_-	hypothetical protein	NA	NA	NA	NA
WP_099514605.1\|380351_380570_-\|transposase	transposase	NA	NA	NA	NA
WP_099514863.1\|380835_381813_-	agmatinase	NA	NA	NA	NA
WP_099514606.1\|382103_382973_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_099514607.1\|383312_384125_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_099514608.1\|384114_384783_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_099514609.1\|384779_385430_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_099514610.1\|385811_386444_+	response regulator transcription factor	NA	NA	NA	NA
WP_157934539.1\|386942_387092_+	hypothetical protein	NA	NA	NA	NA
WP_099514613.1\|387881_389210_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.3e-50	46.0
WP_099514614.1\|389368_389734_-	hypothetical protein	NA	NA	NA	NA
WP_099514615.1\|389893_390235_-	hypothetical protein	NA	NA	NA	NA
WP_157934540.1\|390377_390605_-	hypothetical protein	NA	NA	NA	NA
WP_175608899.1\|390994_391237_+	hypothetical protein	NA	NA	NA	NA
WP_099514617.1\|391501_391780_+	hypothetical protein	NA	NA	NA	NA
WP_099514618.1\|392091_392418_+	hypothetical protein	NA	NA	NA	NA
WP_099514864.1\|392673_393180_+	hypothetical protein	NA	NA	NA	NA
WP_099514620.1\|394369_395173_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_099514621.1\|395156_396188_-	DUF3182 family protein	NA	NA	NA	NA
WP_157934541.1\|396550_396799_+	hypothetical protein	NA	NA	NA	NA
WP_099514623.1\|396890_398801_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	1.2e-63	30.6
WP_099514624.1\|399471_401205_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	1.8e-95	39.4
WP_099509475.1\|401191_402259_+\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	8.0e-06	28.6
WP_099514865.1\|402627_403674_+	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_099514625.1\|403610_404576_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_099514626.1\|404553_405351_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	3.7e-32	36.6
WP_157934542.1\|405969_406254_+	hypothetical protein	NA	NA	NA	NA
WP_099514866.1\|406348_406972_+	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_157934266.1\|407349_407523_+	hypothetical protein	NA	NA	NA	NA
WP_157934543.1\|407855_408173_+	antA/AntB antirepressor family protein	NA	NA	NA	NA
WP_099514629.1\|408635_409934_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_099514630.1\|410010_410421_-	hypothetical protein	NA	NA	NA	NA
WP_099514631.1\|410616_410835_-	hypothetical protein	NA	NA	NA	NA
WP_099514633.1\|411372_412380_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_099514634.1\|414629_415046_-	hypothetical protein	NA	NA	NA	NA
WP_099514635.1\|415238_416150_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_099514636.1\|416212_416593_+	hypothetical protein	NA	NA	NA	NA
WP_099514867.1\|416895_417213_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
417922:417936	attR	NA	NA	NA	NA

DBSCAN-SWA_6

604618 : 663860

Chrysochromulina_ericina_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099514779.1\|604618_605683_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514780.1\|605806_606508_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_099514781.1\|607299_608076_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_099514879.1\|608114_608900_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.5e-22	32.4
WP_099514782.1\|609221_610193_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_157934562.1\|610214_610376_-	hypothetical protein	NA	NA	NA	NA
WP_099514880.1\|610641_611694_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_099514783.1\|611736_613542_-	DUF1446 domain-containing protein	NA	NA	NA	NA
WP_099514784.1\|613526_614291_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_099514785.1\|614287_615535_-	CoA transferase	NA	NA	NA	NA
WP_099514786.1\|615659_616196_-	2,4'-dihydroxyacetophenone dioxygenase family protein	NA	NA	NA	NA
WP_099514787.1\|616192_616963_-	cupin domain-containing protein	NA	NA	NA	NA
WP_099514788.1\|617007_617286_+	hypothetical protein	NA	NA	NA	NA
WP_099514789.1\|617193_618018_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_099514790.1\|618366_618573_+	hypothetical protein	NA	NA	NA	NA
WP_157934573.1\|618593_618821_-	WGR domain-containing protein	NA	NA	NA	NA
WP_099514778.1\|618945_619692_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_099514791.1\|619913_621674_-	acyl-CoA dehydrogenase C-terminal domain-containing protein	NA	NA	NA	NA
WP_099514792.1\|621691_623986_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_099514793.1\|623985_625110_-	thiolase family protein	NA	NA	NA	NA
WP_173909561.1\|625387_625969_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_099509422.1\|626110_626860_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_099514795.1\|626872_627829_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_099514796.1\|628060_629629_+	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_099514797.1\|629639_631070_+	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_099514881.1\|631149_632175_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_099514798.1\|632241_632571_-	hypothetical protein	NA	NA	NA	NA
WP_099514799.1\|632794_633067_-	DUF2312 domain-containing protein	A0A0F6R615	Sinorhizobium_phage	7.7e-14	47.2
WP_099513509.1\|633525_634356_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099514800.1\|634712_634895_+	hypothetical protein	NA	NA	NA	NA
WP_162299258.1\|636766_637900_+	PAS domain S-box protein	NA	NA	NA	NA
WP_099514802.1\|638101_639097_-	phasin family protein	NA	NA	NA	NA
WP_157933989.1\|639946_641434_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099508287.1\|641430_642198_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.0e-43	40.0
WP_099514804.1\|642348_643209_+	hypothetical protein	NA	NA	NA	NA
WP_099514443.1\|645351_647571_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_099514444.1\|647574_648525_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_099514882.1\|648521_649157_-	aldehyde dehydrogenase iron-sulfur subunit	A0A0P0IVM8	Acinetobacter_phage	1.9e-15	32.5
WP_099514522.1\|649954_650980_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099514805.1\|651592_654403_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.5e-78	43.5
WP_099514806.1\|654600_655626_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_099514807.1\|656040_656718_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-28	39.8
WP_099514883.1\|656710_659263_+	ABC transporter permease	NA	NA	NA	NA
WP_099514808.1\|659262_660339_+	carotenoid 1,2-hydratase	NA	NA	NA	NA
WP_157934563.1\|660502_660658_-	hypothetical protein	NA	NA	NA	NA
WP_157934564.1\|662229_662517_-	hypothetical protein	NA	NA	NA	NA
WP_157934565.1\|662510_662816_-	hypothetical protein	NA	NA	NA	NA
WP_099514811.1\|663026_663860_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage