CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024315	Rhodococcus ruber strain P14 chromosome, complete genome	5 crisprs	c2c9_V-U4,DEDDh,cas4,WYL,csa3,Cas9_archaeal,cas3	0	2	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024315_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024315_1

1178247-1178323

Orphan

Consensus_repeat	Method
CCGCCGAGTCCGCCGCCGCGATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024315_1

>merge|NZ_CP024315|1|1178247-1178323|CRISPRCasFinder
CCGCCGAGTCCGCCGCCGCGATCGGCGCGCGCCACGTCGTCAAGGTCGTCTCCCCCGCCGAGTTCGCCGCCGCGATC

>NZ_CP024315|1|1|1178247-1178323|CRISPRCasFinder
CCGCCGAGTCCGCCGCCGCGATC	GGCGCGCGCCACGTCGTCAAGGTCGTCTCCC
CCGCCGAGTTCGCCGCCGCGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024315.1\|WP_010594332.1\|1183875_1184979_-\|branched-chain-amino-acid-aminotransferase	unknown	unknown	gnl\|CDD\|237363
NZ_CP024315.1\|WP_010594349.1\|1169036_1169444_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010594346.1\|1171161_1172289_+\|ubiquinol-cytochrome-c-reductase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|223795
NZ_CP024315.1\|WP_010594333.1\|1183107_1183860_+\|adenosylcobinamide-GDP-ribazoletransferase	unknown	unknown	gnl\|CDD\|234697
NZ_CP024315.1\|WP_010594338.1\|1179304_1180276_-\|carbohydrate-kinase-family-protein	unknown	unknown	gnl\|CDD\|238917
NZ_CP024315.1\|WP_010594330.1\|1186187_1187696_+\|leucyl-aminopeptidase	unknown	unknown	gnl\|CDD\|234863
NZ_CP024315.1\|WP_010594331.1\|1185012_1186113_-\|glycine-cleavage-system-aminomethyltransferase-GcvT	unknown	unknown	gnl\|CDD\|234742
NZ_CP024315.1\|WP_108754921.1\|1175978_1177043_-\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|224537
NZ_CP024315.1\|WP_010594348.1\|1169620_1170232_+\|heme-copper-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|224758
NZ_CP024315.1\|WP_010594329.1\|1187953_1189705_+\|2-oxoglutarate-dehydrogenase,-E2-component,-dihydrolipoamide-succinyltransferase	unknown	unknown	gnl\|CDD\|200219
NZ_CP024315.1\|WP_010594336.1\|1180885_1181551_+\|DUF3043-domain-containing-protein	unknown	unknown	gnl\|CDD\|378611
NZ_CP024315.1\|WP_010594334.1\|1182004_1183108_+\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234636
NZ_CP024315.1\|WP_010594347.1\|1170331_1171165_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|224921
NZ_CP024315.1\|WP_010594337.1\|1180389_1180740_-\|iron-sulfur-cluster-assembly-accessory-protein	unknown	unknown	gnl\|CDD\|223393
NZ_CP024315.1\|WP_010594341.1\|1175530_1175947_-\|cytochrome-c-oxidase-subunit-4	unknown	unknown	gnl\|CDD\|378833
NZ_CP024315.1\|WP_010594350.1\|1167897_1168944_-\|anthranilate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234682
NZ_CP024315.1\|WP_003934124.1\|1167502_1167778_+\|Lrp/AsnC-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366431
NZ_CP024315.1\|WP_010594345.1\|1172285_1173935_+\|cytochrome-bc-complex-cytochrome-b-subunit	unknown	unknown	gnl\|CDD\|379304
NZ_CP024315.1\|WP_010594344.1\|1174073_1174949_-\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|378238
NZ_CP024315.1\|WP_010594335.1\|1181654_1181870_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP024315.1\|WP_010594332.1\|1183875_1184979_-\|branched-chain-amino-acid-aminotransferase	gnl\|CDD\|237363	PRK13357, PRK13357, branched-chain amino acid aminotransferase; Provisional.	0
NZ_CP024315.1\|WP_010594336.1\|1180885_1181551_+\|DUF3043-domain-containing-protein	gnl\|CDD\|378611	pfam11241, DUF3043, Protein of unknown function (DUF3043). Some members in this family of proteins with unknown function are annotated as membrane proteins. This cannot be confirmed.	1.51382e-67
NZ_CP024315.1\|WP_010594346.1\|1171161_1172289_+\|ubiquinol-cytochrome-c-reductase-iron-sulfur-subunit	gnl\|CDD\|223795	COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion].	6.98908e-26
NZ_CP024315.1\|WP_010594330.1\|1186187_1187696_+\|leucyl-aminopeptidase	gnl\|CDD\|234863	PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional.	0
NZ_CP024315.1\|WP_010594338.1\|1179304_1180276_-\|carbohydrate-kinase-family-protein	gnl\|CDD\|238917	cd01942, ribokinase_group_A, Ribokinase-like subgroup A. Found in bacteria and archaea, this subgroup is part of the ribokinase/pfkB superfamily. Its oligomerization state is unknown at this time.	2.8516e-71
NZ_CP024315.1\|WP_010594331.1\|1185012_1186113_-\|glycine-cleavage-system-aminomethyltransferase-GcvT	gnl\|CDD\|234742	PRK00389, gcvT, glycine cleavage system aminomethyltransferase GcvT.	0
NZ_CP024315.1\|WP_108754921.1\|1175978_1177043_-\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|224537	COG1622, CyoA, Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion].	1.7337e-28
NZ_CP024315.1\|WP_010594348.1\|1169620_1170232_+\|heme-copper-oxidase-subunit-III	gnl\|CDD\|224758	COG1845, CyoC, Heme/copper-type cytochrome/quinol oxidase, subunit 3 [Energy production and conversion].	6.69504e-54
NZ_CP024315.1\|WP_010594329.1\|1187953_1189705_+\|2-oxoglutarate-dehydrogenase,-E2-component,-dihydrolipoamide-succinyltransferase	gnl\|CDD\|200219	TIGR02927, putative_dihydrolipoamide_acyltransferase, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase. This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817).	0
NZ_CP024315.1\|WP_010594333.1\|1183107_1183860_+\|adenosylcobinamide-GDP-ribazoletransferase	gnl\|CDD\|234697	PRK00235, cobS, cobalamin synthase; Reviewed.	1.84729e-54
NZ_CP024315.1\|WP_010594347.1\|1170331_1171165_+\|c-type-cytochrome	gnl\|CDD\|224921	COG2010, CccA, Cytochrome c, mono- and diheme variants [Energy production and conversion].	1.00982e-13
NZ_CP024315.1\|WP_010594337.1\|1180389_1180740_-\|iron-sulfur-cluster-assembly-accessory-protein	gnl\|CDD\|223393	COG0316, sufA, Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones].	4.89307e-47
NZ_CP024315.1\|WP_010594341.1\|1175530_1175947_-\|cytochrome-c-oxidase-subunit-4	gnl\|CDD\|378833	pfam12270, Cyt_c_ox_IV, Cytochrome c oxidase subunit IV. This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex.	1.02587e-56
NZ_CP024315.1\|WP_010594350.1\|1167897_1168944_-\|anthranilate-phosphoribosyltransferase	gnl\|CDD\|234682	PRK00188, trpD, anthranilate phosphoribosyltransferase; Provisional.	3.7097e-168
NZ_CP024315.1\|WP_003934124.1\|1167502_1167778_+\|Lrp/AsnC-ligand-binding-domain-containing-protein	gnl\|CDD\|366431	pfam01037, AsnC_trans_reg, Lrp/AsnC ligand binding domain. The l-leucine-responsive regulatory protein (Lrp/AsnC) family is a family of similar bacterial transcription regulatory proteins. The family is named after two E. coli proteins involved in regulating amino acid metabolism. This entry corresponds to the usually C-terminal regulatory ligand binding domain. Structurally this domain has a dimeric alpha/beta barrel fold.	1.13634e-10
NZ_CP024315.1\|WP_010594345.1\|1172285_1173935_+\|cytochrome-bc-complex-cytochrome-b-subunit	gnl\|CDD\|379304	pfam13631, Cytochrom_B_N_2, Cytochrome b(N-terminal)/b6/petB.	9.74875e-77
NZ_CP024315.1\|WP_010594344.1\|1174073_1174949_-\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|378238	pfam09678, Caa3_CtaG, Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG). Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as found in Bacillus subtilis.	2.47931e-51
NZ_CP024315.1\|WP_010594334.1\|1182004_1183108_+\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	gnl\|CDD\|234636	PRK00105, cobT, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase; Reviewed.	1.27231e-170

>NZ_CP024315.1|WP_108754921.1|1175978_1177043_-|cytochrome-c-oxidase-subunit-II
MNVAQGRILRRFGLAASLGIAALLLTGCSSEEVLRFGWPEGITPQAERMRELWTWSVVAALVMGVLVWGLTFWVVIFHRKKKDSPEFPRQTAYNVPLELLYTAVPFVIIAVLFYFTVVVQNYVLEKEDNPNVVVDVTAFQWNWKFGYRTIDLGEGTARYEGTDEIAQAAVAGDDEEHAGGEHEVPAPIHGQEAEDLSYLHYNKIETVGTSSEIPVLVLPTDRRIEFVLASSDVIHSFWVPEFLFKRDVNPNPLNNSSDPVFQISEIQEEGAFVGRCAEMCGTYHAMMNFEVRAVSPERFAEYIELRKPVEDGGQGLTNAQALERIGESPVATSTTPFKTDRTDRAASGVVTAGN
>NZ_CP024315.1|WP_010594341.1|1175530_1175947_-|cytochrome-c-oxidase-subunit-4
MKIEAKLFEVVTVFFVLVAIVYGVFTGLSRTGIEWAGLTAIVLSAGLTLIVGTYFRFVARRLDTRPEDYEEAEISDGAGDLGFFSAGSYWPILLAGAAAFAAIALAFFQPWLIVLAVVLILAAAAGLVFEYHVGPEKH
>NZ_CP024315.1|WP_010594344.1|1174073_1174949_-|cytochrome-c-oxidase-assembly-protein
MHDHSMLAPGSPGLLHLLVVVVAAAIAGTYLAASSRLRRRGDVWSRARDASFVAGCAIVAAATVPLPVPAFTGHMGVHLGVGMVGPVLLVLARPVTLALRAVQPGPARRALVSVAHSGPVAVLTAPPVAAVLDLGGLWLLYRTGLFAVMHHSPLLGAVVHLHVFAAGVLFAYAICQVDPVRHRYGLGSRAAVLFLAGTAHAILAESLYASPPPGHEVATSDLQAGALVMYYGGDLVEVALAVVLAVEWYRRTGRDRARSVRRDAAEGPHAPPRTGVGATPRGHRSADTPGR
>NZ_CP024315.1|WP_010594345.1|1172285_1173935_+|cytochrome-bc-complex-cytochrome-b-subunit
MSTATPSRAAHAAENIDSRYHPAAGLRRQINKVFPTHWSFLLGEIALYSFVILLISGVYLTLFFDPSLAHVVYDGAYTPLRGVTMSRAYETTLDISFEVRGGLFVRQIHHWAALMFAASIIVHLLRVFFTGAFRRPREANWVIGSLLLILAMFEGFFGYSLPDDLLSGTGLRAALSGITISIPVIGTWMHWLIFGGDFPGMLIIPRLYVAHVLLLPGIILALIAAHLALVWYQKHTQFPGPGRTEQNVVGVRILPVFAVKSGAFFAITFAVLALMSGLLQINPVWNIGPYNPSQVSAGSQPDIYMMWTDGLARIWPAWEIYLFGRYTIPAVFWIAVIMGLVFAVLIAYPWIEKKFTKDDAHHNLLQRPRDVPVRTAIGAMALTFYAIATIMCINDIIAYKFDISLNAMTWIGRIGILLGPPLAYYLTYRFCLGLQRSDRQVLEHGIETGIVRRLPHGEYIEIHQPLGPVDEHGHPIPLEYQGAPVPKRMNKLGTAGKPGAGSWWSADPAEEATALEAAHHEAEVEQRAILSEYQERVHGTPTDGDGRTH
>NZ_CP024315.1|WP_010594346.1|1171161_1172289_+|ubiquinol-cytochrome-c-reductase-iron-sulfur-subunit
MSGGETPNKHTIENLDQMSRDDLVALGTNLDGVDVAFRKDRWPVGGTRAEKRAERNVAFWFGLAGVSALAFIAVFIFWPWEYQGPGEDNYALYNLYTPLLGLTLGLAILGVGVGAVQFTKKFIPEEVSIQDRHDGVSSEVDRRTIVAELSDSLDTSTLPRRKLIKRTALFGGGALGLGLIMPLGGLIKNPWAEGDDSPLWVSGWTPRYPGETIYLRRDTGRVNDIVLVRPEDLDAGGMETVFPFRESDRGDEHALLEGLRGIRNAVMLIRLRTEDTAKVIKRKGQESFNYGDYFAYSKICTHLGCPTSLYEQQTNRILCPCHQSQFNALEYGKPLFGPAARALPQLPITVNEEGFLVAGGDFIEALGPAFWERRP
>NZ_CP024315.1|WP_010594347.1|1170331_1171165_+|c-type-cytochrome
MPGQSAAASAKSRRQRKLRRRVTGALVLALGLLSAGFLASALTPAPQVATANEDQSALIREGKQLYETSCVTCHGANLQGVQDRGPSLIGVGEAAVYFQVSTGRMPMMRNEAQALRKTPKFDAAQTDALGAYIQANGGGPTLIRDENGEIAQSSLRGDDVARGSELFRQNCASCHNFTGRGGALSSGKFAPVLDPANEQQIYTAMLTGPQNMPKFSDRQLTLEEKQDIIAYVKASSETQSPGGYGLGGFGPASEGPTMWVVGIVAVVGAALWIGARS
>NZ_CP024315.1|WP_010594348.1|1169620_1170232_+|heme-copper-oxidase-subunit-III
MTSAVGTSGTAITQRVHSLNRPNLVSVGTIVWLSSELMFFAGLFAMYFVARAQADGNWPPEPVHLNLALAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYLITLAMGTFFVLGQGFEYTQLVAEGVTISSMVWGSVFYITTGFHGLHVIGGLVAFVFLLVRTRVSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFIR
>NZ_CP024315.1|WP_010594349.1|1169036_1169444_-|hypothetical-protein
MFSRRRPEPLDPSRPDLVVVVSSFDDVEACSTALERGSASEPAWSPEAEAVLRHHLELPADSVDQAIALCGRDGYAPAQPARPAGTGLEAVLLQRVQVLDALHCSQERSRMASLAQRLGGTALGWDALQPATGAD
>NZ_CP024315.1|WP_010594350.1|1167897_1168944_-|anthranilate-phosphoribosyltransferase
MARSWPAVLGALTAGRDLARAEAQWAMDEIMSDNATAAQIAAFGVALKMKGETPEELLGLADSMLAHARLVPVDDDVVDIVGTGGDRANTVNISTMASLVVAACGIRVVKHGNRAASSKSGGADVLEALGVHIDLGPEAVAESVAEAGIGFCFAPVYHPALRFAAAPRKQIGIPTVFNVLGPLTNPARPRAGLIGCAFPELIGTVAGVLAERGNSALVVRGDDGLDELTTSTTSTVYVVRDGHVSTVSLDPTDLGVARVPLEALRGGDATDNAVIARAVLAGEHGPVRDAVLLNAAGAIAAFRGFEGSLASALAAGMQTAAEALDSGAAAAVLARWAEVTTRLAAGSR
>NZ_CP024315.1|WP_003934124.1|1167502_1167778_+|Lrp/AsnC-ligand-binding-domain-containing-protein
MIHAIVLIHADAHRIPETAQAVADLAGVDKVYSCAGDIDLIALLRVRDHEEIAEVVTRGINKLEGVAKTATHIAFQSYSSADVEAGFSIGE
>NZ_CP024315.1|WP_010594338.1|1179304_1180276_-|carbohydrate-kinase-family-protein
MTIAVTGSIATDHLMRFPGRFAEQLVADQLSHISLSFLVDDLVVRRGGVGGNIAYAMGVLGGAPVLVGAVGADFAEYRAWLEGNGVDCSPVHVSQTAHTARFVCTTDEAMAQIASFYPGAMSEARDISLAGVTGAHGVDLVLIGANDPEAMARHTDECRQLGVPFAADPSQQLARLSGEEAARLIDGAAYLFTNEYEWGLLQQKTGLTEEQIRAMVGLRVTTLGGNGVEIVERDGRRTHVGVVPERAKVDPTGVGDAFRAGFLLGHRAGLTLERAAQLGSLVAVLVLETTGTQEWTFDRPDAVKRLTVAYGQAAADEIAAILP
>NZ_CP024315.1|WP_010594337.1|1180389_1180740_-|iron-sulfur-cluster-assembly-accessory-protein
MTVQDETATHGVTMTEAASAKAKALLDQEGRDDLSLRIAVQPGGCAGLRYQLFFDDRTLDGDLTRDFGGVVLAVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN
>NZ_CP024315.1|WP_010594336.1|1180885_1181551_+|DUF3043-domain-containing-protein
MKLLRRGGSDESDNEDLGVSESVAAPQSEGGKGTTGKGRPTPKRREAEARRRGPVAPAPLTAKEARARRKAAKQSLSKDERKARAAERRAAAGERRTRMLAGEEKYLLPRDKGPVRAYVRDLVDSRRNLVGLFMPMALILIMTMFLGPVVQQYVTLAMFAMIVLMVIEGIYLGRLVNKKVRARFPDTTEGGFGLGWYAFVRASQIRKLRAPLPRVSPGDAV
>NZ_CP024315.1|WP_010594335.1|1181654_1181870_-|hypothetical-protein
MSQVVVIVLVLATLFAGLELARARSRPAPRWVTRAWRRCDHFRPHDPSPHGGDPSAGWVRTTIDARRSPQH
>NZ_CP024315.1|WP_010594334.1|1182004_1183108_+|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase
MSSESVFSADIVFPPVVAPDPEIRRRAEGRQRDLTKPAGSLGRLEELGCWVASCQGQVPPRPFARPRVVVFAGDHGVARGGVSAYPPEVTAQMVANFLAGGAAVNVLAGVAGAGVRVVDMAVDGDTDPAVSAHKVRRSSGAVDREDALTEQETLQAIAAGRTVADEEVDAGADLLVAGDMGIGNTTPATALIATLTGTEPVAAVGRGTGIDDAAWMRKVAAIRDAMRRARPHARNPVALLRTAGGADLAAMAGYLAQASVRRTPVVLDGVVVTAAALVAEELAPGARDWWVAGHRSTEPAHTLALRHLNLDPLVDLGMRLGEGSGAVAALPILHGAVAVLTNMATFAEAGVSTRDEDDAPVAGPRGD
>NZ_CP024315.1|WP_010594333.1|1183107_1183860_+|adenosylcobinamide-GDP-ribazoletransferase
MRGVALALSWLTVLPIRGPGHIDRSAAGAAIAAAPVAGLVLGLGTAGALWAAVAAGCAPLLAGLIGVGFLGLATRGMHLDGLCDTADGLGCYGPPERAREVMKSGGAGPFGVATLVLVLGAQAASFGALADARSWFAVVLAVTAGRVAVVLACRRGVAAAPGSGFGALVAGTQPLGVGVLWAVVAAVAAAWCVPGAWWTGPATVAVGLVAALLLVRHCVRRFGGLNGDALGAGLETTVTVVAAALSAAVG
>NZ_CP024315.1|WP_010594332.1|1183875_1184979_-|branched-chain-amino-acid-aminotransferase
MTGVLEFAHVPHPSPASAERRGEVLADPGFGRYFTDHMVTIDYTEGRGWHDATVQPYGPMQLDPAAMVLHYGQAIFEGLKVYRQPDGSIAAFRVYSNAERMRRSSRRLAMAELPDELFVRSIAELVDADHEWVPAAGGEESLYLRPFMFSTEAGLGVRPANQYRYVLIASPAGAYFPRGVKPVSVWISQEYVRAAPGGTGDAKFSGNYAASLLAQAQAVEQGCDQVVWLDAVERRYIEEMGGMNLCFIFGSGADAKLVTPELSGSLLPGITRDSLLTLAREAGLEVEERKISVQEWESEVADGRITEVFACGTAAVITPVGTVKSRDGEFTVGDGEPGKVTMALRDTLTGIQRGTFADTHGWLTTLR
>NZ_CP024315.1|WP_010594331.1|1185012_1186113_-|glycine-cleavage-system-aminomethyltransferase-GcvT
MSDQPLLQGPIHAVHTELGATFAAFGGWQMPVSYAGTVAEHTAVRENVGLFDVSHLGKALVAGPGAADYVDATLTNDLRKIGPGKAQYTLCCTESGGVTDDLIVYYVSDEELFLVPNAANTAAVVEVLAAHAPEGVTVTNQHRDYGVFAVQGPNSEAVLQGLGLPTDLGYMSFVDARWNDLPVRVCRTGYTGERGFELVPRWADAESLFRALADAVRAAGGHAAGLGARDTLRTEMGYPLHGHELSEAISPLQARCGWAVGWSKPAFRGRAALVAEKESGPARRLWGVRALDRGVLRPGLKVLRDGTPVGETTSGTFSPTLKVGIALALLETAGDPAAGDEVTVDVRGRALRAQLVAPPFVPDHTK
>NZ_CP024315.1|WP_010594330.1|1186187_1187696_+|leucyl-aminopeptidase
MSALSPTLPELVLAGSVSKRADVLVVGLTAGDGGPEALLGDGLVDEDVLGGLLDALQSVGAEGRAEEVTRIPAPAALPVTSVLAVGLGAADKLDAEQVRRSAGAAARALAGVPVVATTLSAVDLGATAEGFALGAYTFTEFRTTKSNAGDAQPPARIELLVSSPRAREAKAELARSVAVAEAVATARRFVDTPPSHLFPAEFAERAKALGTAAGLKVEVLDEKALEQQGYGGIVGVGKGSSRPPRLVRLSYSAKKRKAPKVALVGKGITFDTGGISIKPAAGMENMTSDMGGAAAVVATVVLAAKLGVAADVTATVPMAENMPSATAQRPGDVLTQYGGTTVEVINTDAEGRLILADAIVRACEDEPDYLIDTATLTGAQMVALGTRTPGVMGTDEFRDRVARLSQEVGENGWAMPLPAELRADLKSRVADLANVTPHRWGGMLAAGLYLQEFVAEGVQWAHIDIAGPAFNTGSPFGYVGKGGTGVPVRTLIAVIEDIANNG
>NZ_CP024315.1|WP_010594329.1|1187953_1189705_+|2-oxoglutarate-dehydrogenase,-E2-component,-dihydrolipoamide-succinyltransferase
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLVKIVAQEDETIEIGGELAVIGDSADDGGSSTAPTAAPSEEAAPEEQSTPEPEPEPEPEPEPAPASSGSDTGSAEGTPVTMPALGESVTEGTVTRWLKSVGDEVAVDEPLLEVSTDKVDTEIPSPVAGVLLEINADEDETVEVGGQLAVIGSGTPAAAPSKPEPKPEPKPEPEPEPAKQAAPEPAKQPAPEPAKQAAPAPAPAPAAAETPGGATPYVTPLVRKLAAEHDVDLSKVSGTGVGGRIRKQDVLAAAEAAKAPAAEAPKAPAAKAPAAAPATTAGVRPELAHLRGTTQKVNRIRQITAIKTRESLQTTAQLTQTFEVDVTKIAHLRSQAKATFAEREGVNLTFLPFFAKAVVEALKAHPNINASYDEDKKEITYHAAEHLGIAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAKRARSGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVTDEVGNESIGVRSMCYLPLTYDHRLIDGADAGRFLTTIKHRLEEAAFDADLGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024315_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024315_2

2269727-2269804

Orphan

Consensus_repeat	Method
CCCGCACCCAGATCCACCGCACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024315_2

>merge|NZ_CP024315|2|2269727-2269804|CRISPRCasFinder
CCCGCACCCAGATCCACCGCACCGCCGAGACCACCGGCCAGACCCCCACCGAGGCCCGCACCCAGATCCGCCGCACCG

>NZ_CP024315|2|2|2269727-2269804|CRISPRCasFinder
CCCGCACCCAGATCCACCGCACCG	CCGAGACCACCGGCCAGACCCCCACCGAGG
CCCGCACCCAGATCCGCCGCACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024315.1\|WP_010593258.1\|2264094_2264592_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010593272.1\|2285414_2286359_-\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP024315.1\|WP_010593268.1\|2277513_2278842_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010593260.1\|2265742_2267194_-\|dynamin-family-protein	unknown	unknown	gnl\|CDD\|206739
NZ_CP024315.1\|WP_010593270.1\|2280647_2281343_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010593259.1\|2264760_2265669_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP024315.1\|WP_010593257.1\|2262010_2263855_-\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|234715
NZ_CP024315.1\|WP_010593256.1\|2261369_2262014_-\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|237632
NZ_CP024315.1\|WP_010593253.1\|2259254_2259635_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010593267.1\|2275915_2277421_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226406
NZ_CP024315.1\|WP_010593261.1\|2267190_2269017_-\|dynamin-family-protein	unknown	unknown	gnl\|CDD\|206739
NZ_CP024315.1\|WP_003938894.1\|2287874_2288078_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP024315.1\|WP_010593273.1\|2286525_2287677_-\|alkane-1-monooxygenase	unknown	unknown	gnl\|CDD\|239589
NZ_CP024315.1\|WP_099528034.1\|2273456_2275925_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP024315.1\|WP_072786519.1\|2271659_2273453_+\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212667
NZ_CP024315.1\|WP_010593254.1\|2259747_2260155_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133387
NZ_CP024315.1\|WP_010593255.1\|2260154_2261336_-\|molecular-chaperone-DnaJ	unknown	unknown	gnl\|CDD\|237655
NZ_CP024315.1\|WP_010593252.1\|2258472_2259105_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP024315.1\|WP_040270589.1\|2278961_2280263_+\|protease	unknown	unknown	unknown
NZ_CP024315.1\|WP_099528035.1\|2281825_2285281_+\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|223325

Protein	Function_ID	Function_description	E-value
NZ_CP024315.1\|WP_010593272.1\|2285414_2286359_-\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	5.81978e-05
NZ_CP024315.1\|WP_010593256.1\|2261369_2262014_-\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|237632	PRK14164, PRK14164, heat shock protein GrpE; Provisional.	8.71787e-56
NZ_CP024315.1\|WP_010593257.1\|2262010_2263855_-\|molecular-chaperone-DnaK	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
NZ_CP024315.1\|WP_010593260.1\|2265742_2267194_-\|dynamin-family-protein	gnl\|CDD\|206739	cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. This family also includes bacterial DLPs. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes mitofusins (MFN1 and MFN2 in mammals) that are involved in mitochondrial fusion. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.	4.50147e-14
NZ_CP024315.1\|WP_010593259.1\|2264760_2265669_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	0.00277277
NZ_CP024315.1\|WP_010593267.1\|2275915_2277421_+\|hypothetical-protein	gnl\|CDD\|226406	COG3889, COG3889, Predicted solute binding protein [General function prediction only].	4.57492e-08
NZ_CP024315.1\|WP_010593261.1\|2267190_2269017_-\|dynamin-family-protein	gnl\|CDD\|206739	cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. This family also includes bacterial DLPs. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes mitofusins (MFN1 and MFN2 in mammals) that are involved in mitochondrial fusion. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.	1.88925e-20
NZ_CP024315.1\|WP_003938894.1\|2287874_2288078_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	4.30773e-34
NZ_CP024315.1\|WP_010593273.1\|2286525_2287677_-\|alkane-1-monooxygenase	gnl\|CDD\|239589	cd03512, Alkane-hydroxylase, Alkane hydroxylase is a bacterial, integral-membrane di-iron enzyme that shares a requirement for iron and oxygen for activity similar to that of the non-heme integral-membrane acyl coenzyme A (CoA) desaturases and acyl lipid desaturases. The alk genes in Pseudomonas oleovorans encode conversion of alkanes to acyl CoA. The alkane omega-hydroxylase (AlkB) system is responsible for the initial oxidation of inactivated alkanes. It is a three-component system comprising a soluble NADH-rubredoxin reductase (AlkT), a soluble rubredoxin (AlkG), and the integral membrane oxygenase (AlkB). AlkB utilizes the oxygen rebound mechanism to hydroxylate alkanes. This mechanism involves homolytic cleavage of the C-H bond by an electrophilic metal-oxo intermediate to generate a substrate-based radical. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. The active site structure of AlkB is not known, however, spectroscopic and genetic evidence points to a nitrogen-rich coordination environment located in the cytoplasm with as many as eight histidines coordinating the two iron ions and a carboxylate residue bridging the two metals. Like all other members of this superfamily, there are eight conserved histidines seen in the histidine cluster motifs: HXXXH, HXXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within the homolog, stearoyl CoA desaturase. Also included in this CD are terminal alkane hydroxylases (AlkM), xylene monooxygenase hydroxylases (XylM), p-cymene monooxygenase hydroxylases (CymAa), and other related proteins.	1.7587e-139
NZ_CP024315.1\|WP_099528034.1\|2273456_2275925_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	4.76681e-15
NZ_CP024315.1\|WP_072786519.1\|2271659_2273453_+\|Hsp70-family-protein	gnl\|CDD\|212667	cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family. HSP70 (70-kDa heat shock protein) family chaperones assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some HSP70 family members are not chaperones but instead, function as NEFs to remove ADP from their HSP70 chaperone partners during the ATP hydrolysis cycle, some may function as both chaperones and NEFs.	3.17264e-42
NZ_CP024315.1\|WP_010593254.1\|2259747_2260155_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133387	cd01279, HTH_HspR-like, Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator HspR and related proteins, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	6.46599e-40
NZ_CP024315.1\|WP_010593255.1\|2260154_2261336_-\|molecular-chaperone-DnaJ	gnl\|CDD\|237655	PRK14279, PRK14279, molecular chaperone DnaJ.	0
NZ_CP024315.1\|WP_010593252.1\|2258472_2259105_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.61324e-63
NZ_CP024315.1\|WP_099528035.1\|2281825_2285281_+\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	1.67701e-83

>NZ_CP024315.1|WP_010593261.1|2267190_2269017_-|dynamin-family-protein
MHTSSADAAARRAALVELIDAAAEHIRAAERGDLATRLEAARTRVVDPRLRVVVVGQLKQGKSQFVNSLLNLEVCSVGDDETTAVPTVVQNADRTFAELVLAEPGRDPVRVDLPVDELQRVTPATPRAGGREVLRLEVNVPSPLLADGLVLVDTPGVGGHGNPHAAATLGLLPAADAVFVVSDASQEFTEPELSFLRQVLQLCPAAAVLITKTDLYPHWREIVAADRGHLQRAGLDVPLLPVSSLLRSHALRLDDASLHEESGFESVYGFLRERVVARGADVARRSVALDVKSVVEHVALSLGSELAALRDPETGAAAVAELQRAKAAAEALRTRAAQWQQTLADGIADLAADIDHDLRDRLRRVTREAEATVDECDPGEEWPRIGEWLGEQVAESVGDNFVWAHERSVWLAEVVAGHFADSGAVDLPDLHLGDLEGLLEPVSRLSDLESGRIGVGQKMLVGMKGSYGGVLMFGLITTLMGMALVNPISVGAGVVLGTKAYRDDKQARIVKRRADAKVAIRKFTDDVGFQVGKESKDRLRLIQRQLRDHFTELAEQTLRSLSESLRAAQEAATVEEAQRQRRVAELETHVRALTALRERAAQLAGADA
>NZ_CP024315.1|WP_010593260.1|2265742_2267194_-|dynamin-family-protein
MSVEQARELVAAARARYGSDPRAAEQLALCAARLEQPLRVALAGSLKAGKSTLLNALVGQDIAPTDATECTRVVTWYRSGSTPSVTAHYDGDRILPVPVQRRDGRLTFDLGELTADRVDRIDVEWPASALAQTTIIDTPGTSSLSQDVSARTFELLTPDDEASGADAVVYLMRTLGAADVQFLGRIGQHVGGESGPLGVIGVVSRADEVGAGRMDAMMSAKEVAARFAGELERTGLCQAVVPVAGLLALGARTLRQSEFAAFEALAQVPSQDLQVAMLSADRFARPDIALPVDPGTRAHLVDRFGLFGIRMAVTLIGLGVRDSPTLAAELVARSGLDELRQVIDVQFGQRADQLKAHSALMSLERVLRAHHDGPLLASVQRLLADVHGFTELRLLGRLRSTRVTLSEDDVLELQRLIGGFGIGPAQRLGLAPDATVAEIHAAGVAAVRTWRARAEHPLLDRFTANACSVAARSGEGILADVAG
>NZ_CP024315.1|WP_010593259.1|2264760_2265669_+|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein
MNDPTPLRRADLLASGHTPTELRNALRTGRLRRIAPGIYLRRHETDGLDDVDRHRLRVQALAPALDADAVFSHVSAAVLHGFDLWNVDLSRVHVTRGRTSGGRRTPHLHVHVGGYGADEIATCDGLPVTSAARTVVDLARTLPSDRATVIGDSALRLRRVDPGALSVALATSGTKAGIASARRVVPFLDGRSESPGESLSRLRMLDAGMPRPQLQHELRTGDGRFVARTDFYWEGIAGEFDGMGKYGADEPGATAEIVRREKLREDAIRQLGFEVIRWTWPDLFRFHVVQARFGQAAQRARR
>NZ_CP024315.1|WP_010593258.1|2264094_2264592_+|hypothetical-protein
MSTRPQPPRPEFSVTPLRTADTPGPRVGAAVSAWGLSFVVFAGLLGAVYLDRESVRDALEQSLRSANPGTTAASIADTVALTLTGFAAAGLLLVALAAVFLELLRRGRPWARPALAVVSVATVVTAVAARSVLADAGDATAGVLLWAPLLWAGLTVVGAVATWRR
>NZ_CP024315.1|WP_010593257.1|2262010_2263855_-|molecular-chaperone-DnaK
MARAVGIDLGTTNSVVSVLEGGEPVVVANSEGSRTTPSVVAFAKNGEVLVGQPAKNQAVTNVDRTIRSVKRHIGTDWTVEIDGKKYTSQEISARTLMKLKRDAEAYLGEEITDAVITVPAYFEDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGDGVVEVRATSGDNHLGGDDWDQRVVDWLVEKFKAQHGVDLTKDKMALQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLSRSEFQKITSDLLDRTRAPFQQVIKDAGISVKDIDHVVLVGGSTRMPAVTDLVRELTGGREPNKGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETFTTADDNQPSVQIQVFQGEREIAAHNKLLGSFELGGIAPAPRGVPQIEVTFDIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHAEEDRKRREEAEVRNQAESLVHQTEKFLQENEDKVAADAKGKVESAIKETKDALAGTDIAAVKTAVEKLATESQALGQSLYESQAADAGAAAGDGAAAGSDDVVDAEVVDEPTDSEKK
>NZ_CP024315.1|WP_010593256.1|2261369_2262014_-|nucleotide-exchange-factor-GrpE
MTAGQPEQEPVTVTDKRRIDPDTFEVRDPDAGSQPVEETDTEAPAAGEHEEAALAAEPSPESAQLAERTADLQRLTAEYANYRRRVERERVVTTEAAKASVVTQLLDVVDDLDRARAHGDLEQGPLKSVADKLTGVLSGLGLQPFGDPGDAFDPEIHEAVHMEGDGANPVLDTVLRKGYRLGERILRHAMVTVTDTVPSGDAPAEKPDSGADDE
>NZ_CP024315.1|WP_010593255.1|2260154_2261336_-|molecular-chaperone-DnaJ
MSQREWIEKDFYKELGVSSDATADDIKKAYRKLARDLHPDANPGDTKTEERFKAVSEAYAVLSDPARRKEYDETRQMFASGGFGGGFRPGAGSGGFSGGTTTFDLGDLFGGGGGGAGDAGLGDLFGGLFNRSGGGGARTTSRPRRGSDVDAETTLDFRDAALGVTVPLRLTSPAPCTTCHGSGARPGTSPRVCPRCNGSGIVSRNQGAFGFSEPCDDCRGTGSIIDEPCTDCRGSGIQNRTRTITVRIPPGVRDGQRIRLPGQGEAGLRGAPSGDLFVTVHVRADKVFGRDGDDLTLVLPVSYGELVLGTTVSVPTLEGRVGLKIPAGTADGRVLRVRGRGVPKRGGGAGDLLVTVKVAVPQNLDDQAIEALRAYMHAEQANGFDPRAGWAGA
>NZ_CP024315.1|WP_010593254.1|2259747_2260155_-|MerR-family-transcriptional-regulator
MSENRNRNDSPMDPDARVYVISVAAELAGMHAQTLRNYDRLGLVTPHRTRGGGRRYSPRDVALLREVQRLSQDEGVNLAGIKRIIELTNQVEALQQRVSEMATEIAQLHASRRALVPIPRSNALVVWKPKHQRDR
>NZ_CP024315.1|WP_010593253.1|2259254_2259635_+|hypothetical-protein
MHTRNPVACPSVALTIRNDTSEPMVLRDSALPEGRWVLRPPSSLRPGEAATVAASTGDELGIGIRLTYSLPGGVRAIFLAQTYRYGDSSVDGTRIEPDAGYVVHTQIDRRFPHMCAHYSVSILDPT
>NZ_CP024315.1|WP_010593252.1|2258472_2259105_-|response-regulator-transcription-factor
MPVRVVVGDDHPLFRDGVVRALSGSERIEVIGESGDGAAALDLIRTHRPDVALLDYRMPHLDGAAVAAAVRRDGLPTRVLLLSAHDDAAIVYHALQEGACGFLPKESTRAEIVAAVLDCADGRDVLAPELASGLVAEVRRRSEPSGPALSDRERQVLTMIAQGRSVPSIAAQLYLAPSTVKTHVQRLYEKLGVSDRAAAVAEAMRRGMLE
>NZ_CP024315.1|WP_072786519.1|2271659_2273453_+|Hsp70-family-protein
MAAGLGVTIGSADSVAATAFDRADTYRPVVLSRASELHLPPDDAPHLGHRPAAPGALVFTDFVSRVGDPVGVLADNGASYSGADLTATAIGCLVHEASLDLPEAPAITVAHPATWAGYTVDALREALSRAGLADVTLMPEPIAAVRWLEATRGPLGDGVVVVYDLGARTLDVSVVRTGAEPVLLGRPIASEDVCGGHLDHLVTTHLLDTVRDDVPDFDPFAAPMTAALAELRTRSRAAKEQLSTDTETVVAIDLPGVRRDVRLVRDEFEELARGPLQASTALVHEALRGAGVEPSDVGRVLLTGGGGAIPLVAELLSAELGVAVVAGPHPAHTAALGAAQPRAGTAVAAPVDDDVPTTVLPVTTARPTEAISPVRPAVVPAPAPAAAAAPAPSRSRRYVLAGAAAAALVLLGAGGLAVGTLGTSDASEAGVGAATSATVPGATPASAGGPATTATTGSGTSSAVPATTPGTRAAATAATPGAPGTVAPAGSVPAGTTAPGAAPGAPAPGAVAPGTVAPGTVAPVPTTTPPPAPAPAPAPAPAPAPNYGSQVGDALGGAGEGAGAVVGGAGNAVGGVVEGVGGAVGGVVDGVGGLLGN
>NZ_CP024315.1|WP_099528034.1|2273456_2275925_+|helix-turn-helix-transcriptional-regulator
MPQPVSLPRDVAHAVAASPPRLLLAGPAGSGKSALLSSVRQTLADRGLTVGTDPDSPATSALVVDDAHTLPAESVLALAEQVRRGERAVVVATEPRPHRSDLRALSSAFGAHSALVELRPLSPREIAGRAATLGLTPRPEPIRAVHRLTGGTRDVVDAALVALRDGTDPRRAAAARVRDRLAGGDPDLPRVLVLAALGGTLDPLEVASVLGVEADRARELVDAARASGLLTVDGDVPIPAAAAVPATVLGSHGIRTLAHRLAALRLDAGLLSADTARALADAGVADARLADRLVTLAAEAAPAQALALYDAAIRAGADADALDVRRAETAGLAGDLATAAQLTDRLLDRAATLPGDELTAATRIAATVAARRGMLGRSADLYEWLGPERAGADAPVAATVLLAAGRPGAAARFGTAAPAPTSSAAAAQLLAAGLRESVGGDGRVAMNSLTRALSVHGTGDRTRLLPDTPEAVTALLCLHSGELAHAAAVLGRPSTVPSVRHRLLAAWTALIGGDLPVATAAADELAPSATEQRDQLFLHGLRVGLARRGGDVGALTAAWTAAQGVVAAYSVDLLSLLPLGELWLAAVRLGEADRIAHLVAQAQELLSTLGEPPLWGATLHWYGVQAAIAADRPAELLPHARALGSAAESTAYAAALARAGQAWLRVLQGDADPARVQAAAESLAAIGLPWDGARLAGEAALRVGDTATATALLQVARAVRHPSAAPRSPAPAPAAAAPTAPSPLSDREAEVADLVVAGLTYREVGSRLYISAKTVEHHVARIRRRLGAGSRSELISMLRALGHGAEARQPATSGNGGTSACP
>NZ_CP024315.1|WP_010593267.1|2275915_2277421_+|hypothetical-protein
MSVGVGLKVGTTVSAVAVTSAEGIRPDPEPVERLTHLHLHSDGTATLGVRDPGAGECSSFSGFVDRVGDPAGVRAEDGALSRAEDLVATAMECLLADAAPLVGDAPATVAAAHPTEWSPATVAVLRNALDYVGLRHVALISDAEAVAAWFEARVAQQSGRLVAVYHLDAGGSTVTLVRSGVAAGRAFRYPEGDAPSVPAQLSAALGAFGWLVSNLDAVVISTEDPVDPSAAQLVAQAVKAGMGVRCVLPPQPQHTVVRGAALAAAAGSADMVGATRIIPAVRSAAAARTPLEPPAAPEPRVAPEPRADAGPAVAATVTDRGSAEPDRVPPNRLVVSGAVAAAVALLVGMGALVFSLRDTPAETPVREAGAAYESLSSAVQVPSTTGTPTGTTAAPATTPDAAPVAVDSGPVDSWPAVTEPLPAAAVAPSTRSTTSRPAPTTTRSTTAEPTTSAATRERDRPTRTTTPTATTTVAPTTTVTSTPTGTTEPDPTDTTGSEAPE
>NZ_CP024315.1|WP_010593268.1|2277513_2278842_+|hypothetical-protein
MRYSSASRAAARTTVRRVVVAAASALLLAGPLAATAHAAPADQLSADQLPAELVEAISRDLKISADEYLERSERAQELADYARTFRAERPDDFAGAWLGTDGKPVVAVTNPDAARQAENDGYHVTVAPVSADGLERSLAELNRWVAALPRELASQVNSTSIDVFNNRLIVDIANSPAGRALNLPTLIANVQVMLTPGQPPNEPGPLGGDTYITADGDVRSTPLDRIGVCSFGFNAVDADGSAVNITAGHCDAVAREDGGSTVYLPNRENIDESVKIGAFTRSTVGEGSTLDYGIIGLDQAGVDVGLNRPVIRGGNGSTLTVTGTAAPVAGAPVCKSGQSSYFTCGIVAADRIETQLVRADGTSTTIRGFATTACTLSGDSGGAIVTGTLALGVISGSNSSGAPDCVEANLVLAPQGGTSSLGIAIQDIEAETGARVRTGAAA
>NZ_CP024315.1|WP_040270589.1|2278961_2280263_+|protease
MRRSFARRAAVYGSAALMLFGPAAAIAQAEPAPIEATALPNELVEALARDLQMSPERYLTDAARSQELARFAETAREQFAAVFSGVWLEQDGTPKVGLTEGEGYDAAREAAEDAGFTVEDTDRTETQLRDELKALNDWLATQPPAVADLVRGVAIDVVHNDVVLRTENVAGIELPDFLQGARVLFAPAPLVPEPAAGDLQPVADLAAPTALFGGDAYAALGAGDGLRCSLGFNAVDGSDRPVNITAGHCDPNRPSAGTEYASKVYHLIGEELGQQLGTFEKTSLDGHDYALIRPTAEAQGRFENNGVRVPLAAPLPITGIAEPVVGAPACKSGVRSGYSCGVVTAAGQTVEVGHRVLRDGFSTNLCALQGDSGGTIVTGTLALGISSASNVGQYGMCEIAGVVSGLLGESPELFATPISAVLAENPGLRVRTW
>NZ_CP024315.1|WP_010593270.1|2280647_2281343_-|hypothetical-protein
MKFRKLAAVAAMTIAAVGLTAGTSYAAPAVTAPEKINYESKVDGESVVTVIDAGTFQVSGDGKNVELQDGDGNAVVSLPLAFQLGDLQLPFEREISEDGKTLTLTPVTDMSQATPVAPEDKTAPSLNPVSLALKDVASPEENLKAQQNFSSQLAIASAVGGLTGGIIGCVIGAVAGGIPTALIAALPGCAAGFGIGSVVGTIAAGGPTLIVAGIGLIQTLMAPPGTTQWAE
>NZ_CP024315.1|WP_099528035.1|2281825_2285281_+|4Fe-4S-dicluster-domain-containing-protein
MNALTITLGTIGVLLSLVCWYSFIGGAMKMVNVVRIGQPAPDRWQPFFPRFKQMLVEFVAHTRMSKFRTVGWAHWLVMVGFMLGAIVWFEAYGQTFDPAFHWPLIGNTAVYHLIDELLGLGTVIGITALIIIRQLNHPRKPERLSRFAGSDFRAAYFVEAVVLIEGLGMIFVKAGKIATYGHANPWTDFFTMNLAKLLPASAVMVSIFAFVKLMSGMIWLYVVGRNITWGVAWHRFAAFFNIYFKREDDGGVALGAAKPMTSKGKAIDMETADPDTDTFGAGKIEDFSWKGWLDFTTCTECGRCQSQCPAWNTGKPLSPKLLITSLRDHGYAKAPYLLAGGRKDLGGDEIGLVDAEGNPDEAKLGKIPAAALAETDRRLVGETVEGELAPVIDTETLWSCTNCGACVEQCPVDIEHVDHIIDMRRYQVLIESDFPSELAGLFKNLENKGNPWGQNAKDRLNWISELDFDVPVFGQDADTFADYEYLFWVGCAGAYEDRAKKTTKAVAELLATAGVKFMVLGAEETCTGDSARRAGNEFLFQQLAMQNIETLNSVFEGVEDSKRKIVVTCAHCFNALNNEYPQFGGNYEVVHHTQLLNRLVRQKKLVPVASVSQDVTYHDPCFLGRHNKVYDAPRELMAASGAKLTEMPRHGERSMCCGAGGARMWMEEKIGKRINIDRVDEALSTSPSKIATGCPFCRVMLNDGVTARQEKGEGEGVEVVDVAQLMLDSITRLEPAQLGENLKVIPSERPAPAPAADSKGAAVASEAVAETEEKERVEEIEEAAATPAAPKTAPAGGLQMKGAAKAPGAKPGGLQMKGGLKAPGAKASGDGAAAEAPAAPAAKPGGLQMKGGLKAPGAKKAAPAAPAAESAPAEAPAAPKAKPGGLQMKGGLKAPGAKKAAPAAPAAESAPAEAPAAPKAKPGGLQMKGGLKAPGAKKAAPAAPAAEAPAAEAPAAEAPAAPSVPKAKPGGLQMKGGLKAPGAKKAAPAAPAAKAPATEAPASAEAPAAEAPAAEAPAAETSTAPEPPKAKPGGLAFKGGAKAPGARKAAAPTAPAEKSEPAGKPEPAEKPAAPEKAPEPAHAPPGEAPDPDAPPEKAPEPETQSTNGAEATPTNGAEATPTNGAESPAPPQAKPGALGFRSGAKAPGRRS
>NZ_CP024315.1|WP_010593272.1|2285414_2286359_-|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein
MGDEHDIIRRAAALERGVSDREIRRLCGRGHWHRVHRGAYLPAESYSQLDEYGRHHRRAVAVAGAIRSDAALSHVSAAVLHGLALWHTPLDDVHLTRNRAGGAKRTPGRNLHASPFAPDEVTEIDGARVLTVARTVADLARTLPFEQAVVAGDHALHTCGISVADVTDALARNVRHPGHAKGLRAAQFMDGRSESVGESRSRVLFVRAGLPIPLTQATVHDARGRWLARVDFLLPDHGVIGEFDGRVKYRGDDVAPEETVWREKQREDRLRDAGWTVVRWVWDELAAPLVVADRIREAITRAARGPRPTGTFRV
>NZ_CP024315.1|WP_010593273.1|2286525_2287677_-|alkane-1-monooxygenase
MVGDGAAVAQWRDRKRYLWLCGLAVPLSPFVAWVLVEYLRLGLFWAFGALLIAVIVPLVDRFTGVDKANPPEELVRELEEDRYYRWCTYLYLPLQYAGLVFACWVWTVAPMGWPERFAMAATVGVVGGVGINAAHELGHKRTDLERRLAKIALAQSGYGHFFVEHNHGHHLRVATPEDAATARFGETYWKFLPRSVFGGVRSGWRYERDRLARRGLPWWSPRNNVLNAWALTVVLYAGLIAVFGWSVAPWLIVQAVLAVMFLEAANYLEHYGLLREQRPDGSYVRVAPRHSWNSDHSCSNLFLYHLQRHSDHHANPLRRYQTLRTMEEAPQLPAGYAVMILLSFVPPLWRKVMDPRLLDHYDGDVSRVNLDPARREELIARHS
>NZ_CP024315.1|WP_003938894.1|2287874_2288078_-|cold-shock-protein
MAQGTVKWFNAEKGFGFIEQDGGGPDVFVHYSEIQGSGFKSLDEGARVEFEIGQGQKGPQAQGVRPI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024315_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024315_3

3285798-3285894

Orphan

Consensus_repeat	Method
GCGCGGTTCAGCCGGCGCGCACAGCGCGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024315_3

>merge|NZ_CP024315|3|3285798-3285894|CRISPRCasFinder
GCGCGGTTCAGCCGGCGCGCAGCGCGGTTCAGCCGGCGCGCACAGCGCGGTTCAGACGGCGCGCACGGCGCGGTTCAGACGGCGCGCACGGCGCGGT

>NZ_CP024315|3|3|3285798-3285894|CRISPRCasFinder
GCGCGGTTCAGCCGGCGCGCAGCGCGGTTC	AGCCGGCGCGCACAGCGCGGTTCAGACGGCGCGCACG
GCGCGGTTCAGACGGCGCGCACGGCGCGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024315.1\|WP_010594146.1\|3293091_3294267_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379062
NZ_CP024315.1\|WP_010594135.1\|3284703_3284994_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642
NZ_CP024315.1\|WP_010594129.1\|3279920_3280661_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP024315.1\|WP_010594148.1\|3295625_3297089_+\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP024315.1\|WP_010594130.1\|3280742_3281363_+\|AIM24-family-protein	unknown	unknown	gnl\|CDD\|376704
NZ_CP024315.1\|WP_006944063.1\|3282998_3283196_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|377304
NZ_CP024315.1\|WP_010594136.1\|3285017_3285797_+\|putative-protein-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|274733
NZ_CP024315.1\|WP_010594132.1\|3282069_3282825_+\|AIM24-family-protein	unknown	unknown	gnl\|CDD\|376704
NZ_CP024315.1\|WP_010594139.1\|3287399_3288308_+\|polyphosphate-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143622
NZ_CP024315.1\|WP_010594140.1\|3288350_3289028_+\|DUF4956-domain-containing-protein	unknown	unknown	gnl\|CDD\|379819
NZ_CP024315.1\|WP_010594138.1\|3286644_3287166_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NZ_CP024315.1\|WP_003938723.1\|3283241_3283718_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|153099
NZ_CP024315.1\|WP_010594144.1\|3291628_3292045_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|236607
NZ_CP024315.1\|WP_010594141.1\|3289123_3290569_+\|CotH-kinase-family-protein	unknown	unknown	gnl\|CDD\|227642
NZ_CP024315.1\|WP_010594133.1\|3283714_3284179_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP024315.1\|WP_010594147.1\|3294272_3295457_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP024315.1\|WP_010594134.1\|3284224_3284686_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP024315.1\|WP_010594131.1\|3281371_3282073_+\|AIM24-family-protein	unknown	unknown	gnl\|CDD\|376704
NZ_CP024315.1\|WP_010594145.1\|3292252_3292993_+\|GAP-family-protein	unknown	unknown	gnl\|CDD\|378566
NZ_CP024315.1\|WP_029540006.1\|3290819_3291401_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379324

Protein	Function_ID	Function_description	E-value
NZ_CP024315.1\|WP_010594146.1\|3293091_3294267_+\|ATP-binding-protein	gnl\|CDD\|379062	pfam13191, AAA_16, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	2.82097e-10
NZ_CP024315.1\|WP_010594135.1\|3284703_3284994_+\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	5.70252e-32
NZ_CP024315.1\|WP_010594129.1\|3279920_3280661_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	6.09873e-53
NZ_CP024315.1\|WP_010594148.1\|3295625_3297089_+\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP024315.1\|WP_010594130.1\|3280742_3281363_+\|AIM24-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	1.02453e-32
NZ_CP024315.1\|WP_006944063.1\|3282998_3283196_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|377304	pfam04324, Fer2_BFD, BFD-like [2Fe-2S] binding domain. The two Fe ions are each coordinated by two conserved cysteine residues. This domain occurs alone in small proteins such as Bacterioferritin-associated ferredoxin (BFD). The function of BFD is not known, but it may may be a general redox and/or regulatory component involved in the iron storage or mobilisation functions of bacterioferritin in bacteria. This domain is also found in nitrate reductase proteins in association with Nitrite and sulphite reductase 4Fe-4S domain (pfam01077), Nitrite/Sulfite reductase ferredoxin-like half domain (pfam03460) and Pyridine nucleotide-disulphide oxidoreductase (pfam00070). It is also found in NifU nitrogen fixation proteins, in association with NifU-like N terminal domain (pfam01592) and NifU-like domain (pfam01106).	5.90478e-07
NZ_CP024315.1\|WP_010594136.1\|3285017_3285797_+\|putative-protein-N(5)-glutamine-methyltransferase	gnl\|CDD\|274733	TIGR03704, PrmC_rel_meth, putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific. This protein family is closely related to two different families of protein-(glutamine-N5) methyltransferase. The first is PrmB, which modifies ribosomal protein L3 in some bacteria. The second is PrmC (HemK), which modifies peptide chain release factors 1 and 2 in most bacteria and also in eukaryotes. The glutamine side chain-binding motif NPPY shared by PrmB and PrmC is N[VAT]PY in this family. The protein substrate is unknown. [Protein synthesis, Ribosomal proteins: synthesis and modification].	2.18754e-111
NZ_CP024315.1\|WP_010594132.1\|3282069_3282825_+\|AIM24-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	7.91033e-15
NZ_CP024315.1\|WP_010594139.1\|3287399_3288308_+\|polyphosphate-polymerase-domain-containing-protein	gnl\|CDD\|143622	cd07750, PolyPPase_VTC_like, Polyphosphate(polyP) polymerase domain of yeast vacuolar transport chaperone (VTC) proteins VTC-2, -3 and- 4, and similar proteins. Saccharomyces cerevisiae VTC-1, -2, -3, and -4 comprise the membrane-integral VTC complex. VTC-2, -3, and -4 contain polyP polymerase domains. For S. cerevisiae VTC4 it has been shown that this domain generates polyP from ATP by a phosphotransfer reaction releasing ADP. This activity is metal ion-dependent. The ATP gamma phosphate may be cleaved and then transferred to an acceptor phosphate to form polyP. PolyP is ubiquitous. In prokaryotes, it is a store of phosphate and energy. In eukaryotes, polyPs have roles in bone calcification, and osmoregulation, and in phosphate transport in the symbiosis of mycorrhizal fungi and plants. This subgroup belongs to the CYTH/triphosphate tunnel metalloenzyme (TTM)-like superfamily, whose enzymes have a unique active site located within an eight-stranded beta barrel.	1.10238e-61
NZ_CP024315.1\|WP_010594140.1\|3288350_3289028_+\|DUF4956-domain-containing-protein	gnl\|CDD\|379819	pfam16316, DUF4956, Domain of unknown function (DUF4956). This family consists of uncharacterized proteins around 220 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.	1.6739e-25
NZ_CP024315.1\|WP_010594138.1\|3286644_3287166_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	2.16492e-22
NZ_CP024315.1\|WP_003938723.1\|3283241_3283718_+\|bacterioferritin	gnl\|CDD\|153099	cd00907, Bacterioferritin, Bacterioferritin, ferritin-like diiron-binding domain. Bacterioferritins, also known as cytochrome b1, are members of a broad superfamily of ferritin-like diiron-carboxylate proteins. Similar to ferritin in architecture, Bfr forms an oligomer of 24 subunits that assembles to form a hollow sphere with 432 symmetry. Up to 12 heme cofactor groups (iron protoporphyrin IX or coproporphyrin III) are bound between dimer pairs. The role of the heme is unknown, although it may be involved in mediating iron-core reduction and iron release. Each subunit is composed of a four-helix bundle which carries a diiron ferroxidase center; it is here that initial oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of ferric-hydroxyphosphate at the core. Some bacterioferritins are composed of two subunit types, one conferring heme-binding ability (alpha) and the other (beta) bestowing ferroxidase activity.	6.87203e-73
NZ_CP024315.1\|WP_010594144.1\|3291628_3292045_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|236607	PRK09648, PRK09648, RNA polymerase sigma factor ShbA.	4.71399e-22
NZ_CP024315.1\|WP_010594141.1\|3289123_3290569_+\|CotH-kinase-family-protein	gnl\|CDD\|227642	COG5337, CotH, Spore coat assembly protein [Cell envelope biogenesis, outer membrane].	1.97874e-115
NZ_CP024315.1\|WP_010594133.1\|3283714_3284179_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	2.6065e-22
NZ_CP024315.1\|WP_010594147.1\|3294272_3295457_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	9.55087e-52
NZ_CP024315.1\|WP_010594134.1\|3284224_3284686_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.6229e-14
NZ_CP024315.1\|WP_010594131.1\|3281371_3282073_+\|AIM24-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	2.81426e-31
NZ_CP024315.1\|WP_010594145.1\|3292252_3292993_+\|GAP-family-protein	gnl\|CDD\|378566	pfam11139, SfLAP, Sap, sulfolipid-1-addressing protein. SAP is a transmembrane transport protein with six predicted transmembrane helices, with a hydrophilic domain between helices 3 and 4. This hyrodphobic region is highly variable among identified Gap-like (GPL, peptidoglycolipid, addressing protein) proteins and may be involved in substrate recognition. SAP also belongs to the LysE protein superfamily (pfam01810), whose members have been implicated in small molecule transport in bacteria. Other Gap proteins export metabolites across the cell membrane so it is possible that Sap specifically may be involved in transport of sulfolipid-1 across the membrane.	6.19819e-28
NZ_CP024315.1\|WP_029540006.1\|3290819_3291401_+\|AAA-family-ATPase	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	2.03235e-07

>NZ_CP024315.1|WP_010594136.1|3285017_3285797_+|putative-protein-N(5)-glutamine-methyltransferase
MPPPPDVTAVAATLRRAGCVFAEDEARLLIDAARTPGDLADSVRRRAGGEPLEHVLGWTEFRGLRIHVTPGVFVPRRRSEFLVECAVALAAPGVVVDLCCGSGALGAAVAAAVADVELHATDLDPAAVECAGRNLAAFGGHVYEGDLYDPLPAGLRGRVHLLLANVPYVPTADLALLPADAREHEARIALDGGADGLDVLRRVAAAAGRWLAPGGHLLVESSTQQADGIAACFDRNGLTPQVAHSDDDFATVVVGTAPR
>NZ_CP024315.1|WP_010594135.1|3284703_3284994_+|N-acetyltransferase
MSDPSVAAVHNPQRQRYELRDGDTVVGYTQYHPDGDVQLVFDHTEVDNAYSGRGLSSTLVRFALDDVRARGKRVVAICPFVDGFIDKHPEYKDLAD
>NZ_CP024315.1|WP_010594134.1|3284224_3284686_+|MarR-family-transcriptional-regulator
MTETRWLSDDEQRTWRAYLDSTRLLMNALDRQLTRDSGMSLTDYELLVALSEAPGRRLRMRALADAVVTTRSGVTRAISRLVDAGWVRRVECDEDKRGMLAELTDAGAAKLAQASPGHVEAVRSYVFDLLGPRDVTRFGDTYTAMRTHLLENT
>NZ_CP024315.1|WP_010594133.1|3283714_3284179_+|carboxymuconolactone-decarboxylase-family-protein
MSDKRVPIDKQTRPVYRAQIAVAQAIRQATADAGLGRRLVELVNIRVSQINGCAYCLDVHVRDALREGETTQRLAVLRAWRDTDLFTEQEQAALTLAESITELPDSRAQDRDYAFARARLTEDQLSAIAWVAVAMNTFNRVSIVSRHPVRPPQE
>NZ_CP024315.1|WP_003938723.1|3283241_3283718_+|bacterioferritin
MKGDKKVIEYLNEQLTAELTAINQYFLHSKMQDNNGWTKLAAHTRAESFEEMRHAETLTDRILFLEGLPNYQRLGTLRLGETVKEMFEADLQVEIEARDRLRKGAEYMRSVHDITSARIFEEILANEEEHIDYLETQLGLLEQLGEPLYISVHVSPPE
>NZ_CP024315.1|WP_006944063.1|3282998_3283196_+|(2Fe-2S)-binding-protein
MIVCSCHALSHRHIEAHIAAGARCTREIGAACRAGTDCGRCVRNISAIVRASRERDERIELETAV
>NZ_CP024315.1|WP_010594132.1|3282069_3282825_+|AIM24-family-protein
MSVVLNPSHLVGSDNLPGNHYAFCIDLQSPWFLSKGAMIAYYGQVQFTSLTHGLQGQLLQMVAHQFSAPLYMGDYVVAEGYGKLILGDRGYDINSYDLDDGNLTIRAANLLAFEPGLSLNQSIVPGFLTLIGTGKFLASSNGPVMFAEPPLRVDPEALVGWADCPSPSHHYDEAWVNGFVAAGARMFGVQSGEERQFDFTGAGTVLVQSSEKVIDDSAVVRTIEGQLPGLTPGGLQRINQVVASQLQSQQH
>NZ_CP024315.1|WP_010594131.1|3281371_3282073_+|AIM24-family-protein
MFSKINGKVVKVDLNQSGPVVARRGAMLFYTGMVQFAPHQVPGAGGMPGMGGIAGMAGRMMQGEHERTMLAQGNGVVHYGFRGLEVHVVDLSAGGDLRVEASRLLGYTASLQSSVVSMAAPPAGGGGGGGGFLGALRNAATGMVTGTGMFTTQLSGRGTAVLLGHGGFLELQVGGPAPVVVDPQSFIAASGPVRTELKSSMSWRNAGRSGGEGLQLECTGQGIVYVQASEEKL
>NZ_CP024315.1|WP_010594130.1|3280742_3281363_+|AIM24-family-protein
MRLVEKSKRVIEAHLNNTSVRALSGSMVAYEGQVQFKSAGFGGGEGVLAGLRQRATGEGLSLMECTGNGVVYLAHQGQDVTVLELNNETLQVESEQLLALNGNLGTNVTFAGVRGNMSGQGLFTTTVTGSGQVALLSAGGPLIHLEVSPQYPLVVDPDAFVCAKGQLSQSFVTDVSWRTFVGQGSGEAFSLRWDGMGVVSIQPAER
>NZ_CP024315.1|WP_010594129.1|3279920_3280661_-|IclR-family-transcriptional-regulator
MPDAPDRSLLGRAFAVLGAFTAERPRLTQSELSRRTGLPLPTVFRLCGQLVDAGALERRADGSYQIGVRVWELGALAPRAHGLRQVAMPYLEDLFDATRENVQLVVREGLEALYVERLSARGAVPVVGRAGGRLPLHASSGGLVLLAHGGTELLQEVLDAGLERFTPATIVDESRLRRVLDDIRRTGVVIAREYLNVGTMAMAAPIRERSGRVVAAVSVVVSIEADPAPLIPAMRAAASGISRRLT
>NZ_CP024315.1|WP_010594138.1|3286644_3287166_+|DUF1992-domain-containing-protein
MTERKRPDITFESWIERQIRVAQERGDFDNLRGAGKPIPHRSDDELWWVKDYLRREGLSTEALLPPPLQLRKEVERLRDTVRDVPSEPAVRQIVRELNRRIVDCLRAPSGPLVPIHRVDPEEVVRQWATDRAELRSQRAERAAAAAAALREYTAEPPRRRWWHRVLGIRPAGT
>NZ_CP024315.1|WP_010594139.1|3287399_3288308_+|polyphosphate-polymerase-domain-containing-protein
MGVFDRFRTSTPQDMPPTDAVPTAPTGYRQTAGSLHAFNRYEIKYFVDELKVPELRRELAARMETDPYSPHGGYPVTSLYYDTPDLRFYWEKIEGLRFRRKLRMRLYGNPSECTDDTPVHIEVKQRVNRVTQKRRIAMPYGTAQRWLDGRQEVGCDPPQRPFVHEVTTLIGNLDLRPIVTTGYLREAFVGREADLGLRVTIDHKVHGRDGDFGFASGAQNRFVVPPKLAIVELKANERVPYWATDLTARMDMSVVRVSKYCQSVEAFGLAPRSRFGAPGLVLPQGFDGRVPTGLLETTTTVP
>NZ_CP024315.1|WP_010594140.1|3288350_3289028_+|DUF4956-domain-containing-protein
MNFDLQDLSGTFTTFDIIVSLSLSFVLASIIGWVYRHTHKNVSYSQSYVQTLVLVGMVIALIMLVVGSNIARAFALVGALSVVRFRNAIKETRDVGFIFLVMAVGMTTGTRFYLLAIAATIAICLVLLIMSKFNWFELDVRRQVVKVQVPPEQQYSAMVEDVLVRYCTEFELVSTESVRSGALTELYYTAQLKKDAKPNELISALSAVNTGQRVTVLTGYDQTDI
>NZ_CP024315.1|WP_010594141.1|3289123_3290569_+|CotH-kinase-family-protein
MFVAFVTILATVFGATRIRPYLTGDPTIIASEITDNITGTVDLFDASVPHELSVEITDAEYDEMITAFQSTGEKKWVTADVTLDGTLITDVSVRLKGNSTLMGLRGTGTRVGGQGVAPPAGLELPEGFEPPATGGMSQATADDPTSLPLLVSFDENADGRAYQGMTEISVRPGSPVLNEAMALSLTAETEQPTQRYAYTVYSVNGSATTTRLLLEHPDDTYANSLFDSEGYLYKADASSRFEYVGDDQSDYADQFEQINAVGTGNLQPIVRFLEWLDSAGDEEFDAHLSEWVDVDSFARYVTTQNLLVNGDDMSGPGQNYYLWYDLGTGRLSVVSWDLNLAMQGDATTGPHDTVSMGPGARGGAGQDGRGTPPAGVGAVAQPRAMPSDAAAPPGDGRMQSGNALKTRFLGSDAFTGVYEDAYRELYDQMYGSGRALEILDTLVATVPVSDGLPADSLRSSADSMRSWIEQRTAALAELRDS
>NZ_CP024315.1|WP_029540006.1|3290819_3291401_+|AAA-family-ATPase
MVGGIPGAGKSTLLRRIEHDIPGLTVLDPERRAEGLAAALPPDLPYRRYRPLVHLMHTLDVVRTLLAGPHRSEGPVAVHDTATRSRRRDWTARLARRRGWTPVLVFLDVPRDVAQAGQHARGRVVNESSFARHWHRWTVLRSHLTDEDDATAGSPWDQVVVTTRDNAKSRVCDVLTQDETVPCELGGGSPVPQ
>NZ_CP024315.1|WP_010594144.1|3291628_3292045_+|sigma-70-family-RNA-polymerase-sigma-factor
MRPWIEQRTAALDPENPDAVRSDPRNAAPVGDVPDVPWGPEAPETHARRRYERRRIDALLDVLTDRQRDILHLRVVHSMSTAETAAVLHITPGAVRLGQHRALSRLRVALTRPAGEPITCRDTVVPLDARRRDATRPA
>NZ_CP024315.1|WP_010594145.1|3292252_3292993_+|GAP-family-protein
MSVSTGRGCDYSSSEIDDRRSEGWLMAGAIGQSLPIAVGLLLAAMPIVMLSVLLVTKRPLRVSYAFVGGWFAGLLVVGAVVIAVADVIMLSDEPTWWAAAAKLVLGVVLVLLAVRKWYSRPQPGEESTVPGWMAAAQTMTARRALALGFLFAAANPKNLALVAAGAVVIADATARVPEQIVALIVFAVVASLGVAAPPAVRGVFADRADRALAAADEWMTRQHTVIMAAVLLILGLILIGNGIAGL
>NZ_CP024315.1|WP_010594146.1|3293091_3294267_+|ATP-binding-protein
MDLELNPFKPGSGLRPPALEGRDEQIGAFELLVARSKRQNYDRGLILSGLRGVGKTTLLNALVEHADRQGWLTIALEARPNEAGTSAVRAKLSQELTVGLRRYSRKHRIQHAIDPLIDLARGFSLGLGLGPATASFSLDQPPAASGDIDLDLEELVEAITAELRPRSSAFGLFVDEMQDLDSDLLSALLAVQHRASQREWPFFLIGAGLPNLPAVLAGNRSYAERQFLYSTIGPLSPTAAADALRIPVRRQGGDFTDDALAVLVQASGGYPYFLQEFGKAIWNVAPHSPFQLEDAELAVEVGRRHLDEGFFPSRWNRATDRERRYLAALAAAGEEAPRSGKVAQLMGSTATGVSDVRNSAIRKGLIWAPEHGRIAFTVPGMADFIRRQPAE
>NZ_CP024315.1|WP_010594147.1|3294272_3295457_-|ROK-family-protein
MSRSSSAPATAGEVFALVRAGAATTRSEIGHHTGLSRTAVAARVAALQDLGLVVETEEGPSTGGRPPLTLTFGAGAGIVLVVAIGRSRTQLAVCDLAGDLLRTEDLEQEIGASPGELMPKVAAHLADLRAALGPGAPRTVGIGVSLPGTVDTARGCSLDSPMMAGWDGVELQPFLADLGGAPVFVDNDANVMVLAERLGERRKFDDMLLIKASTGLGAGIVSGGVLQRGAVGAAGEIGHTKTAAAQGVLCRCGDVGCVEAIAGGWALVRDLQEQGRDVTHIRDVVALAVGGDAEARRMIRDSGRRIGEVIAGAVNLLDPAVLVVGGDMAEAYDVFVAGLRETLYRDAVSVATRALQILPWSHGDRSGMIGCASMALDQVLSVRAVDRMVAERGR
>NZ_CP024315.1|WP_010594148.1|3295625_3297089_+|glucose-6-phosphate-dehydrogenase
MSPAAPCTVVVFGGTGDLAVRKLLPALYLRDRDGQLPPRSRIVGAARAGLDTDGYRDKVRGELARFVPAPLLDAGTLTRFLDRLDYVSLDFAGGDDWSALHDVLPPDSVRVFYLACAPSLFGPISHHLARHGLVEPTSRVVLEKPIGRDLASAHAINDAVGEVFDESQIFRIDHYLGKESVQNLLVTRFANTLLEPLWNSTWIDHVQITVSESLGVGTRGGYYDTSGALRDMLQNHLLQVLCLVAMEPPTVVDRETVRDEKLKVLQALRPMTAEDVERFTVTGQYGPGLVDGGAVPGYRDEVENPDSRTETFVAVRAEVRNWRWAGVPFYLRTGKRLEKRSSEIVVQFKDVPHPMFPRAEGATEPNRLVIRLQPDEGICLHMTAKEPGPGGIRLRPVSLDLNYVDAFDRPSPDAYERLLMDVVRGDPTLFMRRDEVETAWAWVEPILQTWDRTGRMPRRYPAGTSGPTDATTLIERDGRAWYEGTSV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024315_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024315_4

3839860-3839952

Orphan

Consensus_repeat	Method
GTCGCTGGGCGGGTAGCCCTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024315_4

>merge|NZ_CP024315|4|3839860-3839952|CRISPRCasFinder
GTCGCTGGGCGGGTAGCCCTCAGAGTCGCTGGGCGGTAGCCCTCAGGGTCACTGGGCGGTAGCCCTCAGGGTCGCCGGGCGGGTAGCCCTCAG

>NZ_CP024315|4|4|3839860-3839952|CRISPRCasFinder
GTCGCTGGGCGGGTAGCCCTCAG	AGTCGCTGGGCGGTAGCCCTCAGGGTCACTGGGCGGTAGCCCTCAGG
GTCGCCGGGCGGGTAGCCCTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024315.1\|WP_003937196.1\|3847439_3847757_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010596231.1\|3842728_3845116_-\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|223256
NZ_CP024315.1\|WP_099528212.1\|3829981_3830533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010596010.1\|3830908_3831370_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010596229.1\|3847956_3848586_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380061
NZ_CP024315.1\|WP_099528117.1\|3840402_3841782_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP024315.1\|WP_010596017.1\|3838813_3839188_+\|glutaredoxin	unknown	unknown	gnl\|CDD\|131255
NZ_CP024315.1\|WP_010596016.1\|3837734_3838622_-\|slipin-family-protein	unknown	unknown	gnl\|CDD\|259808
NZ_CP024315.1\|WP_003937198.1\|3845784_3846195_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP024315.1\|WP_010596018.1\|3839187_3839820_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP024315.1\|WP_040271490.1\|3831507_3833019_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010596012.1\|3833015_3834374_+\|NAD(+)/NADH-kinase	unknown	unknown	gnl\|CDD\|224513
NZ_CP024315.1\|WP_003939454.1\|3839971_3840274_-\|metal-sensitive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197385
NZ_CP024315.1\|WP_003937200.1\|3845177_3845627_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP024315.1\|WP_010596013.1\|3834337_3835996_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP024315.1\|WP_010596228.1\|3848759_3849821_+\|phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|270703
NZ_CP024315.1\|WP_010596232.1\|3841918_3842689_+\|thioesterase-family-protein	unknown	unknown	gnl\|CDD\|379298
NZ_CP024315.1\|WP_010596009.1\|3830609_3830837_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010596014.1\|3836099_3836921_-\|class-II-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|238889
NZ_CP024315.1\|WP_010596230.1\|3846417_3847326_-\|cation-transporter	unknown	unknown	gnl\|CDD\|223131

Protein	Function_ID	Function_description	E-value
NZ_CP024315.1\|WP_010596229.1\|3847956_3848586_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380061	pfam17932, TetR_C_24, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in family members such as HTH-type transcriptional repressor KstR2 as well as fatty acid metabolism regulator proteins. In Mycobacterium smegmatis, KstR2 is involved in involved in cholesterol catabolism, while YsiA in Bacillus subtilis is involved in fatty acid degradation.	3.42278e-34
NZ_CP024315.1\|WP_099528117.1\|3840402_3841782_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.85271e-76
NZ_CP024315.1\|WP_010596017.1\|3838813_3839188_+\|glutaredoxin	gnl\|CDD\|131255	TIGR02200, conserved_hypothetical_protein, Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.	1.53285e-20
NZ_CP024315.1\|WP_010596018.1\|3839187_3839820_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.83171e-18
NZ_CP024315.1\|WP_003937198.1\|3845784_3846195_+\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.43758e-47
NZ_CP024315.1\|WP_010596231.1\|3842728_3845116_-\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|223256	COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair].	0
NZ_CP024315.1\|WP_010596230.1\|3846417_3847326_-\|cation-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	9.90464e-75
NZ_CP024315.1\|WP_010596012.1\|3833015_3834374_+\|NAD(+)/NADH-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	2.27193e-37
NZ_CP024315.1\|WP_003939454.1\|3839971_3840274_-\|metal-sensitive-transcriptional-regulator	gnl\|CDD\|197385	cd10148, CsoR-like_DUF156, Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This superfamily includes various transcriptional regulators that respond to stressors including Cu(I), Ni(I), sulfite, and formaldehyde. It includes CsoR (copper-sensitive operon repressor) from Mycobacterium tuberculosis (MtCsoR), Bacillus subtilis (BsCsoR), Thermus thermophilus (TthCsoR), and Staphylococcus aureus (SaCsoR), Mycobacterium tuberculosis RicR (regulated in copper repressor, MtRicR), Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), Alcaligenes xylosoxidans NreA (nickel-sensitive), E. coli FrmR (formally known as YaiN, formaldehyde sensitive), and Staphylococcus aureus CstR (CsoR-like sulfur transferase repressor, NWMN_0026.5, SaCstR). CsoR is Cu(I)-inducible, and regulates the expression of genes involved in copper homeostasis. For example, TthCsoR binds the promoter region of the copZ-csoR-copA operon, and represses expression of these genes, which encode the copper chaperone CopZ, CsoR, and the copper efflux P-type ATPase CopA, respectively. In the presence of excess Cu(I), TthCsoR binds this ion, and is released from the DNA, allowing expression of the downstream genes. TthCsoR also senses other metal ions such as Cu(II), Zn(II), Ag(I), Cd(II) and Ni(II). CsoRs form a homotetramer (dimer of dimers). In the case of MtCsoR, two Cys residues on opposite subunits within each dimer, along with a His residue, bind the Cu(I) ion. These residues are conserved in the majority of members of this superfamily. Exceptions include the functionally uncharacterized Bacillus subtilis YrkD where there is an Asn instead of His (C-N-C), E.coli RcnR where there is a Thr instead of the second Cys (C-H-T), or TthCsoR and E.coli FrmR where there is a His instead of the second Cys and which have an additional N-terminal His (not found in those family members having C-H-C) that may also be involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue facilitate allosteric regulation of DNA binding. SaCstR regulates genes predicted to function in sulfur metabolism; it is thought that oxidation of the intersubunit Cys pair to a mixture of disulphide and trisulphide linkages by sulfite, results in a reduced affinity of SaCstR for the operator DNA. SaCstR exists as a mixture of oligomeric states, including dimers, tetramers and octamers. The sequence of SaCstR was not available at the time this hierarchy was curated and therefore was not included. Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA. The gene encoding Alcaligenes xylosoxidans NreA is part of the nre nickel resistance locus located on the pTOM9 plasmid from thisbacteria. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon.	7.99526e-22
NZ_CP024315.1\|WP_003937200.1\|3845177_3845627_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	5.11799e-28
NZ_CP024315.1\|WP_010596013.1\|3834337_3835996_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.53492e-54
NZ_CP024315.1\|WP_010596228.1\|3848759_3849821_+\|phosphotransferase-family-protein	gnl\|CDD\|270703	cd05154, ACAD10_11_N-like, N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	3.8175e-92
NZ_CP024315.1\|WP_010596232.1\|3841918_3842689_+\|thioesterase-family-protein	gnl\|CDD\|379298	pfam13622, 4HBT_3, Thioesterase-like superfamily. This family contains a wide variety of enzymes, principally thioesterases. These enzymes are part of the Hotdog fold superfamily.	1.28401e-24
NZ_CP024315.1\|WP_010596014.1\|3836099_3836921_-\|class-II-glutamine-amidotransferase	gnl\|CDD\|238889	cd01908, YafJ, Glutamine amidotransferases class-II (Gn-AT)_YafJ-type. YafJ is a glutamine amidotransferase-like protein of unknown function found in prokaryotes, eukaryotes and archaea. YafJ has a conserved structural fold similar to those of other class II glutamine amidotransferases including glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The YafJ fold is also somewhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.	6.49506e-76
NZ_CP024315.1\|WP_010596016.1\|3837734_3838622_-\|slipin-family-protein	gnl\|CDD\|259808	cd08826, SPFH_eoslipins_u1, Uncharacterized prokaryotic subgroup of the stomatin-like proteins (slipins) family; belonging to the SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes a subgroup of the stomatin-like protein family (SLPs or slipins) that is found in bacteria and archaebacteria. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Bacterial and archaebacterial SLPs remain uncharacterized. This subgroup contains PH1511 from the hyperthermophilic archaeon Pyrococcus horikoshi.	5.18444e-89

>NZ_CP024315.1|WP_010596018.1|3839187_3839820_+|class-I-SAM-dependent-methyltransferase
MPEHLQDEELWDERYRSRPALWSGEPNRHLVGEVAGLSPGLALDVGCGEGADAIWLAQRGWRVDGVDVSGVALQRAAEHADRAGAEVAGRISWLHENLTAWDPGRGRYDLVSAQYMHLPSPERDVLFRRLGEAVAPGGTLLIVGHHPSDLQTTVPRPPRPELFFTGADVVALLDPDGWDVVTDAAVAREVTDPDGRVVTVHDTVVRARRR
>NZ_CP024315.1|WP_010596017.1|3838813_3839188_+|glutaredoxin
MTLPDFVDGVEVLWRPGCPFCSRLRRGLHRRGIEVVETDIWQDRAAAARIRAVSGGDEIVPTVFVGPVALVNPSVQEVESAIERHLPGRVGELIGPRPRTVWSRLADTVRGRPAAPPSRRSKES
>NZ_CP024315.1|WP_010596016.1|3837734_3838622_-|slipin-family-protein
MATWVVLTGVLLVVALFVLSQAVHVVTQYEKGVLFRFGRLIGVREPGLHLIIPLVDRLTKVSLRIVTMPIQSQGIITRDNVSVDISAVAYFRVIDAVKSVVAIENVAAAIDQIAQTTLRRVVGRHTLDEALSETNVINANIREFLDVSTLEWGVEVTLVELKDIQLPDSMKRAMARQAEAEREKRAKIIAAEGESIAATALGQASDTMLAHPLALQLRNLQTLVELGVEKNTTVVFPAPMMSAISELKTFLDREITAATAGPPRSAADSARPPESEIARNGTPAPTVSAHEGLGS
>NZ_CP024315.1|WP_010596014.1|3836099_3836921_-|class-II-glutamine-amidotransferase
MAYSGEPILVEDLLFKPEHSLIDQSLHSHLGATTTNGDGFGIGWYGIGSEPALFKSIDPAWNNHNLREIAGQIRTPLLFAHVRASTGTQVQRSNCHPFRHGEWLWMHNGEILGFREIKRELMMAVDPSLYPDVAGTTDSEVLFFLALTFGLRDDPFTAVGRAVGMVEKVARDHGIDDPVQMTVATTAGDTIWVFRYSTEGRTRSLFYSTEVAKLRELHPEVEMFHRLGIDTRFVVSEPLRDLPGAWNEMPESSAAVVGPAGNDIRRFRPLEPV
>NZ_CP024315.1|WP_010596013.1|3834337_3835996_-|MFS-transporter
MSLESSQKGPATASGSALVLAVLAAGQFLMTLDSSVMNVSMATVAADVNTTITGIQTAITLYTLVMATLMITGGKVGTILGRRRAFGLGLIIYGAGSFVTGIAPNLTVLLIGWSLLEGIGAALIMPAIVSLVAANFPAERRPAAYGLVAAAGAAAVAVGPLLGGAVTTFASWRYVFFGEVVVVFLILLTLRRVEDIPPQRIRLDLVGSLLSVVGLGMFVYGVLRSSEWGWIQTKPGGPQILGLSPVIWLLLGGLFVLYLFLRRETYLAKTGGEPLVDPALLKNSQLTGGLSMFFAQFLIQAGVFFSVPLFLSVVLELSALETGVRILPLSIALVLAAIGIPKLRPHANPRLVVRLGLGTMAVGILILVGGMDPGASAAVVSIPMLLMGLGLGALASQLGAVTVSAVPDSQSAEVGGLQNTATNLGASLGTALIGSILIATLTTSVIAGIENNPAVPESVQQQATTDMAAGVPFLSDTQLEDALADAGVDESTADAIVEVNSDARLEALQVAFAVTALLAVAALFGTGSLPRVPVGTRPGEGQRRPDETDDER
>NZ_CP024315.1|WP_010596012.1|3833015_3834374_+|NAD(+)/NADH-kinase
MNPVDAAPGDQVPASRRWWARAAFVAVLCAAVVPVVVAGLRGAVALLVVSVAVAAVTVAALYWFLATRGLARALSLGLAVIAPLALPVLFVREGVLWVALVSVALVLLALLCARAALRRGSEQGMPEYPAPPVHRPFLVMNPRSGGGKVVKFDLQRKAEELGAEVALLAGPGPVDVEALARQAVERGADLLGVAGGDGTQALVAAIAAEHGLPFLVISAGTRNHFALDLGLDREDPAAGLDALRDGVELRVDLGRIGGRVFVNNASFGVYADVVQSPAYRDDKTGTALRMMPDLLARDSATRLRARIDGDTTVEGAQAVLVSNDPYATDDLAGLGRRPRLDRGVLGVVAISVAGAGQAVDLLRRTRSRGLVQRAATEVVVDADAPEIPVGVDGEALMLPTPVRCTVEPQALRVRVPRHRPGALVSAPTWNWVRLRDLAFRPQRSSSVSSGLR
>NZ_CP024315.1|WP_040271490.1|3831507_3833019_+|hypothetical-protein
MDSEPTRSGTGTAPLDTAERAELERLRAEVAALRARTEAAPEAPPPSPPPVSRPPRHALRWTAVAILTVLVALLAITSVTARFVRSEILDTDRYVTTVAPLGSDPAVQTEIAGTVTDEIFARVDVEGLTSDALTALTDAVPATADAPRVDRAVEGLAPVIAGQARNFVYETVLSLVQTDQFEDLWIQANRAAHTGLVAVVTGEGGPSSVTVDESGTVSISLGTIIDNVKARLLDRGFSFAEKIPDIDKQFVLFQSPELIKAQRAVSALNTASDVLPWLTIAAAVAAVAVAPPGRRRRALAFVGTALLVGMLILAIALIVARSLYLGDIPPDVLSPDAASAIADTVLVPLRTALRAVAVLGLVIAVGAYLTGGSASAAAVRRGFGRGMDAVQRSRKPRPPNQVEAGAYRARTALRLAIIGVAALMLMFWRYPTGLVVVWIVLGALLALLALEVLIRPARAWEEPAGDVTSAPPTGASPTGASPTGEQPAGEQPTEKLPGSKTGS
>NZ_CP024315.1|WP_010596010.1|3830908_3831370_+|hypothetical-protein
MSEDVRVGQGSASHGSVSRGSTAERSVGQKIATGTSVGAAVVLATVGILQLLQGVAAVAEGELFVVGQKYTFEFDLTTWGWIHIVTGAVLIVVGAALLTGATWGRVAAIVVAALSILLNFMWLPYYPWWSILIIALDVVVIWAVSTWNPRLDY
>NZ_CP024315.1|WP_010596009.1|3830609_3830837_+|hypothetical-protein
MSDWVCRLMMPKDFGDSPAQLHLVLRDDLTDAEVLARVLGLVHEFYGPRVQVDDLRPESWAQTRVGSRLRSSPAG
>NZ_CP024315.1|WP_099528212.1|3829981_3830533_+|hypothetical-protein
MRRSERVESALVLAVALFVLVLIPFAAAYGTATYARIGQLAMQEHQQRHQVAAVLLEEPAPARADALTDTATRGPGDPDRATARWTTETGETRTGRVEVPFGAKPGETIDIWIDSNGDPVAAPRTGSDGVVAGVVAALTVWGMGSGVALLLLYGVHRAGAKRRISALDREWNDVGRSPGWSMG
>NZ_CP024315.1|WP_003939454.1|3839971_3840274_-|metal-sensitive-transcriptional-regulator
MNTPAAPVARTAVTPEADTQVLHRLRRAQGQLAGVIAMLESGRECRDVVTQLAAVSRALDRAGFKIVAAQLRRCMLDEEDDTCPDRLTEEQLERLFLALA
>NZ_CP024315.1|WP_099528117.1|3840402_3841782_+|MBL-fold-metallo-hydrolase
MILEQYYIECLSHASYLIGDEGTGRAIVVDPRRDVTEYLDDARRHGLSIEGVINTHFHADFVSGHLELLEATGAWIGFGEAAEADYPIRRLRDGEHLSLGEVDLEILSTPGHTWESISVLVREHPGATPTAVLTGDSLFIGDVGRPDLVNLGDSSTEDLARAMYHTVHEKLLTLPDQVTVMPAHGAGSSCGKNLSTELTSTIGEQRVSNPSVQPMSEDAFVALVTEGQPAAPSYFSIDAAMNKRTHPLLAQDRAIPQLSPERVRAELAAGTRVLDARSVDDFAAGHLAGSVNVGFDGRFAETGGMVAEVGEPIVLITYPGQEQDAAVRLARIGSDNALGYLTVGSDGVFPAELAGLVVPAPRTTVEQLEALLAADAVTLVDIRNPGEREFGTIPGAVPIPLAQLRARLEQVPTGKPIVVHCAGGWRSSVAASLLRAQGFENVSDLLGGYNAWADAHVPA
>NZ_CP024315.1|WP_010596232.1|3841918_3842689_+|thioesterase-family-protein
MAYFERIGPAAFRPTHHVGGAWNPQEQHIAPALGLLVHAVECDRDARRDDGLVVARLSYDILGTVPVDTVETTVTVLRPGRTIELVEAVLTHDGRAAVRLRAWLMQPRPTPALEATSLPRIDPPEAMAPWDASTVWPGGFIASTEVRRTQLEPGRAAYWVRTPLPLVLDEKVSAPAGAAGLFDIANGMTVRASPDDVAFPNVDLTAHLFTEPRGDWLGFDTTVSFGPDGLGLTSSVLHDTRGPVGTVSQILTLRPN
>NZ_CP024315.1|WP_010596231.1|3842728_3845116_-|excinuclease-ABC-subunit-UvrA
MATKTDTQSPTLHTADSHDLIRVHGARVNNLHDVSVEIPKRRLTVFTGVSGSGKSSLVFGTIAAESQRLINETYSAFVQGFMPTLARPDVDLLEGLTTAIIVDQERMGSNPRSTVGTATDAHAMLRILFSRLGQPHIGSPNAYSFNVPSVKASGAITVERGAGRTKTEKATFHRLGGMCPRCEGMGSVTDFDRSALYDENLSLDEGALTIPGYSMEGWYGRIYRGCGFFDSAKPIRKYTKRELHDLLYKEPTKIKVDGINLTYEGLIPKIQKSMLSKDVDALQPHIRAFVERAVTFSTCPECNGTRLAQEALSSKIDGRNIADVCAMQISDLADWVRSLDEPSVAPLLTGLQHLLDAFTEIGLGYLSLDRPAGTLSGGEAQRTKMIRHLGSSLTDVTYVFDEPTIGLHPHDIARMNDLLLQLRDKGNTVLVVEHKPEAIAIADHVVDLGPGAGTGGGEVVFEGTVEGLRTSGTLTGRHLDDRASVKPAVRTPSGVLEVRGADTHNLQNVDVDIPLGVLVVLTGVAGSGKSSLIDGSVAGREGVVTVDQGAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPALFSANSEGACPACNGAGVIYTDLGVMATVESTCEECEGKRFQSAVLEFTFGGRSIADVLAMPVTEAEEFFGAGETRIPAAHKILERLADVGLGYLSLGQPLSTLSGGERQRIKLATRMAEKGGVYVLDEPTTGLHLADVEQLLGLLDRLVDSGKSVIVIEHHQAVMAHADWIIDLGPGAGHDGGRIVFEGTPADLVATRSTLTGEHLAAYVGA
>NZ_CP024315.1|WP_003937200.1|3845177_3845627_-|helix-turn-helix-transcriptional-regulator
MTGGPADAQHLRDLARLRRVRDRIDREYAQPLDVEALARGVHMSAGHLSRQFRAAYGESPYAYLMTRRIERAMALLRRGDLSVTEVCFAVGCSSLGTFSTRFTELVGVPPSVYRRQAAHAAAGMPSCVAKTVTRPIRNREAGAAEPQLA
>NZ_CP024315.1|WP_003937198.1|3845784_3846195_+|VOC-family-protein
MDITIHTSFLPHDDPEASLAFYRDVLGFEVRNDVGQGKMRWITVGPAGQPDTSILLAPPAVDPGITDDERRTIAEMMAKGTYGWILLATRDLDATFEKVQAGDVEVVQEPTEQPYGIRDCAFRDPAGNMVRIQERR
>NZ_CP024315.1|WP_010596230.1|3846417_3847326_-|cation-transporter
MTTSVPESRQQQDRLLFRFMLLSLAAAVLTIVLKASAAWATGSVGFLSDALESGVNLVAAVVALIALRVAARPPDASHHFGHGKAEYVSALVEGAMIFVAATAIIWTAIERLISPVPLVQPGLGLALSTVASVINLGVGLTLLRVGRTHRSITLVADGKHLLTDVWTSAGVIVGIALVAVTGWEPLDPIVALAVGVNILWTGYRLLRGSVSGLLSAALPQHEQDQVNAVLDRFRAECPVEFAPLRTVESGRQRQVFVVVTVPGDWTVRTAHDMADRIEAAIDAVLPHTETFIHVEPAGPENA
>NZ_CP024315.1|WP_003937196.1|3847439_3847757_-|hypothetical-protein
MPAPVLTDEQRTAALAKAAEVRKARSELLAAVKAGELDVPAVLEKAETDEVVKKTKVSALIKALPGVGAVKAAKLLEQLSIPDTRRIGGLGANQRQALLDATTAA
>NZ_CP024315.1|WP_010596229.1|3847956_3848586_+|TetR-family-transcriptional-regulator
MSAAKAATVGTGNGRQAILDSALQNMNERGYHGTSMRDIARDADITVASIYHHFKSKQEILQDIMTRALHDAIAMTRGALLRAGGSPDAQLQALVRAWVMFHTTRQLDALVGATELRSLNEAGRRLVVALRDEQEGLFRDVVERGVEEGAFEVEFPRDAVRGIINMGQSVCTWWRSDGPLRAEELADRYADLALAMVQHRPRRVGAPAS
>NZ_CP024315.1|WP_010596228.1|3848759_3849821_+|phosphotransferase-family-protein
MTASPAGAVAGLDLDALTAHLQRVLDGGVSGALTASLIGGGRSNPTYRLADDEHVWVLRRPPYGHVLPSAHDMRREFTVIDALGGTSVPVPRAVHLCEDESILGATFYLMELVDGVAVGTVDQASALTPDERRRLGFSLADTLAALHDIDPGTVGLGSFGRPDGYLERQLGRWAKQWEASRRVDRPEVAVLLDKLRRALPQTRHPGIVHGDVKLDNVLAAPQDRGRIAAVLDWEMATLGDTLADIGIMLSFWDVPGATPNPITRGLATLDGFPTRAELLERYAGARGIDLADVDWYIVFADFKIAVILEGIGARHDRGETVGEGFDGIADMVGPLLRRALDLAATSALPALRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024315_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024315_5

4035833-4035914

Orphan

Consensus_repeat	Method
ACGCGCGCAACTCGCACCGACGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024315_5

>merge|NZ_CP024315|5|4035833-4035914|CRISPRCasFinder
ACGCGCGCAACTCGCACCGACGCGCGCAACTTGCCCCTGACGCGCGCCACGTGCGTCCGACGCGCGCAACTTGCACCGACGC

>NZ_CP024315|5|5|4035833-4035914|CRISPRCasFinder
ACGCGCGCAACTCGCACCGACGC	GCGCAACTTGCCCCTGACGCGCGCCACGTGCGTCCG
ACGCGCGCAACTTGCACCGACGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024315.1\|WP_029540072.1\|4035286_4035514_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226181
NZ_CP024315.1\|WP_010594914.1\|4033369_4034584_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|308008
NZ_CP024315.1\|WP_099528126.1\|4036758_4038693_+\|two-component-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP024315.1\|WP_017681499.1\|4028255_4029737_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP024315.1\|WP_010594922.1\|4043003_4044038_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP024315.1\|WP_010594910.1\|4029733_4031680_+\|primary-amine-oxidase	unknown	unknown	gnl\|CDD\|236919
NZ_CP024315.1\|WP_010594926.1\|4047375_4048134_-\|Rv3717-family-N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
NZ_CP024315.1\|WP_010594924.1\|4045374_4046808_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP024315.1\|WP_010594923.1\|4044076_4045378_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|367049
NZ_CP024315.1\|WP_010594919.1\|4038677_4039340_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP024315.1\|WP_010594920.1\|4039489_4040704_+\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|236197
NZ_CP024315.1\|WP_010594906.1\|4024677_4026099_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP024315.1\|WP_010594915.1\|4034669_4035287_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010594925.1\|4046944_4047379_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP024315.1\|WP_099528216.1\|4023925_4024681_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP024315.1\|WP_010594911.1\|4031685_4032138_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010594917.1\|4036027_4036714_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024315.1\|WP_010594921.1\|4040732_4042883_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236864
NZ_CP024315.1\|WP_010594907.1\|4026545_4028051_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143410
NZ_CP024315.1\|WP_010594913.1\|4032683_4033370_+\|cutinase-family-protein	unknown	unknown	gnl\|CDD\|369775

Protein	Function_ID	Function_description	E-value
NZ_CP024315.1\|WP_029540072.1\|4035286_4035514_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|226181	COG3655, COG3655, Predicted transcriptional regulator [Transcription].	1.15517e-19
NZ_CP024315.1\|WP_010594914.1\|4033369_4034584_+\|site-2-protease-family-protein	gnl\|CDD\|308008	pfam02163, Peptidase_M50, Peptidase family M50.	3.15403e-44
NZ_CP024315.1\|WP_099528126.1\|4036758_4038693_+\|two-component-sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	7.81972e-36
NZ_CP024315.1\|WP_017681499.1\|4028255_4029737_+\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	7.66712e-34
NZ_CP024315.1\|WP_010594922.1\|4043003_4044038_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	0.00486681
NZ_CP024315.1\|WP_010594910.1\|4029733_4031680_+\|primary-amine-oxidase	gnl\|CDD\|236919	PRK11504, tynA, primary-amine oxidase.	0
NZ_CP024315.1\|WP_010594926.1\|4047375_4048134_-\|Rv3717-family-N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	2.34425e-42
NZ_CP024315.1\|WP_010594924.1\|4045374_4046808_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	5.28509e-37
NZ_CP024315.1\|WP_010594919.1\|4038677_4039340_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	7.68119e-59
NZ_CP024315.1\|WP_010594907.1\|4026545_4028051_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143410	cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins. ALDH subfamily which includes the NAD+-dependent retinal dehydrogenase 1 (RALDH 1, ALDH1, EC=1.2.1.36), also known as aldehyde dehydrogenase family 1 member A1 (ALDH1A1), in humans, a homotetrameric, cytosolic enzyme that catalyzes the oxidation of retinaldehyde to retinoic acid. Human ALDH1B1 and ALDH2 are also in this cluster; both are mitochrondrial homotetramers which play important roles in acetaldehyde oxidation; ALDH1B1 in response to UV light exposure and ALDH2 during ethanol metabolism. 10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1), in humans, a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the conversion of 10-formyltetrahydrofolate to tetrahydrofolate and CO2. Also included in this subfamily is the Arabidosis aldehyde dehydrogenase family 2 members B4 and B7 (EC=1.2.1.3), which are mitochondrial, homotetramers that oxidize acetaldehyde and glycolaldehyde, as well as, the Arabidosis cytosolic, homotetramer ALDH2C4 (EC=1.2.1.3), an enzyme involved in the oxidation of sinapalehyde and coniferaldehyde. Also included is the AldA aldehyde dehydrogenase of Aspergillus nidulans (locus AN0554), the aldehyde dehydrogenase 2 (YMR170c, ALD5, EC=1.2.1.5) of Saccharomyces cerevisiae, and other similar sequences.	0
NZ_CP024315.1\|WP_010594906.1\|4024677_4026099_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	4.72121e-34
NZ_CP024315.1\|WP_010594925.1\|4046944_4047379_+\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	4.84631e-06
NZ_CP024315.1\|WP_099528216.1\|4023925_4024681_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.67503e-31
NZ_CP024315.1\|WP_010594923.1\|4044076_4045378_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|367049	pfam02353, CMAS, Mycolic acid cyclopropane synthetase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyze the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <=> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.	3.70445e-122
NZ_CP024315.1\|WP_010594921.1\|4040732_4042883_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236864	PRK11154, fadJ, fatty acid oxidation complex subunit alpha FadJ.	7.55889e-137
NZ_CP024315.1\|WP_010594920.1\|4039489_4040704_+\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|236197	PRK08242, PRK08242, acetyl-CoA C-acetyltransferase.	0
NZ_CP024315.1\|WP_010594913.1\|4032683_4033370_+\|cutinase-family-protein	gnl\|CDD\|369775	pfam08237, PE-PPE, PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.	0.00312549

>NZ_CP024315.1|WP_029540072.1|4035286_4035514_+|helix-turn-helix-transcriptional-regulator
MPPESEHAVHCRLDDLLAERGMTLATLSERVGVSVANLSVLKNDRARAIRFSTLTAICHVLGCTVGDLLTVQPPR
>NZ_CP024315.1|WP_010594915.1|4034669_4035287_+|hypothetical-protein
MSVLRPTAKDRRDLWASMAVFAGTAAVVVADYVATLSGQLSAATVTARMELGEAATPVPTPSGVQASLDGAVTTSLPVAELSPVTVALLRTGDAAQTLSYLAVLGLLALLVRRFVQGRMFDHGTYRLTYHLGWVALTIALVPMFPRITGTNMAIRDLGLTHVPGVEGSWLGAEFWLVYAGAMVLSAVAIAIRVGNRMARDQEGLV
>NZ_CP024315.1|WP_010594914.1|4033369_4034584_+|site-2-protease-family-protein
MFALGVALFALALAVSVALHEAGHLWVARRLGMKVRRFAVGRGPTVFSFRRGETEYGLGLFPVGGFCEIAGTTALDELAPGEYDRALYRQRTWKRVAVMSGGVCMNFLLAVVLVLGLAVGWGLPDLHPRIVVESVGCVPPSQGPAPGYGLVGCDGPGPAASAGIRPGDVVLAVDGRDVARFGDLVERVWQSSGVVELVIDRQGRELRVPVAVEPVQRWVVDPRSGVERSTTVGAIGLSAQPVAGPVRYGLVAAVPAAFAFTGDLVVASARTLASAPSKVASLWHSVTGGERDADTPVSVVGAASLGGQAAERGMWESFVLLMVGLNLFVGLVNLLPLLPLDGGHAAVAVYEACRNRVRRLRGLSDAGPVDFGKLLPVTYAFVVAGGAFTVLTVVADVVAPIRLA
>NZ_CP024315.1|WP_010594913.1|4032683_4033370_+|cutinase-family-protein
MILSAVRVAIVGALTIGSMFGAVSIAHADPSPAAYCAPTVVLAVDGTKGPETPDSIDPDSPLNSYTDQYRDSSDFAVRHVRYPAGMVAGVFGWDTFMDQSVQIGVQNLWAEIGRTEAACGPRTRYELYGYSQGAIVVRRVAMEIDAVPPVHDDGTDLQDRVRVHLIADPAQGRPAQYAGPLVPGITLPQPAGELRHIPVTTECLEGDMICDPEGNVSGYIREHATYHP
>NZ_CP024315.1|WP_010594911.1|4031685_4032138_+|hypothetical-protein
MSTTDPAARRTTFPWCGRAAAALAVASAVLHVGALGGHAPSPAPAVLTLVMTAGCLYCARHLWRRGNQRDWILVTVMNVVMIMLHLTTMSPGGGGGGHHGHAVPVVAGGTADASMPPLMAAALAVAAAEILLAVSVVFHRTRGLDPAIAG
>NZ_CP024315.1|WP_010594910.1|4029733_4031680_+|primary-amine-oxidase
MSTATTPFTEAASTPAPDHPLSPLTADEITAVKETVSAAGLVTEHVRFVYVGLEEPPKSTVLAFRPGEHVERRARVLLLDRATGAGSDHVVSVTERRILGTVAVDAATDGHVPILDEEFEDIESFLLSSFDWIAAMAARGIDPQKVRAVPLSAGVFGHEDEVGHRIVRVLAFHQEDEADLPWAHPIDGVVAYVDLTEQRVVKVVDEITLPVPAERGEWDAAPHETPVRTDLKPIEITQPEGPSFSVDGNRITWADWTFRFGFDVREGLTLHQLSFSDDGVERPVIYRASIAEMVVPYADPSPVRYWQNYFDQGEYLFGRYTNSLELGCDCLGEIQYFDVTIADEKGDPRVMKNAICLHEEDYGVLWKHTDMFNGMTETRRSRRLVISFFLTIGNYDYGFYWYLYLDGTIELEAKATGIVFTSAYRGEDGFATEMAPGLGAPFHQHLFSARLDMAVDGNVNTVEEVDAVPEPMGPDNPWGNAFRCRKTTLTTEAEGQRLADNTKARVWHITNPTKQNRLGRNVGYALHPEGQPVLLADPSSSIAARAAFATRHLWVTQYDPAQRYPAGDFVNQHPGQGGLPTFVAGNRNIEGEDLVLWHTFGLTHFPRPEDWPVMPVDYAGFTLKPVGFFDRNPALDVPAGPSKHCCTD
>NZ_CP024315.1|WP_017681499.1|4028255_4029737_+|APC-family-permease
MTLNARAHEPPTHRLSGSLGPGAVVFMVVAAAAPLTVIAGTVPLGISAGNGAAFPASYVVCTVVLLFFAVGFTAMAKHVPGAGAFYTFVTHGLGRHAGLGSAFLALLSYTAVQGAVYGYIGAALDDFVTAHGGPELPWYLWALIVLVAVAVLGYRHIDLSGKVLGVLLLCEVGIVLVIDAAVVVRGGAEGLSTAALRPSEFFSGAPGIALIFAVAGYIGFEATAVFRDEVRDPARTVPRATYLALVVIGGFYALSSWALVSAWGDEGAVALATENPEGMIVDTATRYVGAAAGDVVQVLLVTSLFAALLSFHNVLSRYIFSLGNSAALPARCGRSHERHASPYVASVVQTVSALVLVVASAVGGLDPVTEVFAWFAGVASVGVLALMALTSIAVLVFFRRSRADTRPWPTLIAPALGLAGLGALLTMTIANLPLLVGGSSTLAAVIAVVLAGTFAGGAAVAALRPDAARNTHPHGGLAPAVTTEPQIDKEIAR
>NZ_CP024315.1|WP_010594907.1|4026545_4028051_+|aldehyde-dehydrogenase-family-protein
MTAVAQSATALLPEVAEFLSSPKQMLIGGRWVESASGRRFDTVDPATGQVLTTVPHGSAEDVDRAVAAARRAFEEGPWRRLTPAERQRVLWRIGEGILARADQFAQLESLDNGKSVVVAKAVDVTWAAEIFFYYAGWATKIEGRTVPVSVPWAPGARFHAFTSREPVGVCAQIVPWNFPLVMAAFKLAPALACANTLVLKPAEQTPLTALLLAEVATEAGVPDGVVNVVTGFGDAGAALSAHDDVDKVAFTGSTEVGKKIVSAAAGNLKKVSLELGGKSPQVVFSDADLEAAIPGVASGFLFNHGQACTAGTRLLVEDRIFDEFTQGVAEFAKSQKIGPGLDPTSDIGPLISAEQLGKVTGYIDAGLEDGARALSGGKRHGDSGFYVEPTLLVDVRSDFGVYREEIFGPVAVAVPFNREEGVRAAANDTPYGLAASVWTRDVSRAHEVAAEIKAGTVWINCHNAFDTALPFGGYKQSGWGRELGEGALAEYTQTKSVNIAL
>NZ_CP024315.1|WP_010594906.1|4024677_4026099_-|APC-family-permease
MAGLERGRLTFVEVLAQSVSAVAPSAVMVTLPALVIPEAGRAAIPVFVTAAVLMAAVGYCIGQFAARMVAVSGLYSYTVKGLGPRVGFAGGWSLLIGYAAAAMASTVGAASYLASLLERVGLSAGAPTSAVLAGIVGVVALLLMVRGVQLSARIMLGVEAFAIVAASAVLVIAFVVAVRDGASPSAPSGTGSDSAIGFALLLAITSFVGFESAGTVAREAHNPLISVPRAIRWTPIVLAALYVFAAAMQSPESAREGVGSLRIVLTLPDTAGSGSAVLAVVMELGITASWFACVMGSTTALSRTLFAMGREGIAPAIVGRAHARFRTPHVALIVAMPVVVVVPVVFLIATGSTRDVLIGLLTLSAHGYVLAYILVCVATPAFLHRIGELTRMPLIVGALTAACLVALIVWAAASRLYVAGAMTAVYAVLMLLGGALLAVRVRRDPGVADRIGVYDETVADDLLGRHRPWQVRR
>NZ_CP024315.1|WP_099528216.1|4023925_4024681_-|helix-turn-helix-domain-containing-protein
MSPVDGTLSGRQPKAVISALRVLEEVARAGPGVTAKDIAAHLSLPPATTYRLLNLLAGEGYVVRLPDLSGFALGRKIGVLVDAAVVPTVCTAARTLLTELRLTVRFGVHLYYYTDTTLRLADADPEYPPRTDEAVLTRYLHASAVGKLLLAEKNDLDAVLPRWDLRALTGRTIVVRSDLLRHLAEIRDRGFATQLGELRDDCACLAVPVRSAAGTLVAGLVLSGSIDHQHLLTRHLESLREHARQLAPLLT
>NZ_CP024315.1|WP_010594917.1|4036027_4036714_+|hypothetical-protein
MSTASVTEDSRTGARRASSSAWAWAGAVAGLAGVVAIQASMGMGAAYDESTAGNASAIADAFAGERTELLVMHLSLMVSTVLLLIFAAGLQRRLRIALPDDSLLPAVAAFGLLLTATACLLGAGLDTELLFGLSEPGQMVAEVAVVGSHWVGTIPWLWVGAGVSGLAVAAASLRHGATPQWLGWASVVLGGLTALLGISPLQYMAGFVGPVWVLVAGVGFAVSDRARR
>NZ_CP024315.1|WP_099528126.1|4036758_4038693_+|two-component-sensor-histidine-kinase
MAVADASETAAGTGGAPGPAAVVAVLSCGLAVAALAVFAAARPDLDSDQLFFLVDVVGAAVYGTVAGVVLARRVHPVPLLLSLASIGVGLSALSYAWTKLAQVRPGLPFAGVLAPLQSTTWIPGTLALFLVVPWLVRDTPLDRRARLGVLTGAAVTGWFFWARTFTGTAVGWLVLPVVTVGLLAAADVTYRWRRGPVSDRIGLGWLALGTALMAVSYIPLAVPGLPWMLTPLLHLTTQAFYPIAILVVVLRQRLWGLDLAVSRAAVAGSLVAVLATGYLVVTATVALILPTDGSVVAQAVAAVAVALAVQPVRAWLTRRVHILVYGEGDDPASAVRRLGRHFAGAQTPRQLLEDLAAGIGVALRLESVTVRRGDEVLARWGTPTGPAEEVVLRDGRVAVTAPPGETLGPRSLRALGELASVVEAGLVVLRSSEELDAARARLTEARLAERRTIRRELHDGLGPSLAGIRLGLQGARNLVDTDSADAVPLIDSLLRELDHQVEGVRELSRGLLPPALDELGLAAALEEMSAVHSRSGFRVEVDADVPSGRSGPVVAAAYGIAAEAVTNARRHSGADGCRVRVRASADRLTLEVRDAGRGMDRNARRGVGTHSMRERAEDVGGSVAITGAQPHGTVVTAHLPWGPS
>NZ_CP024315.1|WP_010594919.1|4038677_4039340_+|response-regulator-transcription-factor
MGTVVSAPTAIAVAVVDDHPVFRLGLVALLGTLDGIEVVAQASSVAEALEVITADVDVVLMDLELGDGSGIEATRLLLGRFPELRVLVVTMHEDEDSLVASVRAGARGYLVKGADPSGVERAIRAVADGEVIVGAAVAAKAIGAMAASRTLAPTVFPELTDREREVLDLMARGHDNATIARRLVLSPKTVRNHVSNVLGKLGAADRSTAIVQAREAGLGV
>NZ_CP024315.1|WP_010594920.1|4039489_4040704_+|acetyl-CoA-C-acetyltransferase
MTSEAFIYEAIRTPRGRGKKTGSLHSVKPISLVTGLIDELRVRFPDLDENRISDLILGVVGPVGDQGADIARTAVTAARMPDTVGGVQINRFCASGLEAVNMAAQKVRSGWDELVVAGGVESMSRVPMGSDGGPWALDPATNYDTYFVPQGVSADLIATMEGFSREDVDAYALRSQQLAAAAWSGGYFAKSVVPVKDQNGLTVLDHDEHMRPDTTLAGLAGLQPSFAMVGEMGGFDAVALQKFHFVEKIDHVHHGGNSSGIVDGAALVLVGSEQAGKDMGLTPRARIVATATSGADSTIMLTGPTPAAHKVLAAAGLTVDDIDLFEINEAFASVVLKFQKDLKIPDEKLNVNGGAIAMGHPLGATGAMIMGTMVDELERRGARRALVTLCIGGGMGVATIIERV
>NZ_CP024315.1|WP_010594921.1|4040732_4042883_+|enoyl-CoA-hydratase/isomerase-family-protein
MTENNMIGWERDADGIVVLTLDDPNQGANTMNELYKASMKATVDRLVAEKDDITGAVITSAKKTFFAGGDLKNMIKVGPEDAQRIFDEVEAIKADLRRLETLGKPVVAAINGAALGGGLEIALATHHRIAADVKGVQIGLPEATLGLLPGGGGVTRTVRMLGLQTALMQVLLQGQRYNPAKAKEIGLIDEIVGSIDELVPAAKAWIKANPEGGVQPWDKKGFKIPGGTPASPAFAANLPAFPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNASKIEGRYFTELVTGQVAKNMIQAFFFDMQAINSGASRPNQADGTPFPKTTFRKVAVLGAGMMGAGIAYVCAKAGMDVILKDVSIESAQKGKAYSEGIEAKALSRGKTTEEKSAALLARITPSADVADLAGADLVIEAVFENTELKHKVFQEIQDVVAPDAVLGSNTSTLPITGLAEGVTRQEDFIGLHFFSPVDKMPLLEIIAGEKTSDATLAKAFDLAQQIRKTPIVVNDSRGFFTSRVIGTFVNEAIRMVGEGIEPATIEQAGSQAGYPAPPLQLSDELNLTLMQKIRKETEAATEASGLKVPQDDSSTVVDFLVDEARPGRAGGGGFYEYVDGKRSRIWPGLREKFDSAPTDIPIQDLIERMLFIEAIETQKCFDEGVLRTTADANIGSILGIGFPAWTGGVAQYIAGYPGGKEGFVKRAEELAAKYGERFTPPASLR
>NZ_CP024315.1|WP_010594922.1|4043003_4044038_+|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein
MGDFGKSDVQKLFDDRAGLVTQTELTDLGVGRGTVRHLLDTGRWQRVLQGVYAVSSGPLTRTMVLEAALLYGGGAAMLSHRTAAELWGMLPVDDTAPVHVTVPVGKSALPQRATMRAPGRKATLPVSKPDAVLHPGVIVHRSRAHAHIGVDRYLARTTKVDTALDLATAQPSPREAYLSLISTVTNAGIRLHTVRRRLEERPPYRYRTALDEAVTLLAEGVQSVLEYHYAIDVERAHALPVADRQSPVVVDGRTLYEDCTYDGAGCPLTVRLDGRWVHSMREVAFRDRRRDNAAELAGRSRLVFGYREVASSPCDVAREVETVLTRLGWVRDEPNPCSCRARFW
>NZ_CP024315.1|WP_010594923.1|4044076_4045378_-|class-I-SAM-dependent-methyltransferase
MTTLREPGIPDGRLTLAQILETVTGGELPVRFTAYDGSSAGPADAPYGLRLTSTRGTTYLATAPGDLGMARAYVSGDLEAEGVHPGNPYELLKALGDLHFQRPPALTLAQIARSLGLETLKPIAPPPQEHLPRWRRFAEGLRHSRSRDAEVIHHHYDVSNAFYEHVLGPSMTYTCALFDSEAQSLEDAQENKYRLVFEKLRLQPGDRLLDIGCGWGGMVRYAARRGVKALGVTLSREQAEWAQKAIADEGLTDLAEVRFSDYRDVPETGFDAISSIGLTEHIGVQNYPTYFRRLHDKLREGGLLLNHCITRPVNRGPVKAGGFIDRYVFPDGELTGSGRIITEIQDIGLEVLHEENLRQHYALTLKGWCENLVANWDACVAEVGEGTARVWGLYMAGSRLGFERNVVQLHHVLAVKLGPDQEPNVPLRPWWVA
>NZ_CP024315.1|WP_010594924.1|4045374_4046808_-|FAD-binding-oxidoreductase
MQKPKSVVVPSGESAHRAGVERLLRSYRAIPADAPVRLAKKTSNLFRARARVNAPGLDVSGLGGVVSVDPVARTADVAGMCTYEDLVDATLPHGLAPLVVPQLKTITLGGAVTGLGIESTSFRNGLPHESVLEMDILTGAGEIVTATPDGEHADLFHGFPNSYGTLGYATRLRIELEPVKPYVALRHLRFDSLDEMQSALDRIATERVHAGVPVDYLDGVMFSAAESYLTLGTQTDAPGPVSDYTGENIYYRSIQHASVNHPRTDRLTVRDYLWRWDTDWFWCSRAFGAQDPRIRRLWPKRLLRSSFYWKLIALDHRYGVADRIERRKGNLPRERVVQDIEVPIERTAEFLRWFLDEIPIEPVWLCPLRLREGGPVARDAQRPWPLYPLEPKRTYVNVGFWSSVPAVAGEIEGAANRRIEHKVAELDGHKSLYSDSYYTRAEFEELYYGGGDYPALKKRYDPESRLLDLFSKAVHNR
>NZ_CP024315.1|WP_010594925.1|4046944_4047379_+|SRPBCC-family-protein
MGQVSASSSIQLAAAPERVLEALADYESVRPRILPEQYRDYRVLSGGRGDGTVVHWILQATKKRARDVEARVAVSGSTITERDANSSLVTTWSVVPNGTGSTVVTLTEWKGAGGIGGFFEKTFAPLGLRKIQEQVLANLKRELD
>NZ_CP024315.1|WP_010594926.1|4047375_4048134_-|Rv3717-family-N-acetylmuramoyl-L-alanine-amidase
MRVRGLSRRITVAATCVLALSLPGVPATATPDLPLTGRTVFLDPGHNGTNDASITAQVPTGRGGTKNCQTTGTSTDSGYTEHTFNWDVAMLVRAELEELGAHVLLSRPDDASVAACVDRRAEEANASGADVVVSLHADGGPADGRGFHVNYSAPPLDEVQAGPSVALAVAVRDALVDAGLTPSTYLGTDGLLGRDDLAGLNLARRPSVLVELGNMRNATDAATMTDPDGRQRYATAVVAGIVAFAGDPADAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK450425	Mycobacterium phage Shelob, complete genome	12927-12956	6	0.8
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH744422	Mycobacterium phage Roots515, complete genome	12357-12386	6	0.8
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK450434	Mycobacterium phage DrPhinkDaddy, complete genome	12243-12272	6	0.8
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK450423	Mycobacterium phage Stubby, complete genome	11301-11330	6	0.8
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	49910-49939	6	0.8
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	KU998243	Gordonia phage Kvothe, complete genome	50586-50615	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH155873	Microbacterium phage Paschalis, complete genome	4247-4276	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MN062719	Microbacterium phage PiperSansNom, complete genome	4551-4580	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MN444877	Microbacterium phage Antares, complete genome	4450-4479	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1053707-1053736	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	759420-759449	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	198687-198716	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH590593	Mycobacterium phage Rabinovish, complete genome	12496-12525	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359337	Mycobacterium phage Flabslab, complete genome	11967-11996	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359364	Mycobacterium phage ChickenPhender, complete genome	10953-10982	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359333	Mycobacterium phage JustHall, complete genome	11934-11963	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MN428065	Mycobacterium phage Cactojaque, complete genome	10831-10860	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359366	Mycobacterium phage Basquiat, complete genome	10908-10937	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MT889395	Mycobacterium phage Shifa, complete genome	11994-12023	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MT723944	Mycobacterium phage ChaylaJr, complete genome	10995-11024	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359336	Mycobacterium phage Chargie21, complete genome	10908-10937	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MN276192	Mycobacterium phage Trinitium, complete genome	10939-10968	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK359344	Mycobacterium phage Napoleon13, complete genome	10904-10933	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_011270	Mycobacterium phage Spud, complete genome	12880-12909	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	EU826469	Mycobacterium phage ScottMcG, complete genome	12341-12370	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK310143	Mycobacterium phage Dietrick, complete genome	10681-10710	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH051266	Mycobacterium phage MikeLiesIn, complete genome	12578-12607	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK878897	Mycobacterium phage Blackbrain, complete genome	10724-10753	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_028869	Mycobacterium phage HyRo, complete genome	12548-12577	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	KT365400	Mycobacterium phage ErnieJ, complete genome	11854-11883	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	NC_028986	Mycobacterium phage Alice, complete sequence	10574-10603	7	0.767
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MK450424	Mycobacterium phage Melpomini, complete genome	10891-10920	7	0.767
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	41927-41957	8	0.742
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	MT522001	Microbacterium phage Karate, complete genome	41572-41602	8	0.742
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	NC_005262	Burkholderia cepacia phage Bcep22, complete genome	54330-54360	8	0.742
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MN871481	UNVERIFIED: Pseudomonas phage PaSz-1_45_92k, complete genome	37963-37992	8	0.733
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH791408	UNVERIFIED: Pseudomonas aeruginosa hage PaZq-1, complete genome	21071-21100	8	0.733
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	KU761955	Pseudomonas phage phiMK, complete genome	58513-58542	8	0.733
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	MH791416	UNVERIFIED: Pseudomonas phage PaSzW-1, complete genome	87456-87485	8	0.733
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	KC862297	Pseudomonas phage PAK_P1, complete genome	8751-8780	8	0.733
NZ_CP024315_2	2.1\|2269751\|30\|NZ_CP024315\|CRISPRCasFinder	2269751-2269780	30	JQ067088	UNVERIFIED: Pseudomonas phage PaMx12, partial genome	28161-28190	8	0.733
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	NC_019917	Burkholderia phage BcepMigl, complete genome	53620-53650	9	0.71
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	FJ937737	Burkholderia cenocepacia phage BcepIL02, complete genome	53288-53318	9	0.71
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	NC_012743	Burkholderia phage BcepIL02, complete genome	53288-53318	9	0.71
NZ_CP024315_1	1.1\|1178270\|31\|NZ_CP024315\|CRISPRCasFinder	1178270-1178300	31	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	210364-210394	9	0.71

1. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK450425 (Mycobacterium phage Shelob, complete genome) position: , mismatch: 6, identity: 0.8

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccaccaccgcccagaccaccaccgagc	Protospacer
**.  ******* ******* ********

2. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 6, identity: 0.8

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccaccaccgcccagaccaccaccgagc	Protospacer
**.  ******* ******* ********

3. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK450434 (Mycobacterium phage DrPhinkDaddy, complete genome) position: , mismatch: 6, identity: 0.8

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccaccaccgcccagaccaccaccgagc	Protospacer
**.  ******* ******* ********

4. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 6, identity: 0.8

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccaccaccgcccagaccaccaccgagc	Protospacer
**.  ******* ******* ********

5. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccgcgaccaccgtccagaccccccaggcgg	Protospacer
*** ******** **********   * **

6. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to KU998243 (Gordonia phage Kvothe, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
tcgagaccaccggcttgacccccaccttcc	Protospacer
.*************. **********

7. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH155873 (Microbacterium phage Paschalis, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
accccgccaccggccagaccaccaccgacg	Protospacer
 *   .************** ******* *

8. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MN062719 (Microbacterium phage PiperSansNom, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
accccgccaccggccagaccaccaccgacg	Protospacer
 *   .************** ******* *

9. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MN444877 (Microbacterium phage Antares, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
accccgccaccggccagaccaccaccgacg	Protospacer
 *   .************** ******* *

10. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cggagaccaccggccaggcccccggctcgc	Protospacer
* ***************.*****. *  *

11. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cggagaccaccggccaggcccccggctcgc	Protospacer
* ***************.*****. *  *

12. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
tcgtgaccaccggcctgacccccagcccgc	Protospacer
.** *********** ******** *  *

13. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

14. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

15. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

16. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

17. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

18. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

19. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

20. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

21. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

22. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

23. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK359344 (Mycobacterium phage Napoleon13, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

24. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

25. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

26. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

27. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH051266 (Mycobacterium phage MikeLiesIn, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

28. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

29. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

30. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

31. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

32. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 7, identity: 0.767

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
ccaccgccaccgcccagaccaccaccgagc	Protospacer
**.  .****** ******* ********

33. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.742

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
ggcgcgcgccacgtcgtccaggcgcaccgac	Protospacer
****************** ***.   *.  *

34. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to MT522001 (Microbacterium phage Karate, complete genome) position: , mismatch: 8, identity: 0.742

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
gacgcgcgccacgtcgtcaatggcgttcttg	Protospacer
*.****************** * ***....

35. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to NC_005262 (Burkholderia cepacia phage Bcep22, complete genome) position: , mismatch: 8, identity: 0.742

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
gaggcgcgccacgtcgtcgaggtcgagcacg	Protospacer
*. ***************.******  . *

36. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MN871481 (UNVERIFIED: Pseudomonas phage PaSz-1_45_92k, complete genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

37. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH791408 (UNVERIFIED: Pseudomonas aeruginosa hage PaZq-1, complete genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

38. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to KU761955 (Pseudomonas phage phiMK, complete genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

39. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to MH791416 (UNVERIFIED: Pseudomonas phage PaSzW-1, complete genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

40. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to KC862297 (Pseudomonas phage PAK_P1, complete genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

41. spacer 2.1|2269751|30|NZ_CP024315|CRISPRCasFinder matches to JQ067088 (UNVERIFIED: Pseudomonas phage PaMx12, partial genome) position: , mismatch: 8, identity: 0.733

ccgagaccaccggccagacccccaccgagg	CRISPR spacer
cattcaccaccggccatagccccaccgaat	Protospacer
*    *********** * *********.

42. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to NC_019917 (Burkholderia phage BcepMigl, complete genome) position: , mismatch: 9, identity: 0.71

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
caggcgcgccacgtcgtcgaggtcgagcacg	Protospacer
 . ***************.******  . *

43. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to FJ937737 (Burkholderia cenocepacia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.71

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
caggcgcgccacgtcgtcgaggtcgagcacg	Protospacer
 . ***************.******  . *

44. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to NC_012743 (Burkholderia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.71

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
caggcgcgccacgtcgtcgaggtcgagcacg	Protospacer
 . ***************.******  . *

45. spacer 1.1|1178270|31|NZ_CP024315|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ggcgcgcgccacgtcgtcaaggtcgtctccc	CRISPR spacer
atggcgcgccaagtggtcaaggtcgtggtca	Protospacer
.  ******** ** ***********  .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

664224 : 672408

Mycobacterium_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010595079.1\|664224_665022_+	Fe-S cluster assembly ATPase SufC	W8CYL7	Bacillus_phage	3.2e-07	27.7
WP_010595078.1\|665036_666290_+	cysteine desulfurase	Q2XUY6	environmental_halophage	4.3e-99	45.4
WP_010595077.1\|666289_666778_+	SUF system NifU family Fe-S cluster assembly protein	A0A0K1LSF9	Mycobacterium_phage	2.4e-21	44.4
WP_010595076.1\|666777_667158_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_048773575.1\|667274_667667_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010595074.1\|667711_668686_-	Ku protein	A0A249XRB2	Mycobacterium_phage	2.3e-52	43.2
WP_010595073.1\|668738_669863_-	lycopene cyclase family protein	NA	NA	NA	NA
WP_010595072.1\|669866_670673_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	2.9e-08	33.9
WP_010595071.1\|670779_672408_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.5e-38	27.5

DBSCAN-SWA_2

3644361 : 3705549

Mycobacterium_phage(66.67%)

integrase,transposase

attL 3643167:3643187|attR 3694175:3694195

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3643167:3643187	attL	NA	NA	NA	NA
WP_099528084.1\|3644361_3645609_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_043805981.1\|3646693_3648802_+\|transposase	Mu transposase C-terminal domain-containing protein	NA	NA	NA	NA
WP_010596658.1\|3648798_3649827_+	AAA family ATPase	NA	NA	NA	NA
WP_010596657.1\|3649823_3650804_+	TniQ family protein	NA	NA	NA	NA
WP_043805980.1\|3650950_3652078_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010596655.1\|3652083_3653097_+	hypothetical protein	NA	NA	NA	NA
WP_157180029.1\|3653409_3654303_+	hypothetical protein	NA	NA	NA	NA
WP_010596654.1\|3654315_3655146_+	hypothetical protein	NA	NA	NA	NA
WP_157180028.1\|3655608_3655917_+	hypothetical protein	NA	NA	NA	NA
WP_099528102.1\|3657107_3657977_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_010596652.1\|3658135_3660496_-	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_010596651.1\|3660492_3661137_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010596650.1\|3661235_3661547_-	WhiB family transcriptional regulator	A0A222ZML0	Mycobacterium_phage	1.2e-05	41.2
WP_010596649.1\|3661899_3663132_-	DUF3500 domain-containing protein	NA	NA	NA	NA
WP_157180025.1\|3663687_3665130_+	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_157180024.1\|3665029_3665374_+	hypothetical protein	NA	NA	NA	NA
WP_010596645.1\|3665835_3666306_-	MaoC family dehydratase	NA	NA	NA	NA
WP_010596644.1\|3666305_3667043_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_029540240.1\|3667123_3668770_-	AMP-binding protein	NA	NA	NA	NA
WP_010596642.1\|3668766_3669636_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_010596641.1\|3669993_3671136_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_099528104.1\|3671258_3671930_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010596639.1\|3672046_3672559_-	hypothetical protein	NA	NA	NA	NA
WP_010596638.1\|3673022_3674240_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_029540238.1\|3674236_3675070_-	ABC transporter permease	NA	NA	NA	NA
WP_162294068.1\|3675609_3676650_+	alcohol dehydrogenase catalytic domain-containing protein	E3SJ82	Synechococcus_phage	3.1e-18	25.4
WP_010596634.1\|3676793_3677543_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_099528106.1\|3677724_3678549_-	cupin domain-containing protein	NA	NA	NA	NA
WP_099528107.1\|3678667_3680254_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_010596630.1\|3680333_3681290_-	oxidoreductase	NA	NA	NA	NA
WP_029540235.1\|3681340_3682531_-	cytochrome P450	NA	NA	NA	NA
WP_099528108.1\|3682978_3684691_+	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_051009419.1\|3685079_3686153_+	cytochrome P450	NA	NA	NA	NA
WP_099528210.1\|3686539_3687508_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010596625.1\|3687820_3688789_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010596624.1\|3689125_3690868_+	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_010596623.1\|3691148_3692342_+	cytochrome P450	NA	NA	NA	NA
WP_010596622.1\|3692632_3693430_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_010596621.1\|3693626_3695255_+	long-chain-fatty-acid--CoA ligase	NA	NA	NA	NA
3694175:3694195	attR	NA	NA	NA	NA
WP_157768885.1\|3695627_3696404_-	hypothetical protein	NA	NA	NA	NA
WP_157768886.1\|3696568_3697729_-	hypothetical protein	NA	NA	NA	NA
WP_010596618.1\|3697756_3699070_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	2.6e-200	79.5
WP_010596617.1\|3699453_3699891_-	hypothetical protein	NA	NA	NA	NA
WP_157180022.1\|3700006_3700831_-	hypothetical protein	NA	NA	NA	NA
WP_010596615.1\|3700863_3701112_-	hypothetical protein	NA	NA	NA	NA
WP_010596614.1\|3701617_3703168_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_099528110.1\|3703980_3705549_+\|transposase	IS1634 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

4137088 : 4205353

Tupanvirus(18.75%)

protease,tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010595016.1\|4137088_4138279_+\|protease	MarP family serine protease	NA	NA	NA	NA
WP_010595017.1\|4138291_4139236_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003935267.1\|4139244_4139745_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_010595018.1\|4139741_4140959_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	5.7e-56	38.7
WP_010595019.1\|4141154_4142528_+	MHS family MFS transporter	NA	NA	NA	NA
WP_010595020.1\|4142598_4144536_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.1e-75	36.9
WP_010595021.1\|4144739_4145492_+	hypothetical protein	NA	NA	NA	NA
WP_010595022.1\|4145919_4146762_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_017681222.1\|4147106_4148180_+	CpaE-like family protein	NA	NA	NA	NA
WP_010595025.1\|4148176_4149349_+	TadA family conjugal transfer-associated ATPase	NA	NA	NA	NA
WP_010595026.1\|4149345_4150146_+	type II secretion system F family protein	NA	NA	NA	NA
WP_010595027.1\|4150109_4150742_+	type II secretion system F family protein	NA	NA	NA	NA
WP_026137874.1\|4150784_4150988_+	DUF4244 domain-containing protein	NA	NA	NA	NA
WP_017681224.1\|4151005_4151320_+	pilus biosynthesis protein TadE	NA	NA	NA	NA
WP_010595030.1\|4151316_4151661_+	flp pilus-assembly TadE/G-like family protein	NA	NA	NA	NA
WP_010595031.1\|4151668_4154014_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	2.9e-08	28.2
WP_003935252.1\|4154406_4154610_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	5.2e-15	57.8
WP_017681225.1\|4154739_4155327_+	hypothetical protein	NA	NA	NA	NA
WP_010595034.1\|4155461_4158392_+	type I DNA topoisomerase	J3E777	Acanthamoeba_polyphaga_lentillevirus	2.9e-98	34.1
WP_010595035.1\|4158423_4159098_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010595036.1\|4159102_4159489_-	VOC family protein	NA	NA	NA	NA
WP_010595037.1\|4159583_4160771_+	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	8.6e-09	29.4
WP_010595038.1\|4161197_4161395_+	hypothetical protein	NA	NA	NA	NA
WP_099528110.1\|4167600_4169169_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_010594631.1\|4169454_4170096_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010594630.1\|4170167_4171361_+	MFS transporter	NA	NA	NA	NA
WP_017681667.1\|4171365_4172727_-	M1 family metallopeptidase	A0A2K9L1R3	Tupanvirus	6.0e-22	23.7
WP_029540051.1\|4172723_4176632_-	non-ribosomal peptide synthetase	NA	NA	NA	NA
WP_010594627.1\|4177065_4178385_+	aminotransferase class V-fold PLP-dependent enzyme	A0A2K9L2Y3	Tupanvirus	2.8e-32	25.2
WP_010594626.1\|4178431_4178905_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_010594625.1\|4179000_4179522_-	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	NA	NA	NA	NA
WP_010594624.1\|4179669_4180500_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_010594623.1\|4180511_4181615_+	SRPBCC family protein	NA	NA	NA	NA
WP_003938269.1\|4181669_4182161_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	2.8e-30	46.2
WP_010594622.1\|4182331_4183738_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_010594621.1\|4183728_4184769_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_010594620.1\|4184771_4185770_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_003938265.1\|4185790_4186345_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	5.3e-09	28.0
WP_099528128.1\|4186332_4188453_-	protein kinase	T2AWK4	Cannes_8_virus	1.8e-12	29.8
WP_099528129.1\|4188680_4191038_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	5.0e-109	47.0
WP_010594617.1\|4191070_4191724_+	GTP cyclohydrolase I FolE	A0A1W7AF02	Streptococcus_virus	2.2e-46	55.3
WP_085997952.1\|4191726_4192578_+	dihydropteroate synthase	S4VNV0	Pandoravirus	1.9e-21	34.0
WP_010594615.1\|4192574_4192943_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_010594614.1\|4192939_4193464_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_017681654.1\|4193463_4193928_+	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_010594612.1\|4194052_4194940_+	hypothetical protein	NA	NA	NA	NA
WP_059175010.1\|4195068_4196004_+	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_010594609.1\|4195996_4196938_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_003935999.1\|4196969_4197407_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_010594608.1\|4197409_4198252_+	type III pantothenate kinase	NA	NA	NA	NA
WP_010594607.1\|4198339_4198783_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_010594606.1\|4198859_4200368_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.3e-73	35.2
WP_010594605.1\|4200470_4200821_+	Lsr2 family protein	NA	NA	NA	NA
WP_026137980.1\|4201140_4202571_+	phospholipase D	NA	NA	NA	NA
WP_010594602.1\|4202827_4205353_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2C9CYX3	Yersinia_phage	6.5e-131	38.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024315

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection