CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP024416	Lactiplantibacillus plantarum strain ATCC 8014 plasmid pLP9042, complete sequence	0 crisprs	NA	0
NZ_CP024415	Lactiplantibacillus plantarum strain ATCC 8014 plasmid pLP39, complete sequence	0 crisprs	NA	1
NZ_CP024413	Lactiplantibacillus plantarum strain ATCC 8014 chromosome, complete genome	2 crisprs	csa3,DinG,cas3,DEDDh	6
NZ_CP024414	Lactiplantibacillus plantarum strain ATCC 8014 plasmid pLP49, complete sequence	0 crisprs	csa3	0
NZ_CP024417	Lactiplantibacillus plantarum strain ATCC 8014 plasmid pLP9039, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12690 : 38903

Lactobacillus_phage(100.0%)

integrase,tail,capsid,protease,terminase,portal

attL 19801:19812|attR 38991:39002

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643911.1\|12690_13005_-	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	4.2e-48	90.4
WP_003643910.1\|13097_13709_-\|tail	tail protein	A0A2P0ZLF5	Lactobacillus_phage	1.1e-105	97.0
WP_003643909.1\|13723_14146_-	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	7.4e-72	98.6
WP_003643908.1\|14142_14550_-	hypothetical protein	A0A2P0ZLD7	Lactobacillus_phage	3.3e-69	97.8
WP_003643907.1\|14546_14936_-	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	3.4e-63	89.1
WP_003643906.1\|14916_15222_-	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	1.6e-44	91.1
WP_003643905.1\|15361_16540_-\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	1.6e-217	98.7
WP_015825171.1\|16560_17304_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	1.4e-129	97.6
WP_003643903.1\|17290_18433_-\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	6.4e-211	96.3
WP_015825170.1\|18451_20134_-\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	99.1
19801:19812	attL	NA	NA	NA	NA
WP_015825169.1\|20130_20418_-\|terminase	P27 family phage terminase small subunit	A0A2P0ZLC8	Lactobacillus_phage	1.9e-39	88.4
WP_003643900.1\|20528_20780_-	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	7.3e-35	89.2
WP_003643899.1\|20813_21068_-	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	5.9e-32	82.5
WP_033615432.1\|21067_21406_-	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	5.2e-60	93.8
WP_003643898.1\|21389_21605_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	2.2e-27	81.4
WP_003643897.1\|21673_22381_-	hypothetical protein	NA	NA	NA	NA
WP_099686931.1\|22559_22991_-	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	6.0e-69	96.3
WP_003643895.1\|23002_23314_-	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	2.6e-50	97.1
WP_003643894.1\|23440_23902_-	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	1.9e-28	47.5
WP_162273788.1\|23898_24333_-	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	4.7e-37	57.4
WP_003643892.1\|24310_24535_-	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	1.1e-13	87.8
WP_003643891.1\|24554_24887_-	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	8.2e-58	96.4
WP_003643890.1\|25144_26419_-	helicase	A0A2P0ZLC4	Lactobacillus_phage	7.1e-243	98.8
WP_003643889.1\|26415_27210_-	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	2.5e-145	97.0
WP_003643888.1\|27283_27838_-	hypothetical protein	NA	NA	NA	NA
WP_003643887.1\|27851_28451_-	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	1.6e-96	98.9
WP_003643886.1\|28453_29170_-	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	3.5e-114	99.1
WP_003643885.1\|29166_30426_-	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	1.9e-227	95.0
WP_003643884.1\|30577_31057_-	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	1.3e-80	95.6
WP_003643883.1\|31053_31305_-	hypothetical protein	NA	NA	NA	NA
WP_016511377.1\|31301_31553_-	hypothetical protein	NA	NA	NA	NA
WP_021730257.1\|31625_31796_-	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	5.5e-26	98.2
WP_015825166.1\|31767_31953_-	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	2.4e-27	91.8
WP_003643881.1\|32108_32558_-	hypothetical protein	A0A2P0ZLA2	Lactobacillus_phage	6.9e-76	96.0
WP_003643880.1\|32696_32969_-	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	3.6e-43	98.9
WP_099112459.1\|33040_33226_-	hypothetical protein	NA	NA	NA	NA
WP_003643879.1\|33219_33435_-	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	6.9e-26	100.0
WP_003643878.1\|33438_33648_-	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	7.0e-31	100.0
WP_003643877.1\|33960_34338_+	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	5.3e-45	69.4
WP_003643876.1\|34347_34779_+	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_003643875.1\|34870_35539_+	hypothetical protein	NA	NA	NA	NA
WP_003643874.1\|35706_35883_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.4e-24	100.0
WP_003643873.1\|36006_36264_+	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.7e-39	95.3
WP_003643872.1\|36363_36795_+	universal stress protein	A0A2P0ZL98	Lactobacillus_phage	1.2e-74	98.6
WP_003643871.1\|36907_37576_+	GIY-YIG nuclease family protein	A0A2P0ZL92	Lactobacillus_phage	2.0e-124	99.1
WP_003643870.1\|37745_38903_+\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	1.0e-216	97.7
38991:39002	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP024413

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024413_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024413_1

1099615-1099771

Orphan

Consensus_repeat	Method
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP024413_1

>merge|NZ_CP024413|1|1099615-1099771|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTGGTGCGAAAAA

>NZ_CP024413|1|1|1099615-1099771|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	TACTAGTCAGAC
AACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACC	CGTACAAGCAATC
AAGAATCCAGTGGTGCGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024413.1\|WP_015825387.1\|1094079_1094661_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NZ_CP024413.1\|WP_015380095.1\|1102552_1102993_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP024413.1\|WP_015825394.1\|1107747_1108296_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP024413.1\|WP_003644190.1\|1107190_1107403_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024413.1\|WP_015825389.1\|1095768_1096611_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_CP024413.1\|WP_003644191.1\|1107517_1107712_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024413.1\|WP_049821960.1\|1096692_1098219_-\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP024413.1\|WP_003643206.1\|1104981_1105650_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP024413.1\|WP_015825383.1\|1089870_1090470_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349772
NZ_CP024413.1\|WP_003645955.1\|1109321_1110125_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP024413.1\|WP_015825391.1\|1098308_1098905_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP024413.1\|WP_015825393.1\|1103122_1104544_-\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP024413.1\|WP_015825386.1\|1093206_1094076_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP024413.1\|WP_003643212.1\|1108530_1109289_+\|competence-protein-ComK	unknown	unknown	gnl\|CDD\|368849
NZ_CP024413.1\|WP_015825382.1\|1089211_1089874_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|130079
NZ_CP024413.1\|WP_015825385.1\|1091652_1093191_+\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP024413.1\|WP_003643208.1\|1106933_1107161_-\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP024413.1\|WP_011101326.1\|1106526_1106832_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024413.1\|WP_015825388.1\|1094670_1095699_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NZ_CP024413.1\|WP_015825384.1\|1090472_1091609_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903

Protein	Function_ID	Function_description	E-value
NZ_CP024413.1\|WP_015825387.1\|1094079_1094661_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.44101e-98
NZ_CP024413.1\|WP_015380095.1\|1102552_1102993_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.84212e-13
NZ_CP024413.1\|WP_015825389.1\|1095768_1096611_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	4.20202e-125
NZ_CP024413.1\|WP_049821960.1\|1096692_1098219_-\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	9.60408e-11
NZ_CP024413.1\|WP_003643206.1\|1104981_1105650_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95
NZ_CP024413.1\|WP_015825383.1\|1089870_1090470_+\|AAA-family-ATPase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.03603e-23
NZ_CP024413.1\|WP_003645955.1\|1109321_1110125_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	5.53268e-120
NZ_CP024413.1\|WP_015825391.1\|1098308_1098905_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	5.8145e-45
NZ_CP024413.1\|WP_015825393.1\|1103122_1104544_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.82021e-41
NZ_CP024413.1\|WP_015825386.1\|1093206_1094076_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP024413.1\|WP_003643212.1\|1108530_1109289_+\|competence-protein-ComK	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	0.000164946
NZ_CP024413.1\|WP_015825382.1\|1089211_1089874_+\|hypothetical-protein	gnl\|CDD\|130079	TIGR01006, Capsular_polysaccharide_biosynthesis_protein_CapA, polysaccharide export protein, MPA1 family, Gram-positive type. This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	8.09802e-14
NZ_CP024413.1\|WP_015825385.1\|1091652_1093191_+\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	4.91398e-12
NZ_CP024413.1\|WP_003643208.1\|1106933_1107161_-\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP024413.1\|WP_015825394.1\|1107747_1108296_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.181e-07
NZ_CP024413.1\|WP_015825388.1\|1094670_1095699_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP024413.1\|WP_015825384.1\|1090472_1091609_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	6.66027e-06

>NZ_CP024413.1|WP_015825391.1|1098308_1098905_-|tyrosine-type-recombinase/integrase
MINIYYNVEPLRSNEEITDFVNKAQNGTHGERNALLILIGLNTGLRMSDILNLKVGQIRYHDIVHITEKKTKKRRVILLTRLRPQINHYIKDLPDNEYLFTNRQHQPLSVNAVYKLFQTIARKMHRTDIGTHTLRKTFGYHYYQQTHDIGTLMMIFNHSSEAITKRYIGLNQDVILKQMAGFSLGIDMLPGIKISDKR
>NZ_CP024413.1|WP_049821960.1|1096692_1098219_-|oligosaccharide-flippase-family-protein
MLNSSILTLVQIFTILVKFITQTIFIKYLGKEYLGLNGLFTNVLSVLSFAELGVGSAIVFSLYAPLAKRDENSISALMNLFRKAYNAIGIIIAFAGVVMIPVLPYLIKDYNDLTHVSLYFVLYISNSVVSYFFTYKRSLLIADQKEYISALNQLKYTALQVVLQVAVLFFFHSYAYYLIVAIITTLLSNFTISRKVDRLYPYLSKHRDLKVDTKSIHIIRNNIVGMVGSKIGSIVVRSTDNLLLSAFMGIYIVGIYSNYLLIVTSISSVCTKLISSVTASVGNLIAENNKKRTFDVFRTHYTINFFIVSVSAGCLLVSLNPFIKFWAGKSYTLALSIVIIIVLNYFFDQLRQSSLTFITAYGLFVANGKKSVVEAIMNFAFSFTLLVGFHLGIRGVLLGTILTNLILNSWWEPLLLFRAGFGFRKKYMRFYLINYWLSNLAILSFIFVGSQFIFYLDTYIHNSNFLIALINSILMLILQLIYFTIFYSRTSGYKYLLKVGKHLLLRKH
>NZ_CP024413.1|WP_015825389.1|1095768_1096611_+|dTDP-4-dehydrorhamnose-reductase
MAKVMIVGANGQLGHELQRLLNEQEIAFDALTEKELDITDLDAVKAKIAELQPAVLYDCAAYTAVDKAEDEGKALNWLVNVDGTKNLAQVAAEQGVKLVYVSTDYIFDGTNKGEYLEDDPANPKNEYGRAKWAGEEAVRHSGADYYIVRTSWVFGEFGHNFVFTMQNLAKTHDKLTVVNDQLGRPTWTRTLAEFMVHLVKTEAASGTYQLSNDNTATWYDFAKEILKDTDVEVAPVTSEQFPQKAYRPQHSVMNLDKAKATGYKILTWQDALNEFLKSLQ
>NZ_CP024413.1|WP_015825388.1|1094670_1095699_+|dTDP-glucose-4,6-dehydratase
MENLLVTGGAGFIGSNFVHYVYNHHPEVQITVLDKLTYAGNRANLEEILGDRVKLVVGDICDAPLVDELMQQTDAVVHYAAESHNDNSLKDPWPFIETNIIGTYTLIQSAHKFNKRFHHVSTDEVYGDLPLREDLPGHGEGVGEKFTPTSRYKPSSPYSSSKASSDLLVRAWVRSFGLQATISNCSNNYGPYQYIEKFIPRQITNILSGIRPKLYGSGKNVRDWIHTNDHSAAVWDILTKGKIGETYLIGADGEMNNKDVLEMILELMGQPKDAYDVVKDRPGHDLRYAIDSTKLRTELGWQPEFTDFRSGLKATIDWYTDHQDWWQADKNKVESNYAKNGQ
>NZ_CP024413.1|WP_015825387.1|1094079_1094661_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MGKLKVTTTKLQDVKIIEPAVFGDKRGFFTETYSDRDFKEAGIDFDFIQDNQSLSAEAGVLRGLHFQRGKAAQTKLIRVVTGAVLDVIVDVRAGSPTYGEWEGYIISESNHRQLLVPRGFAHGFVTLTDNVNFLYKCDNYYNAEADGGITFMDKDLNINWPIDYDQAITSEKDAKQQTFKEFEQNNPFVYGEI
>NZ_CP024413.1|WP_015825386.1|1093206_1094076_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPITRAISKQLIPIYDKPMIYYPLSTLMLAGIQDILVISTPVDTPRFKELLGDGHDLGLNLTYAVQERPNGLAEAFIIGADFIGDDSVCLILGDNIYYGGGLSKMLQHASAKPKGATVFGYHVNDPERFGVVDFDENMHAKSIVEKPDHPASNYAVTGMYFYDNQVVDIAKNIQPSPRGELEITDINKVYLEHNELDVELMGRGFAWLDTGTHDSLQEASSFIATVQKRQNLKVACLEEVAYRMGYIDADKVYDLAQPLKKNDYGQYLLRLIGRA
>NZ_CP024413.1|WP_015825385.1|1091652_1093191_+|oligosaccharide-flippase-family-protein
MRNNLSRTRAALLNSSIASIGQIATLVMQFVARTFFIHILGQQYLGLNGLFTNILTFLNFAELGIGSAITYALYEPLATENRPQIAALMRQFKKWYQYIALIVAIGGIILTPFLPYLVHNQATNFVNVYVAFLLALGNTVASYLVSYKRTLLIANQQGYLNTINTIGYSLVQQIVQVIFLLLYANFYLYLFIQLLFMVISNVHVSHVVDKMYPYLNDYKDERVDGNTLSYFKKNIVGMLSSKVGGIVVNGTDNILLSYFIGLDAVGLYSNYTLILNGLTNVLNQAVTSVASSVGNLAASRGSQEKQKRVFYNYYALSTLLVLFATVGFTAFSSTFIRYWIGSRYIYTQLPLFLISLNFYFQGIRQPVITYTNAYGLYWYARYKSIFESVVNLVVSIVLIKFTGLGISAVLLGTITSNMLVNLWWEPLIVFKWGLKKGYLKFMLLNIIYIIIGVGMLGVIVYSTQIVDYNNILLNIATTAGFELLMFVIFIVTTRLFSADIFNLKSLLAKIKR
>NZ_CP024413.1|WP_015825384.1|1090472_1091609_+|serine-hydrolase
MKGRTRKAVIIFLLFAVVLVAVFIGKKIIDISAANTNVMTSETVVSHQLEKSLLERTTLDTVRLSNKNKEKLSENNRILSKREFIGAFLGVRNNKLVYSWRNGYSNTSPNTSFNVNSSVLVGKYQTVLDQALLLSLVNRGDVKLTDELSKYDVSSGAVGRLTVKQLLRNESHLYVRKQSIATIQNPRNKEYSNTLFKKGKGGMTDWVTADTFIKRIVIARATSKSYESTFEQELTNKFGLSNTRFFNARQTYTNDVASYDKKIVNNTRVQSKKLVIKKRSLNGNTLRMSLADIVLSLNGIEKNRLFDSKYTQYFEDYIEQSGVGSLNENVFTYNGNVAGQALAIKSNLDTQSTVVLITNYSDSDVSLTKHLSQLYRIL
>NZ_CP024413.1|WP_015825383.1|1089870_1090470_+|AAA-family-ATPase
MSTHIKNVVRQINQKLSEQISSKHVISFITPGGLVGQQTLIANLALMYGTAGKKTLIIDTDFSRNIFPNVFDVSSKYGLADYISRPSVELSDVIQSVPGRDVSFVSSGNASNEDVKYLLGDPRFNELIEQVKNKYTYVLINTPTFVGDVALLDSVCNLSEGIIFVLQLKKISKRNVYKLMETVKRNSNNKILGYVNLED
>NZ_CP024413.1|WP_015825382.1|1089211_1089874_+|hypothetical-protein
MKFVFRFNSGMAHRLVKKYLLITILIAVLFGGLSGAATMTLKKNVYTSTGQMVQNDNNYTLIQSYKQFAASSSFTTILDKKIAASRWQESNASKNYTIAIGNNSDSPFFSVSVASPNKYFSEFLTNTAMQTLVSNLSQYLSGANVSIVSEASTGYISGYRKILIKYTIVAAILGFVLSWLIFIARELFIGKIKDEDFVEDVFEINKLGTITLSEKKGGSK
>NZ_CP024413.1|WP_015380095.1|1102552_1102993_+|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGFVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP024413.1|WP_015825393.1|1103122_1104544_-|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFVFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQIATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFGAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP024413.1|WP_003643206.1|1104981_1105650_-|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP024413.1|WP_011101326.1|1106526_1106832_+|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAMRLSCDI
>NZ_CP024413.1|WP_003643208.1|1106933_1107161_-|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP024413.1|WP_003644190.1|1107190_1107403_-|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP024413.1|WP_003644191.1|1107517_1107712_-|hypothetical-protein
MHIWMNTHVLLTVTDSNQRQFHQHWLADRELTDSDFTTLITILTPLFAEKIISITVRTITEFAD
>NZ_CP024413.1|WP_015825394.1|1107747_1108296_-|sigma-70-family-RNA-polymerase-sigma-factor
MYADRFDNQIAFDLLARPEHQRLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFCRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP024413.1|WP_003643212.1|1108530_1109289_+|competence-protein-ComK
MLERNTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLVIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKQLAGELGLSKHKLPVIHGDAILMPLSTAKRGTTSWYNRHYLNHIEAQGFMTALVYDGQITIQVDMSERVATRQLVKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP024413.1|WP_003645955.1|1109321_1110125_+|recombination-regulator-RecX
MTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024413_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024413_2

2664566-2664651

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024413_2

>merge|NZ_CP024413|2|2664566-2664651|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP024413|2|1|2664566-2664651|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024413.1\|WP_059374102.1\|2670072_2670945_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP024413.1\|WP_015825967.1\|2672766_2673591_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP024413.1\|WP_015825957.1\|2659816_2660383_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP024413.1\|WP_003643400.1\|2667344_2668343_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP024413.1\|WP_015825963.1\|2668339_2669335_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP024413.1\|WP_015825968.1\|2673661_2673982_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP024413.1\|WP_013355932.1\|2662502_2662742_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024413.1\|WP_015825955.1\|2657937_2658504_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP024413.1\|WP_003642340.1\|2655984_2656269_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP024413.1\|WP_003642342.1\|2657050_2657779_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP024413.1\|WP_003642350.1\|2666553_2667348_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP024413.1\|WP_003642348.1\|2664667_2665267_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP024413.1\|WP_015825965.1\|2669579_2670092_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP024413.1\|WP_015825960.1\|2663072_2664551_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP024413.1\|WP_003643403.1\|2672001_2672508_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP024413.1\|WP_003642355.1\|2671238_2671985_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP024413.1\|WP_015825958.1\|2660602_2661556_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP024413.1\|WP_011102039.1\|2656552_2656918_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP024413.1\|WP_003642338.1\|2651433_2652846_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP024413.1\|WP_015825956.1\|2658630_2659668_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538

Protein	Function_ID	Function_description	E-value
NZ_CP024413.1\|WP_059374102.1\|2670072_2670945_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.7296e-124
NZ_CP024413.1\|WP_015825967.1\|2672766_2673591_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.68115e-56
NZ_CP024413.1\|WP_015825957.1\|2659816_2660383_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	1.62108e-28
NZ_CP024413.1\|WP_003643400.1\|2667344_2668343_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP024413.1\|WP_015825963.1\|2668339_2669335_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.52715e-79
NZ_CP024413.1\|WP_015825968.1\|2673661_2673982_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.29402e-16
NZ_CP024413.1\|WP_003643403.1\|2672001_2672508_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
NZ_CP024413.1\|WP_015825955.1\|2657937_2658504_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.8176e-05
NZ_CP024413.1\|WP_003642340.1\|2655984_2656269_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP024413.1\|WP_003642342.1\|2657050_2657779_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP024413.1\|WP_003642350.1\|2666553_2667348_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP024413.1\|WP_003642348.1\|2664667_2665267_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.49788e-09
NZ_CP024413.1\|WP_015825965.1\|2669579_2670092_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	8.32203e-07
NZ_CP024413.1\|WP_015825960.1\|2663072_2664551_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.92446e-73
NZ_CP024413.1\|WP_003642355.1\|2671238_2671985_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP024413.1\|WP_015825958.1\|2660602_2661556_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	7.30514e-131
NZ_CP024413.1\|WP_011102039.1\|2656552_2656918_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP024413.1\|WP_003642338.1\|2651433_2652846_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP024413.1\|WP_015825956.1\|2658630_2659668_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.12176e-94

>NZ_CP024413.1|WP_015825960.1|2663072_2664551_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLAGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP024413.1|WP_013355932.1|2662502_2662742_-|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>NZ_CP024413.1|WP_015825958.1|2660602_2661556_-|aldo/keto-reductase
MKTIQIGASQLKASVVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP024413.1|WP_015825957.1|2659816_2660383_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAKWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>NZ_CP024413.1|WP_015825956.1|2658630_2659668_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIHQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP024413.1|WP_015825955.1|2657937_2658504_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLIGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP024413.1|WP_003642342.1|2657050_2657779_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP024413.1|WP_011102039.1|2656552_2656918_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP024413.1|WP_003642340.1|2655984_2656269_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP024413.1|WP_003642338.1|2651433_2652846_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP024413.1|WP_003642348.1|2664667_2665267_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVNLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP024413.1|WP_003642350.1|2666553_2667348_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP024413.1|WP_003643400.1|2667344_2668343_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP024413.1|WP_015825963.1|2668339_2669335_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPTLLGILTGHGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISMAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRR
>NZ_CP024413.1|WP_015825965.1|2669579_2670092_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVRDISDAALVHRSTFCKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP024413.1|WP_059374102.1|2670072_2670945_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDKGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP024413.1|WP_003642355.1|2671238_2671985_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP024413.1|WP_003643403.1|2672001_2672508_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP024413.1|WP_015825967.1|2672766_2673591_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP024413.1|WP_015825968.1|2673661_2673982_+|MerR-family-transcriptional-regulator
MTGMTKDALRYYEHLGILPDVQRNQYNYRQYSHKNLETLQLIKIFRDLDLDLSLLTPAHLALDGQAKVVAFKQYQQVIRDRIRHLEAIDQLLATKIDYFEHQSIDT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15166 : 53448

Staphylococcus_phage(28.57%)

portal,terminase,tail,integrase,head,capsid,transposase

attL 9645:9659|attR 55006:55020

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
9645:9659	attL	NA	NA	NA	NA
WP_012778279.1\|15166_16846_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.7e-93	41.5
WP_003641639.1\|17162_18386_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	2.4e-54	33.6
WP_003643611.1\|18407_19205_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-45	39.2
WP_012778280.1\|19223_20462_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	6.3e-111	52.9
WP_099686930.1\|20922_22539_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012778281.1\|22869_24774_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_003641645.1\|24763_25903_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_003641646.1\|25899_27072_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_012778282.1\|27064_28504_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_003643612.1\|28523_30920_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.6e-09	42.9
WP_012778283.1\|30937_32755_+	glycoside hydrolase family 13 protein	NA	NA	NA	NA
WP_003641650.1\|33087_33855_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641651.1\|34006_34678_-	beta-phosphoglucomutase	NA	NA	NA	NA
WP_011100855.1\|34695_37416_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_003641653.1\|37803_38253_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_003643615.1\|38451_38652_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.6
WP_012778285.1\|38743_38974_+	hypothetical protein	NA	NA	NA	NA
WP_012778286.1\|39442_40597_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	5.2e-59	36.5
WP_012778287.1\|40675_41320_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015640734.1\|41468_41648_+	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	4.3e-21	87.9
WP_012778290.1\|41915_42146_+	hypothetical protein	NA	NA	NA	NA
WP_012778291.1\|42159_42960_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_012778292.1\|42959_44354_+	virulence protein	Q4ZD27	Staphylococcus_phage	3.2e-71	35.9
WP_003645297.1\|44497_44917_+	hypothetical protein	NA	NA	NA	NA
WP_012778293.1\|44941_45124_+	sporulation protein Cse60	NA	NA	NA	NA
WP_012778294.1\|45133_45472_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.4e-09	36.6
WP_012778295.1\|45464_45854_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.3e-18	43.5
WP_012778296.1\|46662_47661_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-52	37.6
WP_012778297.1\|47805_48279_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_012778300.1\|50134_51235_+\|portal	phage portal protein	A0A2H4J8V4	uncultured_Caudovirales_phage	3.0e-48	34.6
WP_012778301.1\|51231_52773_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	9.1e-43	25.9
WP_012778302.1\|53181_53448_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
55006:55020	attR	NA	NA	NA	NA

DBSCAN-SWA_2

331551 : 380043

Bacillus_virus(33.33%)

bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|331551_332115_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011100974.1\|332308_332977_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|333126_334632_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|334896_335265_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_015825106.1\|335377_335887_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_011100975.1\|335917_337114_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|337223_337694_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|337712_338168_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|338271_338844_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|339009_339930_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015825107.1\|340066_340966_+	oxidoreductase	NA	NA	NA	NA
WP_015825108.1\|341405_343286_+	hypothetical protein	NA	NA	NA	NA
WP_003646442.1\|343457_343904_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|344141_345668_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|345668_346640_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_015825110.1\|346717_348049_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|348514_350032_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|350046_351876_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|351890_352613_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_015825112.1\|353199_356883_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_063486260.1\|356884_358759_+	hypothetical protein	NA	NA	NA	NA
WP_015825114.1\|358764_359307_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_015825115.1\|359321_359585_+	hypothetical protein	NA	NA	NA	NA
WP_003641960.1\|359696_359972_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|360354_360972_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003646460.1\|360975_362130_-	MFS transporter	NA	NA	NA	NA
WP_015825116.1\|362133_362925_-	HAD family hydrolase	NA	NA	NA	NA
WP_015379762.1\|362995_363868_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_015825117.1\|364027_364843_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|365368_366745_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_015825118.1\|366789_367974_+	cation:proton antiporter	NA	NA	NA	NA
WP_015825119.1\|368361_368565_+	hypothetical protein	NA	NA	NA	NA
WP_015825120.1\|368936_369605_-	hypothetical protein	NA	NA	NA	NA
WP_154766382.1\|370162_370336_+	hypothetical protein	NA	NA	NA	NA
WP_015825121.1\|370348_371689_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_015825122.1\|371689_372433_+	response regulator transcription factor	NA	NA	NA	NA
WP_015825123.1\|372726_373500_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015825124.1\|373598_373757_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|373781_373952_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_015825125.1\|374218_376369_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_015825126.1\|376384_377761_+	HlyD family secretion protein	NA	NA	NA	NA
WP_015825127.1\|377850_378540_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015825129.1\|379362_380043_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

482651 : 539142

Lactobacillus_phage(87.23%)

portal,terminase,tail,integrase,capsid,transposase,protease

attL 498539:498558|attR 531404:531423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825156.1\|482651_484322_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.7e-93	41.5
WP_003643855.1\|489816_491289_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.1e-68	34.3
WP_003640888.1\|491343_492186_+	metallophosphoesterase	NA	NA	NA	NA
WP_015825157.1\|492747_493206_+	hypothetical protein	NA	NA	NA	NA
WP_015825158.1\|493385_493910_+	cupin domain-containing protein	NA	NA	NA	NA
WP_003640891.1\|493940_494276_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011101053.1\|494310_495153_+	metallophosphoesterase	NA	NA	NA	NA
WP_015825159.1\|495311_496418_-	anion permease	NA	NA	NA	NA
WP_015825160.1\|496610_497432_-	nicotinamide mononucleotide transporter	A0A2K9VCL6	Lactobacillus_phage	2.6e-52	42.2
WP_003640895.1\|497792_498584_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.5e-30	36.1
498539:498558	attL	NA	NA	NA	NA
WP_003644997.1\|498662_499799_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_003640897.1\|499822_500524_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003643865.1\|500693_501431_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_003640899.1\|501587_503066_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-106	44.1
WP_003640900.1\|503065_503893_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.5e-72	54.0
WP_015825161.1\|504348_507003_+	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.8e-70	29.1
WP_015825162.1\|507057_507492_+	hypothetical protein	NA	NA	NA	NA
WP_015825163.1\|507785_509957_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_015825164.1\|509956_510403_+	SprT family protein	NA	NA	NA	NA
WP_015825165.1\|510468_511755_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_003644991.1\|511763_512639_+	homoserine kinase	NA	NA	NA	NA
WP_003643870.1\|512929_514087_-\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	1.0e-216	97.7
WP_003643871.1\|514256_514925_-	GIY-YIG nuclease family protein	A0A2P0ZL92	Lactobacillus_phage	2.0e-124	99.1
WP_003643872.1\|515037_515469_-	universal stress protein	A0A2P0ZL98	Lactobacillus_phage	1.2e-74	98.6
WP_003643873.1\|515568_515826_-	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.7e-39	95.3
WP_003643874.1\|515949_516126_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.4e-24	100.0
WP_003643875.1\|516293_516962_-	hypothetical protein	NA	NA	NA	NA
WP_003643876.1\|517053_517485_-	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_003643877.1\|517494_517872_-	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	5.3e-45	69.4
WP_003643878.1\|518184_518394_+	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	7.0e-31	100.0
WP_003643879.1\|518397_518613_+	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	6.9e-26	100.0
WP_099112459.1\|518606_518792_+	hypothetical protein	NA	NA	NA	NA
WP_003643880.1\|518863_519136_+	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	3.6e-43	98.9
WP_003643881.1\|519274_519724_+	hypothetical protein	A0A2P0ZLA2	Lactobacillus_phage	6.9e-76	96.0
WP_015825166.1\|519879_520065_+	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	2.4e-27	91.8
WP_021730257.1\|520036_520207_+	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	5.5e-26	98.2
WP_016511377.1\|520279_520531_+	hypothetical protein	NA	NA	NA	NA
WP_003643883.1\|520527_520779_+	hypothetical protein	NA	NA	NA	NA
WP_003643884.1\|520775_521255_+	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	1.3e-80	95.6
WP_003643885.1\|521406_522666_+	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	1.9e-227	95.0
WP_003643886.1\|522662_523379_+	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	3.5e-114	99.1
WP_003643887.1\|523381_523981_+	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	1.6e-96	98.9
WP_003643888.1\|523994_524549_+	hypothetical protein	NA	NA	NA	NA
WP_003643889.1\|524622_525417_+	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	2.5e-145	97.0
WP_003643890.1\|525413_526688_+	helicase	A0A2P0ZLC4	Lactobacillus_phage	7.1e-243	98.8
WP_003643891.1\|526945_527278_+	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	8.2e-58	96.4
WP_003643892.1\|527297_527522_+	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	1.1e-13	87.8
WP_162273788.1\|527499_527934_+	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	4.7e-37	57.4
WP_003643894.1\|527930_528392_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	1.9e-28	47.5
WP_003643895.1\|528518_528830_+	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	2.6e-50	97.1
WP_099686931.1\|528841_529273_+	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	6.0e-69	96.3
WP_003643897.1\|529451_530159_+	hypothetical protein	NA	NA	NA	NA
WP_003643898.1\|530227_530443_+	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	2.2e-27	81.4
WP_033615432.1\|530426_530765_+	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	5.2e-60	93.8
WP_003643899.1\|530764_531019_+	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	5.9e-32	82.5
WP_003643900.1\|531052_531304_+	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	7.3e-35	89.2
WP_015825169.1\|531414_531702_+\|terminase	P27 family phage terminase small subunit	A0A2P0ZLC8	Lactobacillus_phage	1.9e-39	88.4
531404:531423	attR	NA	NA	NA	NA
WP_015825170.1\|531698_533381_+\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	99.1
WP_003643903.1\|533399_534542_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	6.4e-211	96.3
WP_015825171.1\|534528_535272_+\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	1.4e-129	97.6
WP_003643905.1\|535292_536471_+\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	1.6e-217	98.7
WP_003643906.1\|536610_536916_+	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	1.6e-44	91.1
WP_003643907.1\|536896_537286_+	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	3.4e-63	89.1
WP_003643908.1\|537282_537690_+	hypothetical protein	A0A2P0ZLD7	Lactobacillus_phage	3.3e-69	97.8
WP_003643909.1\|537686_538109_+	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	7.4e-72	98.6
WP_003643910.1\|538123_538735_+\|tail	tail protein	A0A2P0ZLF5	Lactobacillus_phage	1.1e-105	97.0
WP_003643911.1\|538827_539142_+	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	4.2e-48	90.4

DBSCAN-SWA_4

1005602 : 1098905

Lactobacillus_phage(61.82%)

tRNA,portal,terminase,tail,integrase,head,capsid,transposase,protease

attL 1077023:1077037|attR 1102192:1102206

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825317.1\|1005602_1005923_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_015825318.1\|1005922_1007386_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_015825319.1\|1007385_1008810_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003641344.1\|1008914_1009937_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
WP_015825320.1\|1010270_1011644_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.2e-124	50.0
WP_003641346.1\|1012097_1012676_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003646275.1\|1012942_1015282_+	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	7.1e-39	24.8
WP_003644132.1\|1015531_1016848_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641349.1\|1016840_1017725_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644133.1\|1017849_1018728_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003641351.1\|1018752_1019529_+	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
WP_003641352.1\|1019684_1020050_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_003638174.1\|1020393_1020594_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641353.1\|1020780_1021788_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003641354.1\|1021800_1023135_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
WP_015825321.1\|1023376_1024558_-\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.5e-58	37.6
WP_003641356.1\|1024725_1025040_-	hypothetical protein	NA	NA	NA	NA
WP_003641358.1\|1025373_1025574_-	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_041161662.1\|1025585_1026401_-	hypothetical protein	NA	NA	NA	NA
WP_003641360.1\|1026426_1026816_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_003641361.1\|1026846_1027173_-	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003641362.1\|1027429_1027645_+	hypothetical protein	NA	NA	NA	NA
WP_049821958.1\|1027718_1028462_+	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	4.8e-50	45.6
WP_015825325.1\|1028473_1028683_+	hypothetical protein	NA	NA	NA	NA
WP_015825327.1\|1028695_1028911_+	hypothetical protein	NA	NA	NA	NA
WP_015825329.1\|1029813_1030074_+	hypothetical protein	NA	NA	NA	NA
WP_015825330.1\|1030216_1030396_+	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	1.4e-24	100.0
WP_015825331.1\|1030429_1030684_+	hypothetical protein	NA	NA	NA	NA
WP_015825332.1\|1030686_1030887_+	hypothetical protein	E9LUT7	Lactobacillus_phage	2.6e-27	92.4
WP_164878063.1\|1030898_1031063_+	hypothetical protein	E9LUT8	Lactobacillus_phage	1.4e-10	65.4
WP_021732029.1\|1031065_1031212_+	hypothetical protein	E9LUT9	Lactobacillus_phage	2.3e-17	93.6
WP_015825333.1\|1031211_1032072_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	3.2e-37	34.4
WP_015825334.1\|1032071_1032698_+	ERF family protein	D7RWM8	Brochothrix_phage	6.1e-14	37.4
WP_015825335.1\|1032694_1033156_+	single-stranded DNA-binding protein	A0A2I2MUI5	uncultured_Caudovirales_phage	1.4e-39	57.5
WP_015825336.1\|1033171_1033738_+	HNH endonuclease	A0A249XVQ5	Enterococcus_phage	4.0e-20	34.1
WP_015825337.1\|1033743_1034436_+	hypothetical protein	E9LUU3	Lactobacillus_phage	2.2e-121	91.3
WP_015825338.1\|1034485_1035292_+	hypothetical protein	A0A0S2MYA8	Enterococcus_phage	6.0e-46	37.2
WP_015825339.1\|1035291_1036077_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.2e-144	98.9
WP_013355641.1\|1036212_1036521_+	hypothetical protein	E9LUN7	Lactobacillus_phage	3.2e-48	94.1
WP_015825340.1\|1036795_1037227_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.4e-72	93.7
WP_041161663.1\|1037449_1037716_+	hypothetical protein	NA	NA	NA	NA
WP_015825342.1\|1037737_1038397_+	HNH endonuclease	B8R694	Lactobacillus_phage	2.5e-21	38.4
WP_049821959.1\|1038588_1039023_+\|terminase	phage terminase small subunit P27 family	B8R648	Lactobacillus_phage	8.3e-18	37.7
WP_015825344.1\|1039009_1040926_+\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	8.2e-134	41.4
WP_165274444.1\|1040939_1041104_+	hypothetical protein	NA	NA	NA	NA
WP_015825345.1\|1041145_1042264_+\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	3.6e-65	39.5
WP_015825346.1\|1042235_1042841_+\|head,protease	HK97 family phage prohead protease	B8R651	Lactobacillus_phage	8.2e-40	49.1
WP_015825347.1\|1042847_1044230_+\|capsid	phage major capsid protein	A0A0M7RF71	Lactobacillus_phage	4.9e-96	60.1
WP_015825348.1\|1044320_1044599_+	hypothetical protein	A0A2P0ZLF2	Lactobacillus_phage	2.2e-32	73.6
WP_041161664.1\|1044599_1044947_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.4e-55	92.2
WP_015825350.1\|1044949_1045357_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	1.1e-64	90.9
WP_015825351.1\|1045356_1045737_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	8.5e-59	90.5
WP_015825352.1\|1045751_1046393_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	3.4e-108	92.0
WP_015825353.1\|1046469_1046844_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	2.0e-57	93.5
WP_015825354.1\|1046888_1047074_+	hypothetical protein	NA	NA	NA	NA
WP_015825355.1\|1047105_1052256_+	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	53.8
WP_015825356.1\|1052332_1054105_+\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	2.5e-310	92.9
WP_015825357.1\|1054171_1056583_+\|tail	phage tail protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.5
WP_015825358.1\|1056599_1059395_+\|tail	tail fiber protein	E9LUR4	Lactobacillus_phage	7.5e-221	71.1
WP_003641409.1\|1059387_1059627_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.9e-32	97.4
WP_166485333.1\|1059630_1059792_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	2.1e-19	98.1
WP_015825359.1\|1059775_1060891_+	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	9.1e-61	85.7
WP_041161665.1\|1060887_1061145_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.7e-18	76.4
WP_015825360.1\|1061157_1062315_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.8e-187	85.1
WP_015825361.1\|1062314_1062578_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	7.4e-38	98.9
WP_003643301.1\|1063275_1063716_-	universal stress protein	NA	NA	NA	NA
WP_015825363.1\|1063849_1065157_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_045352539.1\|1065149_1066016_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_076630458.1\|1066167_1066368_-	hypothetical protein	NA	NA	NA	NA
WP_003643305.1\|1066567_1067008_+	hypothetical protein	NA	NA	NA	NA
WP_003646269.1\|1067440_1068004_+	hypothetical protein	NA	NA	NA	NA
WP_015825366.1\|1068610_1069690_+	ATP-binding protein	M4QMW8	Micromonas_pusilla_virus	4.2e-18	32.1
WP_015825367.1\|1069698_1071753_+	S8 family peptidase	NA	NA	NA	NA
WP_172436956.1\|1072057_1073413_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_015825369.1\|1073669_1074845_+	serine hydrolase	NA	NA	NA	NA
WP_015825370.1\|1075034_1076153_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	7.1e-21	31.3
WP_015825371.1\|1076539_1077469_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
1077023:1077037	attL	NA	NA	NA	NA
WP_003643315.1\|1077658_1078375_+	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_015825372.1\|1078626_1079820_+	glycosyltransferase	NA	NA	NA	NA
WP_077727009.1\|1080568_1080778_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_015825374.1\|1080774_1081323_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.1e-30	40.3
WP_099112445.1\|1081391_1082438_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_015825376.1\|1082874_1083657_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_015825377.1\|1083722_1084688_+	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_015825378.1\|1084690_1085737_+	glycosyltransferase	NA	NA	NA	NA
WP_015825379.1\|1085777_1086695_+	glycosyltransferase	NA	NA	NA	NA
WP_015825380.1\|1086681_1087767_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_148113607.1\|1087827_1088853_-	hypothetical protein	NA	NA	NA	NA
WP_015825382.1\|1089211_1089874_+	hypothetical protein	NA	NA	NA	NA
WP_015825383.1\|1089870_1090470_+	AAA family ATPase	NA	NA	NA	NA
WP_015825384.1\|1090472_1091609_+	serine hydrolase	NA	NA	NA	NA
WP_015825385.1\|1091652_1093191_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_015825386.1\|1093206_1094076_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	9.2e-101	61.2
WP_015825387.1\|1094079_1094661_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.5e-38	45.1
WP_015825388.1\|1094670_1095699_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	3.8e-69	42.1
WP_015825389.1\|1095768_1096611_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.4e-34	37.2
WP_049821960.1\|1096692_1098219_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_015825391.1\|1098308_1098905_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.6e-33	43.0
1102192:1102206	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1281109 : 1290956

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825454.1\|1281109_1282348_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	6.3e-220	99.2
WP_015825455.1\|1282438_1283410_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_003643099.1\|1283595_1284543_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1284886_1285501_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_015825456.1\|1285503_1287942_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643095.1\|1288029_1288590_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_011101401.1\|1288660_1289101_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_015380221.1\|1289196_1289334_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1289960_1290956_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_6

2329912 : 2338423

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2329912_2330491_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_015380733.1\|2330483_2331509_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.0
WP_003642591.1\|2331505_2332960_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_015825820.1\|2332944_2335164_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-143	40.1
WP_011101895.1\|2335156_2335837_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2335836_2336091_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2336092_2336824_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_015380738.1\|2336826_2337957_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2337940_2338423_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP024413

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection