CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP021005	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pB, complete sequence	0 crisprs	NA	0	0
NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	2 crisprs	NA	2	0
NZ_CP021002	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pA, complete sequence	0 crisprs	NA	0	0
NZ_CP021004	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence	0 crisprs	NA	0	0
NZ_CP021001	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 chromosome, complete genome	3 crisprs	cas3,DinG,DEDDh,WYL,csa3	6	16

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021003_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021003_1

1682-1788

Orphan

Consensus_repeat	Method
GCGTTCAAGGTCCGTCCGTATTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021003_1

>merge|NZ_CP021003|1|1682-1788|CRISPRCasFinder
GCGTTCAAGGTCCGTCCGTATTACAGCTGACCAATCCAGCATGAGCGCCGGTATCGCCGGCACTGCTGATGGCGCTCAGTGTGGTGTTCAAGGTCCGTCCGTATTAC

>NZ_CP021003|1|1|1682-1788|CRISPRCasFinder
GCGTTCAAGGTCCGTCCGTATTAC	AGCTGACCAATCCAGCATGAGCGCCGGTATCGCCGGCACTGCTGATGGCGCTCAGTGTG
GTGTTCAAGGTCCGTCCGTATTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021003.1\|WP_022560507.1\|11078_11903_+\|DUF945-domain-containing-protein	unknown	unknown	gnl\|CDD\|377596
NZ_CP021003.1\|WP_022560510.1\|12801_13044_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_099800837.1\|6164_9671_+\|Avirulence-protein-AvrBs3	unknown	unknown	gnl\|CDD\|367468
NZ_CP021003.1\|WP_022560509.1\|12575_12797_+\|DUF2688-domain-containing-protein	unknown	unknown	gnl\|CDD\|371287
NZ_CP021003.1\|WP_033481904.1\|2680_3316_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NZ_CP021003.1\|WP_022560508.1\|11955_12579_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_022560536.1\|5519_5771_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_033481836.1\|9749_10025_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_022560534.1\|3328_3898_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|224629
NZ_CP021003.1\|WP_022560535.1\|5103_5451_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021003.1\|WP_022560507.1\|11078_11903_+\|DUF945-domain-containing-protein	gnl\|CDD\|377596	pfam06067, DUF932, Domain of unknown function (DUF932). Family of prokaryotic proteins with unknown function. Contains a number of highly conserved polar residues that could suggest an enzymatic activity.	5.44834e-67
NZ_CP021003.1\|WP_099800837.1\|6164_9671_+\|Avirulence-protein-AvrBs3	gnl\|CDD\|367468	pfam03377, TAL_effector, TAL effector repeat. The proteins in this family bind to DNA. Each repeat binds to a base pair in a predictable way. The structure shows that each repeat is composed of two alpha helices.	5.08951e-08
NZ_CP021003.1\|WP_022560509.1\|12575_12797_+\|DUF2688-domain-containing-protein	gnl\|CDD\|371287	pfam10892, DUF2688, Protein of unknown function (DUF2688). Members in this family of proteins are annotated as KleB however currently no function is known.	3.75212e-16
NZ_CP021003.1\|WP_022560534.1\|3328_3898_+\|restriction-endonuclease	gnl\|CDD\|224629	COG1715, Mrr, Restriction endonuclease [Defense mechanisms].	6.32737e-27
NZ_CP021003.1\|WP_033481904.1\|2680_3316_+\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	4.43486e-16

>NZ_CP021003.1|WP_033481904.1|2680_3316_+|DNA-binding-protein
MTKDQIWKIADQLDVDGVKPTLSAVRKKLGSGSYTTIQDAMNEWKQRKLQKTQPVVEPPPPDVVEAVGVLAAEIWTVARTAAERALAGDREKLAEEFTALQEQVRESLEVADQLNEEAELLRQQVAEGDAAKVERDQITAEHQAFKIRTAQEINRASEKAAAKDSEAIEARKSERIALEQAARLQGQVEALETQLAQLTAAIGSRVTGSKA
>NZ_CP021003.1|WP_022560534.1|3328_3898_+|restriction-endonuclease
MSWSQLFALFVGLAILAALAVVSALRPKARERRHRRRQDQARRVLAKINTIPLMPQRLAYLRKIDPLTFEELLLETFERRGYRVERNTHYTGDGGVDGAVYLNGTRYLLQAKRYRKHINRAHILAFAELLEARGSRGIFIHTGRTGAGARELATANPHLTIISGQRLLDFLNSGRLDRENANAHRTMGN
>NZ_CP021003.1|WP_022560535.1|5103_5451_+|hypothetical-protein
MGGGITDVSTLAREAGFKVPVAVTRAVWADCVAWSQDDTKRKRVPQDEEGRLWDVLFMARNFAARNAQANRVPFALHRVPREGQGHQARIVTLHMHIGGGDNGEPVITIMQPTED
>NZ_CP021003.1|WP_022560536.1|5519_5771_+|hypothetical-protein
MDQAKTAADNVRALIADHRRHERACRVHAARLRREAQQLRELPAGGARSLFRAHELARKAIALTEQADSDSAAAALLATPPQH
>NZ_CP021003.1|WP_099800837.1|6164_9671_+|Avirulence-protein-AvrBs3
MDPIRPRAPSPAHELLAEPQPDRVQPQPTADRGGSPPAGSPLDGLPARRTMSRTRLPSPPAPLPAFSAGSFRDLLRQFDPSLLDTSLFDSMSAFGAPHTEAASGEGDEVQSGLRAADDPQATVQVAVTAARPPRAKPAPRRRAAHTSDASPAGQVDLCTLGYSQQQQEKIKLKARPIVAQHHEALIGHGFTRAHIVALSQHPAALGTVAVKYQAMIAALPEATHEDIVGVGKQWSGARALEALLTVSGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGVPLNLTPDQVVAIASNIGGKQALETVQLLLPVLCEQHGLTPDQVVAIASNGGGKQALETVQRLLPVLCKDHGLTPAQVVAIANHDGGKQALETVQRLLPVLCKDHGLTPAQVVAIASNGGGKQALETVEQLLPVLCKDHGLTPDQVVAIANHDGGKPALETVQRLLPVLCQELGLTPDQVVAIASNIGGKQALETVQRLLPVLCQELGLTPDQVVAIASNGGAKQALETVQRLLPVLCQELGLTPAQVVAIASNIGGKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQALETVERLLPVLCQELGMTLAQVVAIASHYGGKQALEAVQRLLPVLCQELGLTPDQVVAIASNNGGKQALETVQRLLPVLCEQHGLTPDQVVAIASNGGKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQALETVERLLPVLCQELGMTLAQVVAIASNGGGKQALETVERLLPVLCQELGMTLAQVVAIASHYGGKQALEAVQRLLPVLCQDLGLTPDQVVAIASNNGGKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQALEAVQRLLPVLCQDHGLNPDQVVAIASNGGGRQALESIFAQLSRPDQALAALTNDHLVALACLGGCPALEAVKKGLPHALTLIKRTSRRLPERTSHRVADHAQVARVLGFFQCHSHPAQAFDEAMAQFAMSRHGLLQLFRRVGVTELEACNGTLPPASQRWHRILQASGVRTATPSRASAQTPDQASLDAFADALERGLDALSPIDQAVQAQASSRRKRSRSESSVTRSSAHYAVEVPVREQHAALDSLPPSWGAKRPRTRIGGGLADPGTPMHGDLAASSTVAWEHDAAPFAAAEAGDFPAFNDEEIAWLMELFPQ
>NZ_CP021003.1|WP_033481836.1|9749_10025_+|hypothetical-protein
MFFYTNPCRPSEPHFGVHLAAHVGDVSGPAYCTVRGVAALDVFVCSPAAVSADLAALVVAGGYYVLPLEAAAQLAADFALPVRTPPVIEGA
>NZ_CP021003.1|WP_022560507.1|11078_11903_+|DUF945-domain-containing-protein
MLASRFGRKSHGIRSAQPLTNDEIARFAPSIFANEAHESRSQRYTYIPTIDVLDGLRKEGFSPFMVVQTRTRNPDKREHTKHMIRMRHANQIQAGEANEIILLNSHDGSSSYQMLAGVFRFVCQNGMVVGDTVGDIRVPHKGDVISQVIEGAYQVVDSFAAADEQREGMQSLTLAEGEQTAFARAALALRYDDDTAPAPITEQQLLTPKRWEDRKPDLWTTFNRVQENMVRGGLRGRNAKGRPTTTRPVNGIDQSIKLNRALWVLAAEMRRLHH
>NZ_CP021003.1|WP_022560508.1|11955_12579_+|hypothetical-protein
MNTRNLSLPAVEDFKARFAGYIGAGLARISRQWKSAEAIELATRHSQFAIVALQANCLDAVSASLAEAAATGIRGDERDNPFKELRRDFEGEAKSLNLHFDEWSAEAETLAQAHGITYEPDAEEIPDDDTTWREALQDSTRGAGRKSGREMEAIPDFREEVPDFVEGYLQGLQQLEDQLRAAGELTDNIAEQITTLRQAATDSMTAL
>NZ_CP021003.1|WP_022560509.1|12575_12797_+|DUF2688-domain-containing-protein
MSKIITDVIETQCRRCSTPLRTLRRSPLGLDELKERLGSICTECVTAEERAEIAQAQIGALHLAAAIRRLQEE
>NZ_CP021003.1|WP_022560510.1|12801_13044_+|hypothetical-protein
MPDQIALLAQQLNEATRRGDLAGAYATLKGLRINDAARVALEAGFAVTSTQQRKPFFRQLECEIAEAARRRVDGWGLRPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021003_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021003_2

43734-43840

Orphan

Consensus_repeat	Method
GCGTTCAAGGTCCGTCCGTATTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021003_2

>merge|NZ_CP021003|2|43734-43840|CRISPRCasFinder
GCGTTCAAGGTCCGTCCGTATTACAGCTGACCAATCCAGCATGAGCGCCGGTATCGCCGGCACTGCTGATGGCGCTCAGTGTGGTGTTCAAGGTCCGTCCGTATTAC

>NZ_CP021003|2|2|43734-43840|CRISPRCasFinder
GCGTTCAAGGTCCGTCCGTATTAC	AGCTGACCAATCCAGCATGAGCGCCGGTATCGCCGGCACTGCTGATGGCGCTCAGTGTG
GTGTTCAAGGTCCGTCCGTATTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021003.1\|WP_007964456.1\|37734_38805_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_033482006.1\|40905_41460_+\|plasmid-pRiA4b-ORF-3-family-protein	unknown	unknown	gnl\|CDD\|377943
NZ_CP021003.1\|WP_017172484.1\|27016_27886_+\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|334588
NZ_CP021003.1\|WP_022560535.1\|47154_47502_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_011345585.1\|24008_25235_+\|IS256-like-element-ISXax1-family-transposase	unknown	unknown	gnl\|CDD\|225865
NZ_CP021003.1\|WP_022560525.1\|30025_30313_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_022560532.1\|44089_44413_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_022560529.1\|38889_40167_-\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|372592
NZ_CP021003.1\|WP_080720984.1\|34222_35770_+\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|372595
NZ_CP021003.1\|WP_033481941.1\|41885_42206_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_017163690.1\|25943_26618_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP021003.1\|WP_017172485.1\|27882_28884_+\|XcyI-family-restriction-endonuclease	unknown	unknown	gnl\|CDD\|286631
NZ_CP021003.1\|WP_022560536.1\|47570_47822_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021003.1\|WP_033481904.1\|44731_45367_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NZ_CP021003.1\|WP_022560534.1\|45379_45949_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|224629

Protein	Function_ID	Function_description	E-value
NZ_CP021003.1\|WP_022560534.1\|45379_45949_+\|restriction-endonuclease	gnl\|CDD\|224629	COG1715, Mrr, Restriction endonuclease [Defense mechanisms].	6.32737e-27
NZ_CP021003.1\|WP_033482006.1\|40905_41460_+\|plasmid-pRiA4b-ORF-3-family-protein	gnl\|CDD\|377943	pfam07929, PRiA4_ORF3, Plasmid pRiA4b ORF-3-like protein. Members of this family are similar to the protein product of ORF-3 found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumorigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process. Other proteins found in this family are annotated as being putative TnpR resolvases, but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor and in fact carries a LexA DNA binding domain (pfam01726), but no references were found to expand on this.	5.22139e-53
NZ_CP021003.1\|WP_017172484.1\|27016_27886_+\|site-specific-DNA-methyltransferase	gnl\|CDD\|334588	pfam01555, N6_N4_Mtase, DNA methylase. Members of this family are DNA methylases. The family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases.	8.39348e-57
NZ_CP021003.1\|WP_011345585.1\|24008_25235_+\|IS256-like-element-ISXax1-family-transposase	gnl\|CDD\|225865	COG3328, COG3328, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.46544e-129
NZ_CP021003.1\|WP_017163690.1\|25943_26618_+\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	8.96979e-58
NZ_CP021003.1\|WP_017172485.1\|27882_28884_+\|XcyI-family-restriction-endonuclease	gnl\|CDD\|286631	pfam09571, RE_XcyI, XcyI restriction endonuclease. This family includes the XcyI (recognizes and cleaves C^CCGGG) restriction endonucleases.	1.52993e-118
NZ_CP021003.1\|WP_033481904.1\|44731_45367_+\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	4.43486e-16
NZ_CP021003.1\|WP_080720984.1\|34222_35770_+\|HAD-hydrolase-like-protein	gnl\|CDD\|372595	pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase.	3.80632e-07
NZ_CP021003.1\|WP_022560529.1\|38889_40167_-\|lytic-murein-transglycosylase	gnl\|CDD\|372592	pfam13406, SLT_2, Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.	2.14807e-139

>NZ_CP021003.1|WP_033481941.1|41885_42206_+|hypothetical-protein
MIAIEPKALQEAADAHLVRGAEIRAAEDGEGLVVIVDLGEDRRVVGLARNRGVRYFQSFDGAAALLLERGISKFAANTVGWTPRTQPKWMKHRGHNCEGLIAAASI
>NZ_CP021003.1|WP_033482006.1|40905_41460_+|plasmid-pRiA4b-ORF-3-family-protein
MRNPTPVWRLKVELLGVAPAVWRRFDTHSDAKLAQLHYFIQGAMGWELMHLFSYQDGRGYGGAINSELRLCDVCRIGDALTYTYDFGDNWQHRVTVEKAMARPTGTYPCMVAGKYACPPEDCGGSWGYADLLRVLAGHRNARRRELIEWLGGPFDPKVFDMDEAQKRLSEYVEVSMPKNHQPTA
>NZ_CP021003.1|WP_022560529.1|38889_40167_-|lytic-murein-transglycosylase
MIMPSRLLRLSLGVSVCVAATSVAAQAIAPQTTASSATEVSAQQQDPAPTASFEQWLADFRQRALAAGIEATTLDNALAGVTPDPSVHELDQQQPEFTQYLWDYLDARVTPSAIQEGQQLLISQHALFQKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAALQILQTEKNIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAANYLKQSNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVAEWQRLGVAPHRPIAPTLAQQLASVLLPTGYRGPAFLVFDNFRSILRYNNSTAYALAVGLLADGYAGRAGVEQSWPKDDPPLNSTAQITELQQRLTDKGFDVGGIDGVLGARTRQGIRAFQRSQQLPQDGYASTSLLARLRAA
>NZ_CP021003.1|WP_007964456.1|37734_38805_-|hypothetical-protein
MGCTISTTNNAPHSPRQEDAPPLPPQTRQSFVGVVNGLLSDLPKRRRRGGLLSDPDISLAGYLLSKAVIGDPVEPQDIPRLHKANNTVQETRARFPYGRGNVATDIAVSDHASSQHAQAAHDVFVDLVRGAAPASMLTNPTLGHAVVSEFVQGGHCAGYAAVATMRHVQKLQPEESVHYVQHNHQGHDWAESRVPDGHHKTIVLDPWAQGPAVLASDSRFAANAQHTQERLALNAKDGDDIAAKTAAGAQYLLENCLPLTETHLKRLKAQEFHCAPEEVWQPQPVVSDAFRRRVRQGLATLTNSSELGLSQSEQSSKALKKMSIKSACALGFGKKAASAAAEDIAAAAYQLGEQSQ
>NZ_CP021003.1|WP_080720984.1|34222_35770_+|HAD-hydrolase-like-protein
MLAMEAAAKEAGVDVLALATLSAHPFSPQLTMSSEVSAFLDETLAAWDPQAKVTERLAAIGMPREKLTNSEAMILIAYAIDPASDSAISRFESIQNNLFERAHLHNVGIDPDAPDTLEKMQKLRSMQEMAGTDSARHFIDDAKVLEGEHDSLIPILKMKPASPDEIVKELDQVSLASRSSIQASEVKQVVVLDWDDCLRDEKGLNYKLMHNALAIAAREHASTLPELGDAVAVLHSKLNDAGPVDDEAPLLMKNQKDFSSYLMGRPSIYKRHIIEDFVRKMLPGISEHKAASINNAVYSNFVREYKRLVKPEISKKNYSRDVPFPDIELSLLPGAKEILEKSRNANSRVILISNRGHGDLENEINHLGMMHYFDVVSGAEEVTLEKSHFPPSQMPEDLQKRLINSLNGSDEEALRATLSETAIYAHPDSTAIGRIDKKPDSTRLAESLERLSVQPNVPITSYGDQPSDIKQLKNVAEPKSRVLKGVIVNAQRDDVGREIDVDGVPTRVVSKITEL
>NZ_CP021003.1|WP_022560525.1|30025_30313_-|hypothetical-protein
MGGAKRMMEEHDSKIAFATWLAIRARTLKKCEIHDEVLEGTGDIEAAYKLGNTEFSAGSLDGKFESRREMTDYIKEAVEENNSDECGACAKYRDD
>NZ_CP021003.1|WP_017172485.1|27882_28884_+|XcyI-family-restriction-endonuclease
MTTPNKINFPPPKLQIDFAFALKRFRAVYLQSALLETVRDMDIAELDRQLSKYVPPADLATLAQYGLRAELLFAVPAVLEANPHLLGYYRLLMGYSQKEFYGRDKGFGVGCFKSMEEKGKAGKAAVADLHDLCVAFCAAASALLAGVGPLRVSRELLDDLTLLTVGPQLRGGANNQRGADGIVLVFEIIREIVAHAAAEVRESAIEVNSATGRPVLIEFAPDPDIIIREEMEHQHYRNVVAIEVKSGTDVSNIHNRIGEAEKSHQKARQRGFTECWTVVNVGRLDMVKARSESPSTDRFYSLTALSLRAGDEYDDFRRRVLSLTAIPARPANP
>NZ_CP021003.1|WP_017172484.1|27016_27886_+|site-specific-DNA-methyltransferase
MERILRPEPLILRGSTLFEGDALTVLRRLPSGSVRCVVTSPPYWGLRDYGIEEQIGLEVTMPQFLHRLVAIFAEVKRVLTDDGTLWLNIGDGYTSGNRGYRAPDKKNPARAMDVRPDTPVGLKPKDLMGIPWRLAFALQDDGWYLRSDIVWNKPNAMPESVKDRPARSHEFLFMFTKSEKYFYDWQAAREPADGGGLRNRRSVWNVNTKPFAGAHFATFPPELIRPCIHASTEPGDYVLDPFFGSGTVGLVCQDENRQYVGIELNPEYVTLAAGRLQGQNSNVIKIAAA
>NZ_CP021003.1|WP_017163690.1|25943_26618_+|recombinase-family-protein
MARSPAEPFKVARIYQRVSTDGQDLTRQAAIVQEAKAAGFYVAGVYREKASGARADRPELLRMIEDLQSGEVVIAEKIDRISRLPLVEAERLVASIRAKGARLAVPGVVDFSEVAAEAKGVAKVVLESMQDMLLRIALQIARDDYEDRRERQRQGIELAKARDKYRGRPPDQAVHARIVALRSRGETIANTAHLAGASVTTVKRVWAAHCAQGHENGRLGRVIK
>NZ_CP021003.1|WP_011345585.1|24008_25235_+|IS256-like-element-ISXax1-family-transposase
MSPRTHEVPDELLSSLLVNYTKPEDLIGENGLLKQLTKRLVERALDAEMTEHLGHDKHEPVANAAGNTRNGRSRKTLKGEFGELPIEIPRDRHGSFAPQLIPKHQTRWAGFDDKILSLYARGMTVREIQSHLEEMYGTEVSPSLISSVTDAVVEEVKAWQARPLDPVYPIVYLDCIHVKVREGAVRVKAVYLAIGITMGGEKEVLGLWLAQAEGAKFWLQVVTELRNRGVQDIFIACVDGLKGFPEAIEAVFPQTTVQLCIVHMVRHSLNYVSWKRRAEVAADLKRIYACATVEEAEQALTEFEAKWDAQYPPISQSWRRNWSRLIPFFDYPPEIRKVIYTTNAIESVNMSLRKLTKNRGAFPSDEALMKLFYLALRNITKKWTLPIRDWKAALNRFTIQFEGRLPQR
>NZ_CP021003.1|WP_022560532.1|44089_44413_+|hypothetical-protein
MRPRKSFPPALLTELQTMPVPTALDLLGLYWKQDPDFQPLKDKATRRLYVSLGNGVVELLATGPKWFDTRADKGGGGAIDLAMYLMRLDFVSAVKQLDLAKGNPDRS
>NZ_CP021003.1|WP_033481904.1|44731_45367_+|DNA-binding-protein
MTKDQIWKIADQLDVDGVKPTLSAVRKKLGSGSYTTIQDAMNEWKQRKLQKTQPVVEPPPPDVVEAVGVLAAEIWTVARTAAERALAGDREKLAEEFTALQEQVRESLEVADQLNEEAELLRQQVAEGDAAKVERDQITAEHQAFKIRTAQEINRASEKAAAKDSEAIEARKSERIALEQAARLQGQVEALETQLAQLTAAIGSRVTGSKA
>NZ_CP021003.1|WP_022560534.1|45379_45949_+|restriction-endonuclease
MSWSQLFALFVGLAILAALAVVSALRPKARERRHRRRQDQARRVLAKINTIPLMPQRLAYLRKIDPLTFEELLLETFERRGYRVERNTHYTGDGGVDGAVYLNGTRYLLQAKRYRKHINRAHILAFAELLEARGSRGIFIHTGRTGAGARELATANPHLTIISGQRLLDFLNSGRLDRENANAHRTMGN
>NZ_CP021003.1|WP_022560535.1|47154_47502_+|hypothetical-protein
MGGGITDVSTLAREAGFKVPVAVTRAVWADCVAWSQDDTKRKRVPQDEEGRLWDVLFMARNFAARNAQANRVPFALHRVPREGQGHQARIVTLHMHIGGGDNGEPVITIMQPTED
>NZ_CP021003.1|WP_022560536.1|47570_47822_+|hypothetical-protein
MDQAKTAADNVRALIADHRRHERACRVHAARLRREAQQLRELPAGGARSLFRAHELARKAIALTEQADSDSAAAALLATPPQH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	7596-7654	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	60114-60172	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	CP020974	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence	12126-12184	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	30443-30501	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	35166-35224	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP020969	Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence	11009-11067	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP021020	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence	33204-33262	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012062	Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence	38762-38820	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	29272-29330	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012056	Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012054	Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	1706-1764	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	43758-43816	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012052	Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	CP021014	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence	31907-31965	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012059	Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence	38764-38822	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012065	Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence	40165-40223	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NZ_CP012050	Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence	40159-40217	1.0
NZ_CP021003_1	1.1\|1706\|59\|NZ_CP021003\|CRISPRCasFinder	1706-1764	59	NC_022542	Xanthomonas citri pv. fuscans plasmid plc, complete sequence	33981-34039	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	7596-7654	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	60114-60172	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	CP020974	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence	12126-12184	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	30443-30501	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	35166-35224	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP020969	Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence	11009-11067	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP021020	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence	33204-33262	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012062	Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence	38762-38820	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	29272-29330	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012056	Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012054	Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	1706-1764	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	43758-43816	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012052	Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence	36784-36842	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	CP021014	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence	31907-31965	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012059	Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence	38764-38822	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012065	Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence	40165-40223	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NZ_CP012050	Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence	40159-40217	1.0
NZ_CP021003_2	2.1\|43758\|59\|NZ_CP021003\|CRISPRCasFinder	43758-43816	59	NC_022542	Xanthomonas citri pv. fuscans plasmid plc, complete sequence	33981-34039	1.0

1. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

2. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

3. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to CP020974 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

4. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

5. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

6. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020969 (Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

7. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021020 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

8. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012062 (Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

9. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

10. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012056 (Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

11. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012054 (Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

12. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

13. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

14. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012052 (Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

15. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to CP021014 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

16. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012059 (Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

17. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012065 (Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

18. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012050 (Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

19. spacer 1.1|1706|59|NZ_CP021003|CRISPRCasFinder matches to NC_022542 (Xanthomonas citri pv. fuscans plasmid plc, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

20. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

21. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

22. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to CP020974 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

23. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

24. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

25. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020969 (Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

26. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021020 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

27. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012062 (Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

28. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

29. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012056 (Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

30. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012054 (Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

31. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

32. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

33. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012052 (Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

34. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to CP021014 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

35. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012059 (Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

36. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012065 (Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

37. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NZ_CP012050 (Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

38. spacer 2.1|43758|59|NZ_CP021003|CRISPRCasFinder matches to NC_022542 (Xanthomonas citri pv. fuscans plasmid plc, complete sequence) position: , mismatch: 0, identity: 1.0

agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	CRISPR spacer
agctgaccaatccagcatgagcgccggtatcgccggcactgctgatggcgctcagtgtg	Protospacer
***********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021001_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021001_1

2626296-2626447

Orphan

Consensus_repeat	Method
CCGGCGCGCGGCGGCGCGGCTGGGACTGCGCTCGCCTCGGGCTGCTGAGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021001_1

>merge|NZ_CP021001|1|2626296-2626447|CRISPRCasFinder
CCGGCGCGCGGCGGCGCGGCTGGGACTGCGCTCGCCTCGGGCTGCTGAGGCGCGGCAAAAGGTGGACGGGTTGGAGGTGCAGTAACCGTTGTTCACCCACCCGGCGCGCGGCGCCGCGGCTGGGACTGCGCTCGCCTCGGGCTGCTGAGGCG

>NZ_CP021001|1|1|2626296-2626447|CRISPRCasFinder
CCGGCGCGCGGCGGCGCGGCTGGGACTGCGCTCGCCTCGGGCTGCTGAGGCG	CGGCAAAAGGTGGACGGGTTGGAGGTGCAGTAACCGTTGTTCACCCAC
CCGGCGCGCGGCGCCGCGGCTGGGACTGCGCTCGCCTCGGGCTGCTGAGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021001.1\|WP_022559705.1\|2631000_2633139_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP021001.1\|WP_007966665.1\|2618255_2619836_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP021001.1\|WP_022559706.1\|2634704_2636399_-\|asparagine-synthase-B	unknown	unknown	gnl\|CDD\|236513
NZ_CP021001.1\|WP_022559700.1\|2621046_2622564_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP021001.1\|WP_022559696.1\|2611748_2613314_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340905
NZ_CP021001.1\|WP_022559702.1\|2624036_2626280_+\|DNA-topoisomerase-IV-subunit-A	unknown	unknown	gnl\|CDD\|235503
NZ_CP021001.1\|WP_022559695.1\|2611132_2611741_-\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|223777
NZ_CP021001.1\|WP_022559703.1\|2626609_2627266_+\|thiopurine-S-methyltransferase	unknown	unknown	gnl\|CDD\|183921
NZ_CP021001.1\|WP_096035446.1\|2627532_2628069_-\|bacterioferritin	unknown	unknown	gnl\|CDD\|153099
NZ_CP021001.1\|WP_022559707.1\|2636692_2637823_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
NZ_CP021001.1\|WP_033481301.1\|2638605_2639808_-\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	unknown	unknown	gnl\|CDD\|236996
NZ_CP021001.1\|WP_022559697.1\|2613677_2615447_+\|M14-family-metallopeptidase	unknown	unknown	gnl\|CDD\|349460
NZ_CP021001.1\|WP_022559709.1\|2639830_2642440_-\|[protein-PII]-uridylyltransferase	unknown	unknown	gnl\|CDD\|179839
NZ_CP021001.1\|WP_007966645.1\|2638060_2638417_-\|arsenate-reductase	unknown	unknown	gnl\|CDD\|239333
NZ_CP021001.1\|WP_022559699.1\|2619842_2621036_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090
NZ_CP021001.1\|WP_022559701.1\|2623123_2623975_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP021001.1\|WP_008576697.1\|2642436_2643213_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP021001.1\|WP_033481302.1\|2633584_2634637_+\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379079
NZ_CP021001.1\|WP_014089765.1\|2622560_2623001_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP021001.1\|WP_033481306.1\|2615624_2617814_+\|glycoside-hydrolase-family-3-protein	unknown	unknown	gnl\|CDD\|224389

Protein	Function_ID	Function_description	E-value
NZ_CP021001.1\|WP_022559705.1\|2631000_2633139_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	9.0805e-71
NZ_CP021001.1\|WP_007966665.1\|2618255_2619836_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	7.38793e-150
NZ_CP021001.1\|WP_022559706.1\|2634704_2636399_-\|asparagine-synthase-B	gnl\|CDD\|236513	PRK09431, asnB, asparagine synthetase B; Provisional.	0
NZ_CP021001.1\|WP_022559700.1\|2621046_2622564_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	1.11643e-148
NZ_CP021001.1\|WP_022559696.1\|2611748_2613314_-\|MFS-transporter	gnl\|CDD\|340905	cd17347, MFS_SLC15A1_2_like, Solute carrier family 15 members 1 and 2, and similar Major Facilitator Superfamily transporters. Solute carrier family 15 member 1 (SLC15A1) and SLC15A2 are members of the proton-coupled oligopeptide transporter (POT) family of integral membrane proteins that mediate the cellular uptake of di/tripeptides and peptide-like drugs. They mediate the proton-coupled active transport of a broad range of dipeptides and tripeptides, including zwitterionic, anionic and cationic peptides, as well as a variety of peptide-like drugs such as cefadroxil, enalapril, and valacyclovir. SLC15A1, or peptide transporter 1 (PepT1), is primarily expressed in the brush border membranes of enterocytes of the small intestine and is also known as the intestinal isoform. SLC15A2, or peptide transporter 2 (PepT2), is abundantly expressed in the apical membrane of kidney proximal tubules and is also referred to as the renal isoform. Both proteins transport di/tripeptides, but not tetrapeptides or free amino acids, using the energy generated by an inwardly directed transmembrane proton gradient. The SLC15A1/SLC15A2-like group belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.9444e-76
NZ_CP021001.1\|WP_022559702.1\|2624036_2626280_+\|DNA-topoisomerase-IV-subunit-A	gnl\|CDD\|235503	PRK05561, PRK05561, DNA topoisomerase 4 subunit A.	0
NZ_CP021001.1\|WP_022559695.1\|2611132_2611741_-\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|223777	COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism].	1.06644e-19
NZ_CP021001.1\|WP_022559703.1\|2626609_2627266_+\|thiopurine-S-methyltransferase	gnl\|CDD\|183921	PRK13255, PRK13255, thiopurine S-methyltransferase; Reviewed.	1.19368e-128
NZ_CP021001.1\|WP_096035446.1\|2627532_2628069_-\|bacterioferritin	gnl\|CDD\|153099	cd00907, Bacterioferritin, Bacterioferritin, ferritin-like diiron-binding domain. Bacterioferritins, also known as cytochrome b1, are members of a broad superfamily of ferritin-like diiron-carboxylate proteins. Similar to ferritin in architecture, Bfr forms an oligomer of 24 subunits that assembles to form a hollow sphere with 432 symmetry. Up to 12 heme cofactor groups (iron protoporphyrin IX or coproporphyrin III) are bound between dimer pairs. The role of the heme is unknown, although it may be involved in mediating iron-core reduction and iron release. Each subunit is composed of a four-helix bundle which carries a diiron ferroxidase center; it is here that initial oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of ferric-hydroxyphosphate at the core. Some bacterioferritins are composed of two subunit types, one conferring heme-binding ability (alpha) and the other (beta) bestowing ferroxidase activity.	4.21023e-63
NZ_CP021001.1\|WP_022559707.1\|2636692_2637823_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP021001.1\|WP_033481301.1\|2638605_2639808_-\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	gnl\|CDD\|236996	PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional.	4.37952e-179
NZ_CP021001.1\|WP_022559697.1\|2613677_2615447_+\|M14-family-metallopeptidase	gnl\|CDD\|349460	cd06241, M14-like, Peptidase M14-like domain; uncharacterized subgroup. Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavage. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	4.99188e-87
NZ_CP021001.1\|WP_022559709.1\|2639830_2642440_-\|[protein-PII]-uridylyltransferase	gnl\|CDD\|179839	PRK04374, PRK04374, [protein-PII] uridylyltransferase.	0
NZ_CP021001.1\|WP_007966645.1\|2638060_2638417_-\|arsenate-reductase	gnl\|CDD\|239333	cd03035, ArsC_Yffb, Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.	7.61446e-49
NZ_CP021001.1\|WP_022559699.1\|2619842_2621036_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	5.24151e-133
NZ_CP021001.1\|WP_022559701.1\|2623123_2623975_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	3.86016e-26
NZ_CP021001.1\|WP_008576697.1\|2642436_2643213_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	4.27618e-171
NZ_CP021001.1\|WP_033481302.1\|2633584_2634637_+\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|379079	pfam13229, Beta_helix, Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.	3.75594e-18
NZ_CP021001.1\|WP_014089765.1\|2622560_2623001_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	9.78725e-17
NZ_CP021001.1\|WP_033481306.1\|2615624_2617814_+\|glycoside-hydrolase-family-3-protein	gnl\|CDD\|224389	COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism].	1.83691e-73

>NZ_CP021001.1|WP_022559702.1|2624036_2626280_+|DNA-topoisomerase-IV-subunit-A
MTDLTRPTFHGFEQLPLREYAERAYLDYSMYVVLDRALPFLGDGLKPVQRRIVYAMSELGLNAAAKPKKSARTVGDVIGKYHPHGDSACYEALVLMAQPFSYRYPLIEGQGNFGSTDDPKSFAAMRYTESKLTPIAEVLLGELGQGTTDWAPNFDGTLEEPTWLPARLPHLLLNGTTGIAVGMATDVPPHNLNEIVSALLRLLDDPDASVADLCEHVLGPDYPTTAEIITPAADLRNIYETGHGSVRARATYKKEHANIVIDALPYQVSPSKVIEQIAQQMRAKKLPWLEDIRDESDHTSPVRVVLVPRSNRVDAEQLMGHLFVTTDLERSYRVNLNVIGLDGRPQVKNLKHLLSEWLSFRSDTVTRRLNHRLQKVERRLHLLEGLLIAFLNLDEVIRIVRSEDEPKPVLISRFALSEEQAEYILETKLRQLARLEEMKIRGEQEALAKERAQIIAILESKTKLKKLIKDELTADAKKFGDARRSPLVQRGAAQAIDETEMVASEPMTVVLSQKGWVRAAKGHEVDPAGMSYRDGDGLLAAVRSRSTHQVAFLDSDGRAYSTAVHTLPSARGNGEPLTGRFSPASGAAFQVMASADNATRFVLASSHGYGFVTRFENLTGRNKAGKAMLNLTTGSHVLTPAQVSNPQTDRIVAVTSAGNLLAVPATDVPELDKGKGNKIIEIPKAKLGTERVVAVVAVAPGNTLLVRSGARTMSLSFKDLDTYVGARASRGSLLPRGWQKVDGLEVQ
>NZ_CP021001.1|WP_022559701.1|2623123_2623975_+|helix-turn-helix-transcriptional-regulator
MSIENPPTQIDALPPGVRASFEKADGPVLIAFLAELREVWAPETAWHAHVRGQLMYVEHGVLTVHTEQGALSLPPGCAGWMPPGQQHTVELAGPMRGWGVVVRPDACAALPAQGGVIRLTGLAREAIMRAASWPLDQPLDATRQRLAAVLLDELCQVQIDHLHLPMPADRRLLRIARQLLDTPADPRPLDAWANWGGLSPRSLSRHFRDETGLSFAQWRQQARLTEGLRRLSQGHAVAQVSDQLGYSSPSAFVSVFHRHFGAPPTRYLAGSHARGLASPAASG
>NZ_CP021001.1|WP_014089765.1|2622560_2623001_-|MarR-family-transcriptional-regulator
MNVSSSATPSFGLLLRQVRDALMRQLDAEMKGELPDFGFSHYVGLKILAVRSPCTANELALALDQTPSAVTRLLDKLEALGAVRREPHAQDRRALQIVMTEQGVALWERLRLRGERAIEHGLRDLSAAERELLTSLLIRVRDALNS
>NZ_CP021001.1|WP_022559700.1|2621046_2622564_-|efflux-transporter-outer-membrane-subunit
MNVASSPTPTLRPRSMRLARPFVITALALALAACASSRGLNPQGNVLDPGTLHAERALAQQTTLSPAAWPASDWWRALGDAQLDALIAEGLQHSPSLAAADARLRQAQARIGSAQAERGPSLSVSGGYTGLQLPESMVGEELGGSYGGSAQVVLDFRYGIDLWGGKRSAWEAAVDQAHAAEVDAQAARLNLSSAIAEGYAQLAYAWSLHDLANDELSRAQKTLELTRQRRSAGIDSELQVRQAQARVPAAQQQLQSAQQQIDEARTALAALVGQGPDRGLDIARPVFGAGLATQLPSMLPADLLGRRPDVVAARWRVEAADKDIAVAKTRFYPSLNLTALGGVINPDVGKLLESGSVLGLVAPALSLPIFDGGKLRANLAGSDAQYDLAVANYNQKVISALREVADQVTAVRSLEQRAQAQNDAVQTATAAFDLAQQRYRAGIGSYLDVLSVQEQLLVARQRLAGLQSQQLLASVRLQRALGGGFTPEPARDTAHTAPTSAQPNS
>NZ_CP021001.1|WP_022559699.1|2619842_2621036_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MSQTTSTSPQPAPAAPSKRRAALRIVAIVVILAIIGLVVWYFLVGRWHEGTDDAYVQGNQVQITPMVGGTVVSIGAEDGMRVERGQLLVQLDPADTEVAVQQAEANLAKTVRQVRGLYRTVEGAQAELSAREVTLRSARSDFARRKDLAATGAISNEELAHARDELAAAEAAVSGSRESLERNRALVDDSAVANQPDVQTAAAQLRQAYLNHARTGVVAPVSGYVARRSAQVGQRVQPGSVLMAVVPLEQVWVEANFKETQLKHMRLGQEVELHSDLYGGGVSYTGRILSLGLGTGSAFSLLPAQNASGNWIKIVQRVPVRIAVDSEQLASNPLRIGLSMKVEVNLHDQQGSVLPTKVANGAVFATDVYAQQLKAADADIQRIIQDNLPSQAASKAG
>NZ_CP021001.1|WP_007966665.1|2618255_2619836_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MSSQAPTAPGGPAAPAPAAGFRPASVALCTVGLAMASFMQVLDTTIANVSLPTIAGNLGASSQQATWVITSFAVSTAIALPLTGWLSRRFGETKLFVWSTLAFTIASLLCGLAQSMGMLVVARALQGFVAGPMYPITQSLLVSIYPREKRGQALALLAMITVVAPIAGPILGGWITDNYSWEWIFLINVPLGIIASSIVGSQLRHRPEQLEKPRMDYIGLILLVVGVGALQLVLDLGNDEDWFSSDKIVVLACIAAVALVVFVIWELTDKDPIVDLKLFRHRNFRAGTLAMVVAYAAFFSVSLLIPQWLQRDMGYTAIWAGLATAPIGILPVLMTPFVGKYALRFDLRMLATIAFVFMSFTSFFRSNFNLQVDFGHVATIQLVMGVGVALFFMPVLQILLSDLDGREIAAGSGLATFLRTLGGSFAASLTTYLWARRTQVHHAHITEHISVYTPGMQEQVTAMGQGDLQRGAASLNNMINHQASQMGFNDIFYLLGWTFLAIIFFLWLAKPPFGAGAGSAAAAGGH
>NZ_CP021001.1|WP_033481306.1|2615624_2617814_+|glycoside-hydrolase-family-3-protein
MGLGIALAAPLAVAQGAPSSQPWMDTALTSDQRADRLLAQMSEDEKFQMLRSYFGLGTDKIPKPEGALGSAGYVPGIPRLGIPAQQLADAGVGVTNPGGIRKGDYATAMPSGPSTASSWNRQLAYTGGKTMGRESWQQGFNVLLAGSVNLQRDPRNGRNFEYAGEDPLLAGTMVGESIRGVQSEHVLSTMKHFALNDMETRRNFHSAQIGEQAMHESDLLAFEIALKIGDPASVMCSYNKINGVYGCEHDYLLNQVLKQEWKYPGYVMSDWGGVHSGSKAALAGLDQQSAGEVFDAAVYFDAPLRMAVSAGVVPRARLDDMVRRVLRSLFAHGAFDHPTQRQSIDGKAGLLAAQRVAEEGSVLLRNEQAALPLSKDVRRIAVIGGYADKGVMSGGGSSRVDYTINGGNAVPGITPTTWPGPVIIHPSSPLQALRTALPNVQIDYLDGTDRTAAARAAKAADVAIVFATQWAAESVDLPDMRLPDNQDALIETVAKANPKTTVVLETNGPVRMPWAERVPAVLQAWYPGIGGGEAIANLLTGAVNPSGHLPVTWPVDESQLPRPSIPGLGFKPAKPGEDSIDYAIEGANVGYKWFAARKLTPRYPFGHGLSYTQFRMGGLRVDARGSQLTASFEVENTGPREGAAVPQLYVALPDGHATPLRLIGWQKLTLKPGEKRSVQVVAEPKTLADFDAEARRWTIAAGTYRLQLARSASEPVQTAQVTLQAAQLP
>NZ_CP021001.1|WP_022559697.1|2613677_2615447_+|M14-family-metallopeptidase
MPRFTRLALSLLLLTSAPAALAAAPLTTQAERSGFIQTGRYDEVIALCDAFAQRYPQAVRCIQFGTTPEGRPMKALIASTSGALDPQSAAQRKLPVVLVQGGIHAGEIDGKDAGFLALRELLDGKAGHGVLDKLVWVFVPVFNVDGHERFGAWNRPNQRGPEQMGWRTTAQNLNLNRDYVKADAPEMQAVLQLVQQWDPLMYVDLHVTDGAKFEHDVSVQVEPVHAGDTTLQRDGTRWRDAVLADLKKQGSLPLPYYPSFVHEDDPSSGFADDVSPPRFSHGYFLLRNRFGMLVETHSWKDYPTRVRITRNAIVSVLQQAARNGAQWRTDALAADQRATHLAGTSEPLSFAAGPEARTVAFRGYAYTRTSSPISGALMTRYDESKPQVWKVPLRDQIKPDVVVDAPRGGYLVPAAQAALVGGKLRLHGIQFTTIGTAAERPVQTFRADAVKFAARSNESHQTVEVNGQWRDETRNVPAGSLFVPIAQPKARLVMAILEPQAPDSLLQWGFFNTAFERKEYMEAYVAEEVARDMLAKDAALKTQFEQRIASDPDFANNPQARLEFFAKRHASWDERYQLYPVLRTAQTDF
>NZ_CP021001.1|WP_022559696.1|2611748_2613314_-|MFS-transporter
MTTSISPGASAGARLPLQIPFIIGNEACERFSFYGMRNILVQFLITSLLLQEISGPGREAEAKHILHSFMIGVYFFPLLGGWLADRFFGKYNTILWFSLVYCAGHACLALFEGSRDGFFLGLGLIALGAGGIKPLVASFMGDQFDQSNKHLAKVVFDAFYWIINFGSLFASLLIPLALKNLGPAWAFGVPGILMFVATLVFWLGRKRYVLVPLPPKDPHGFAAVVRTALLTHAPGQGRPGLMLAVVSVLLALAGFALVEPLGIVVCLCIALVLLLAGIGGGTWWQLERARGTHPDVAVEGVRALLRVLVIFALVTPFFSLFDQKASTWVLQGREMTMPAWFTASQMQALNPLLVMLLIPFNNLVLYPLLRRGGWEPTPLRRMTSGIAFSGVAWIAVGAIQMIMDGGEPMHIAWQILPYALLTFGEVLVSATGIEFAYSQAPPSMKGVVMSFWYLMTTVGNLWVLLSNVAVRNATVTAHIADTGLSEAAFLMFFFAAFAFLAALAFGLYARRYRMVDNYRTA
>NZ_CP021001.1|WP_022559695.1|2611132_2611741_-|rhomboid-family-intramembrane-serine-protease
MITLILIAITGIVSWMAFNNRKLSDRLILWPPAVDKHRQYDRLVTYGFIHADLGHLIFNMITLFFFGRVIENVMAQLTGSVLTYPLFYLAALVVSILPSYLKNQKNPNYLSLGASGAVSAVLFAFILLQPWTIILVLFIPAPAILYAVFYVGYSLWMDRRGGDRINHSAHLAGAAFGVMFMLIMEPRVWQVFLEQLSNPRLG
>NZ_CP021001.1|WP_022559703.1|2626609_2627266_+|thiopurine-S-methyltransferase
MDTNFWLERWQLGHTGFHQQEVLPLLQKHWHALDLPKESRVLVPLCGKTLDMHWLAAQGHRVLGVELSQLAVTQFFDEAGLQPQRHTSAAGEHFIAGPIEIICGDAFALDASVLADCTAVYDRAALVALPADLRLRYLQTVYAQLPTHCRGLLITLEYPQAETAGPPFSVDATHVHALFDAAWQVDQLERRDILDQEPRFRDEGVTGLSTAVYRLQRR
>NZ_CP021001.1|WP_096035446.1|2627532_2628069_-|bacterioferritin
MPGGLGHHARTASLEHTMKGHPEVVDYLKQLLRGELAARDQYFLHSRRYEDQGLMALYERINHEMEEETEHADALLRRILFLEGDPDMRPAQFTPGKTVVEMLERDLVVEYEVRAALAAGMKLCEEHGDYVSRDVLLKQLQDTEEDHAWWLEQQLGLIKRIGLELYQTSKIDKGHIAG
>NZ_CP021001.1|WP_022559705.1|2631000_2633139_+|TonB-dependent-siderophore-receptor
MRPTLLVTALAAALALHTLPALAQHTTTPAVTELDGVDVIGRAQTLYKSEDAAVATRTDTPLALVPQSVQVLPRELIDDQAARQITDLYRSISGISFFSYAGVTLRGFRQENVLYDGLRGDPYAGFSVPQLFNIERVEVLKGPAGALYGGGEPGGVINYVTRKPGHQAARRIELQLGNQSFGAASFEATGPAREDGRIRYRIGAYADGEDGFRWNTDSQSQIGDASVAFDLGDTGELTLQYTDITQNLGGNRLRGVPVDNDGNFLTDRRWNHNEPTDFLDMRAKVALAQYRFAPSSAWEVDMALRWFKNQEHQIYHEPMGLIDRDRDGTAEWMTRQLRNQYRDNDAISSNVNAVFRTSTAAIEHKLLMGADYYRLDADFRAQTANTADTGRVRGPVPGIDLFNPVYGRSGFYDYGLDALPWRATSTRSQRYGAYLQDELTLAPRWYAMAGVRWDGFKDDNLLDGSRVTGNDLSWRVGSTVVLREGVNAYASYASGFLPQDAANQDSSVGGPFDPERSTQWEIGLKTALNDGGLTLNTALYRIERSNIVQANGSIVAGVNQLSALGLVRSEGLEVDLLADLTERWVLNLTYAYNDARVLDAGTNGITNASGDRFANAPRNTFGLWTRYDLPMWRSAIAFGADYVGERVSLDGQRVKPYAIYDISWQTQWDAWKLQINVKNLFDKVYAVSGFNTRAGHFPGEPRRIYAQLAYSF
>NZ_CP021001.1|WP_033481302.1|2633584_2634637_+|right-handed-parallel-beta-helix-repeat-containing-protein
MPLLARSVSALLPLMFATACSAAAPAKSGPPDAPVAACTAKVRPGQDLQKAIDKLPQSDKPTVLCLEKGEFPLNGLVSIHRGNFTLRGQGPSTIVRMADGVQQPVLVVGDYENQQPTGVIRNVSIEDMQIVASTGDKEFMPERPYLSNSAVVVRSGQGIRLAGLQVNKCRSACLLSEYDTREITIENNDVSGAIWDGVSFNRTAKVTMVNNYIHDNVAAGLTTEHLEDSEIRNNRFERNGSQGIYLSDARRNRFSNNQFDGNKVAGVFLACAIRYRTPEILCWDNSMSQDNIFENNRFANTPFTYTIGVDRAANCTAADFKPNLWRNNQADMAGVDIDPQRYGYCVRHEQ
>NZ_CP021001.1|WP_022559706.1|2634704_2636399_-|asparagine-synthase-B
MCSIFGIFGLQPGDDLQALRRQALECSQRQRHRGPDWSGVYVDTGAILVHERLAIVDPAGGSQPLLSEDGQLALAVNGEIYNHRELKAELLQPYAFQTGSDCEVINALYREDTPASYLNRLNGIFAFALWDKTEGRVIIARDPIGVVPLYWGHDREGRLRVASELKSLVDDCADAAQFPPGHWYDSATGALNRYYERAWRQYGAVEGVQVQLQELREAFERAVHRQLMTDVPYGVLLSGGLDSSLVAAVAARYARHRIEENDTTEAWWPRLHSFAIGLKGSPDLAAAEVAAAALGTVHHGFEYTFDEGLDALPDVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGGYLYFHKAPNAREFHEELVRKLDALNNYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRMDARFKMIDKTSSGATRMEKGVLREAFAGYLPESILWRQKEQFSDGVGYGWIDGLKAHAQAQVSDRELAAADRRYPVNPPQTKEAYFYRSLFEQFFPGQAAAETVPGGKSIACSSPTAIAWDASFAAMADPSGRAIAGVHAQALAS
>NZ_CP021001.1|WP_022559707.1|2636692_2637823_-|succinyl-diaminopimelate-desuccinylase
MSDVLELTCDLIARASVTPMDAGCQAAIAQRLRAAGFSCEHLRLGEVENLWATHGRGAPVLVLLGHTDVVPPGPREAWTSNPFDPQIRDGVLYGRGAADMKGSVAAFVVAAEQFVAAHPSHTGTLAVLLTSDEEGDAIDGVRRVAEVFRERGQTIDWCITGEPSSTERLGDLLRVGRRGSLSGTLTVKGVQGHVAYPHKARNPIHLAAPALAELVARQWDDGFESFPPTSLQLSNIHAGTGANNVIPGELQVAFNLRYTPHWDAPRLEAEITALLDRHALDYALRWHRSGEPFYTPEGRLRSVAREVLGEFAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDEHVRVADLQALPALYRKLIERLLVG
>NZ_CP021001.1|WP_007966645.1|2638060_2638417_-|arsenate-reductase
MTTLYGLKNCDTCKKATKWLDRFGVAYTFVDYRDHKPEPQTLVGWAEQVGGFDALINKSSTTWRQLPDNRKVAGSAAEWKLLLREYPQLIRRPLVITDDGALHQGFSDNGFKKLFGIG
>NZ_CP021001.1|WP_033481301.1|2638605_2639808_-|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase
MATSKKTAPKQSATTTTNAASKRANAPSGKAAKVPAAADSKPGVGVGKQGAAAGAVGKKTAASDAASPKTVAKKTGAKTATSAAPRVARQPTKVVAAPAAKKAAAAKKLPIAEQAVHSAATQVGSDELKLGIESAFERRATLTMDEIDGSTRAIVTRVVDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLYFRVNEMAVIDAQPAPFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLMPSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFIGARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKDGSHSLYCAVIVKQVDAKTRSKTSVNELLRGLAD
>NZ_CP021001.1|WP_022559709.1|2639830_2642440_-|[protein-PII]-uridylyltransferase
MTATPAERPDPGVAGDADWAAQARPLLVHADMRLCKRFDQGEPIERLVALRARAVDQLMRNAWMRCIPADSGLSLHAVGGYGRGELFPRSDVDVLVLGDTAAQQQHEQALARLFALLWDVGLPISHAVRSPAQCTAAAADQTVLTALIESRALVADAHARGALAAAIAPPQVWPPRDFFQAKREELLARHQRFGDTADNLEPDIKDGPSGLRDLQTLGWMALRAFGVKDLEALVGLGHVGFDEAAALRREREELARLRFGLHIVANRPEERLRFDYQKTLAERLGFADDRESLGVEKMMQRFYRSAALIRRISDRLLQRFEEQFDGEATPEPLGGGFSLRRGYLAADPESWPDGDVLQVFALFAQWAAHREVRGLHSLTARALAEVLRDLPAYEVADATARERFMALLRGPRAVETLNRMARLGVLGQWIPAFASVSGRMQFDLFHVYTVDQHTLMVLRNIALFAAGRADERFSIAHEVWPRLRKPELLLLAGLFHDIAKGRGGDHSELGAVDARAFCLAHRLSEGDTELVTWLVEQHLRMSVTAQKQDISDPEVIHRFATLVGTRERLDYLYLLTCADIAGTSPKLWNAWKDRLLADLYFAARRALREGLEHPPPREERLREARESARTLMQAQGHDDVTIDRQFAGMPDENFLRFRPEQLAWQAASLIEVEIGQTLVKARRAVPDNDALEVFVYSPDRDGLFAAIVATLDRKGYGIHRARVLDAPHDAIFDVFEVLPQETYADGDPQRLAATLRQVLAGDLQKVRPARRAVPRQLRHFRFAPRVEFSESAGGRRTRISLVAPDRPGLLADVAHVLRMQHLRVHDARIATFGERAEDQFQITDEHDRPLSESARQALRDALCACLDPV
>NZ_CP021001.1|WP_008576697.1|2642436_2643213_-|type-I-methionyl-aminopeptidase
MSVNLKTKEEIELMRVAGRLAAEVLDVVAPHVKPGVTTAELDRICHDHIVNVQGTIPANVGYRGFPKSVCTSVNNVICHGIPSAAKVLKDGDIVNIDVTVIKDGWHGDTSRMYYVGTPSVMAKRLVETTYEAMWRGIRAVKPGATLGDVGHAIQKFAEAERFSVVRDYCGHGIGKVYHDEPQVMHYGRPGEGLVLKPGMTFTIEPMINEGTYHHKTLPDGWTVVTKDRKLSAQWEHMVAVTEDGVDVLTLSANSPAPV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021001_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021001_2

4111215-4111562

Orphan

Consensus_repeat	Method
NTGGAAACGGTCAACGGC	CRT
GGCGGGCTGGAAACGGTCAACGGCAGCATC	CRISPRCasFinder
TGGAAACGGTCAACGGCTCCATC	PILER-CR

6 spacers

WYL

The CRISPR arrays of NZ_CP021001_2

>merge|NZ_CP021001|2|4111215-4111562|CRT,CRISPRCasFinder,PILER-CR
GTCAGCAAGGTCAACGGCAAGATCAGCGCAGATGCCGGCAAGACCTATGGCGCCCTGGAAACGGTCAACGGCTCCATCGAGATCGGTGCCGGTGCGCAAACCAAGAATGTGGAAACCGTCAACGGCGGCATCCGCATCGGCGACAACGCGCGTACCGGGGGCGTGGAAACGGTCAACGGCTCGATCACGCTGGGCCAGAAGGTGATCGTGTCCGGCGGGCTGGAAACGGTCAACGGCAGCATCCTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGGGTGGAAACGGTCAACGGCAGCATCGGGCTGGTGGGAACCGAGCTCGGCAAGGGCATCGAGACGGTCAATGGC

>NZ_CP021001|2|1|4111215-4111562|CRT
GTCAGCAAGGTCAACGGC	AAGATCAGCGCAGATGCCGGCAAGACCTATGGCGCC
CTGGAAACGGTCAACGGC	TCCATCGAGATCGGTGCCGGTGCGCAAACCAAGAAT
GTGGAAACCGTCAACGGC	GGCATCCGCATCGGCGACAACGCGCGTACCGGGGGC
GTGGAAACGGTCAACGGC	TCGATCACGCTGGGCCAGAAGGTGATCGTGTCCGGCGGG
CTGGAAACGGTCAACGGC	AGCATCCTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGG
GTGGAAACGGTCAACGGC	AGCATCGGGCTGGTGGGAACCGAGCTCGGCAAGGGC
ATCGAGACGGTCAATGGC

>NZ_CP021001|2|2|4111263-4111514|CRISPRCasFinder
GGCGCCCTGGAAACGGTCAACGGCTCCATC	GAGATCGGTGCCGGTGCGCAAACC
AAGAATGTGGAAACCGTCAACGGCGGCATC	CGCATCGGCGACAACGCGCGTACC
GGGGGCGTGGAAACGGTCAACGGCTCGATC	ACGCTGGGCCAGAAGGTGATCGTGTCC
GGCGGGCTGGAAACGGTCAACGGCAGCATC	CTCGCCGAGCGCGGCAGCCAGATCAGT
GGCGGGGTGGAAACGGTCAACGGCAGCATC

>NZ_CP021001|2|1|4111270-4111400|PILER-CR
TGGAAACGGTCAACGGCTCCATC	GAGATCGGTGCCGGTGCGCAAACCAAGAATG
TGGAAACCGTCAACGGCGGCATC	CGCATCGGCGACAACGCGCGTACCGGGGGCGTGGAAA
CGGTCAACGGCTCGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021001.1\|WP_022557792.1\|4114072_4114516_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|379323
NZ_CP021001.1\|WP_007968176.1\|4114811_4115945_-\|glycoside-hydrolase-family-5-protein	unknown	unknown	gnl\|CDD\|365907
NZ_CP021001.1\|WP_022557799.1\|4127711_4128092_-\|proteinase-inhibitor	unknown	unknown	gnl\|CDD\|288556
NZ_CP021001.1\|WP_022557788.1\|4108124_4109648_-\|S41-family-peptidase	unknown	unknown	gnl\|CDD\|223864
NZ_CP021001.1\|WP_033481293.1\|4109752_4110988_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227278
NZ_CP021001.1\|WP_033481284.1\|4106649_4106970_+\|DUF1820-family-protein	unknown	unknown	gnl\|CDD\|370154
NZ_CP021001.1\|WP_022557791.1\|4111966_4113763_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349910
NZ_CP021001.1\|WP_022557800.1\|4128148_4129426_+\|DNA-topoisomerase-IB	unknown	unknown	gnl\|CDD\|226099
NZ_CP021001.1\|WP_022557782.1\|4100747_4101473_+\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP021001.1\|WP_022557787.1\|4106969_4107962_+\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP021001.1\|WP_033481282.1\|4101521_4101887_+\|DUF1330-domain-containing-protein	unknown	unknown	unknown
NZ_CP021001.1\|WP_022557784.1\|4102010_4103138_-\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP021001.1\|WP_033481283.1\|4103322_4104024_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|379309
NZ_CP021001.1\|WP_022557794.1\|4118411_4119485_-\|glycoside-hydrolase-family-5-protein	unknown	unknown	gnl\|CDD\|365907
NZ_CP021001.1\|WP_003482177.1\|4105848_4106541_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP021001.1\|WP_022557798.1\|4123036_4127509_-\|glutamate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236968
NZ_CP021001.1\|WP_022557797.1\|4121433_4122915_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273553
NZ_CP021001.1\|WP_022557795.1\|4119794_4120853_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NZ_CP021001.1\|WP_007968187.1\|4104288_4105629_-\|outer-membrane-protein-transport-protein	unknown	unknown	gnl\|CDD\|367457
NZ_CP021001.1\|WP_022557793.1\|4116582_4117635_-\|glycoside-hydrolase-family-5-protein	unknown	unknown	gnl\|CDD\|365907

Protein	Function_ID	Function_description	E-value
NZ_CP021001.1\|WP_022557792.1\|4114072_4114516_-\|PepSY-domain-containing-protein	gnl\|CDD\|379323	pfam13670, PepSY_2, Peptidase propeptide and YPEB domain. This region is likely to have a protease inhibitory function (personal obs:C Yeats). The name is derived from Peptidase & Bacillus subtilis YPEB.	3.65725e-05
NZ_CP021001.1\|WP_007968176.1\|4114811_4115945_-\|glycoside-hydrolase-family-5-protein	gnl\|CDD\|365907	pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5).	9.71902e-58
NZ_CP021001.1\|WP_022557799.1\|4127711_4128092_-\|proteinase-inhibitor	gnl\|CDD\|288556	pfam11720, Inhibitor_I78, Peptidase inhibitor I78 family. This family includes Aspergillus elastase inhibitor and belongs to MEROPS peptidase inhibitor family I78.	1.35722e-19
NZ_CP021001.1\|WP_022557788.1\|4108124_4109648_-\|S41-family-peptidase	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	2.31526e-128
NZ_CP021001.1\|WP_033481293.1\|4109752_4110988_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	3.65433e-91
NZ_CP021001.1\|WP_033481284.1\|4106649_4106970_+\|DUF1820-family-protein	gnl\|CDD\|370154	pfam08850, DUF1820, Domain of unknown function (DUF1820). This family includes small functionally uncharacterized proteins around 100 amino acids in length.	2.27778e-52
NZ_CP021001.1\|WP_022557791.1\|4111966_4113763_+\|M28-family-peptidase	gnl\|CDD\|349910	cd05660, M28_like_PA, M28 Zn-peptidase containing a protease-associated (PA) domain insert. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This subfamily is composed of uncharacterized proteins containing a protease-associated (PA) domain insert which may participate in substrate binding and/or promote conformational changes, influencing the stability and accessibility of the site to substrate.	8.64928e-123
NZ_CP021001.1\|WP_022557800.1\|4128148_4129426_+\|DNA-topoisomerase-IB	gnl\|CDD\|226099	COG3569, COG3569, Topoisomerase IB [DNA replication, recombination, and repair].	2.14223e-108
NZ_CP021001.1\|WP_022557782.1\|4100747_4101473_+\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	2.89977e-55
NZ_CP021001.1\|WP_022557787.1\|4106969_4107962_+\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	1.77353e-143
NZ_CP021001.1\|WP_022557784.1\|4102010_4103138_-\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	1.44405e-23
NZ_CP021001.1\|WP_033481283.1\|4103322_4104024_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|379309	pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.	1.17536e-07
NZ_CP021001.1\|WP_022557794.1\|4118411_4119485_-\|glycoside-hydrolase-family-5-protein	gnl\|CDD\|365907	pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5).	1.78184e-61
NZ_CP021001.1\|WP_003482177.1\|4105848_4106541_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	1.19314e-25
NZ_CP021001.1\|WP_022557798.1\|4123036_4127509_-\|glutamate-synthase-large-subunit	gnl\|CDD\|236968	PRK11750, gltB, glutamate synthase subunit alpha; Provisional.	0
NZ_CP021001.1\|WP_022557797.1\|4121433_4122915_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|273553	TIGR01318, glutamate_synthase_small_subunit_gltD, glutamate synthase small subunit family protein, proteobacterial. This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit and homologs. TIGR01317 describes the small subunit (or equivalent region from longer forms) in eukaryotes, Gram-positive bacteria, and some other lineages, both NADH and NADPH-dependent. TIGR01316 describes a protein of similar length, from Archaea and a number of bacterial lineages, that forms glutamate synthase homotetramers without a large subunit. This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including E. coli.	0
NZ_CP021001.1\|WP_022557795.1\|4119794_4120853_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP021001.1\|WP_007968187.1\|4104288_4105629_-\|outer-membrane-protein-transport-protein	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	1.79229e-134
NZ_CP021001.1\|WP_022557793.1\|4116582_4117635_-\|glycoside-hydrolase-family-5-protein	gnl\|CDD\|365907	pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5).	4.64675e-58

>NZ_CP021001.1|WP_033481293.1|4109752_4110988_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MWLAVGVLACTLLGSMGASAQSQRETERKLQQLRDELKTISADRRELEGKRGTAAQQLRQADEKVAKTARALSETEAAMRAQEQHLSSLQQERAQLQRGLQSQRTQLAALLRAADQVGRNAPLKVLLSQDTVGDATRMLADHRYVQNARAQRIHALTTQLDALATVEQDIATRRQALDAARAQQKAQAATLQKDRSQQAATVAQLDDRYKQRAEREKAIGQDAKALEQLLANLRAAAAKAEAERRAAARRAAAEAAAQAKRSKTERSDRPGKTPPKVIANAPAPKVGGLSWPVAGNLLARFNATLPDGHTSKGVLIGAPKGTTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLRDAGASIKRGDAVAKVGSSGGQGVPALYFELRRNGQPVDPSSWLQRR
>NZ_CP021001.1|WP_022557788.1|4108124_4109648_-|S41-family-peptidase
MRVAALSVALSLALFASPGWAQKAGPAAAQASADDPEANEAAVSKVPLDEIRRFVAVYNAVKQAYVDPVEDKKLMHAAVRGLLSDLDPHSTYFDKEDAEAFDEQATGAYDGIGVELLQQQDNTLKVIAPIDDTPAARAGIRAGDVIVAIDGKPIDASKAMEPLRGESGSKVVLTIMRDKTPKPFDVTLQRETIRVASVRSKLLEPGYGYIRISTFQADTGADFQKNLKQLQAGGKLRGLVLDLRSNPGGLLTSAVQVADDLLDKGNIVSTRGRISISDAKFDATPGDLLNGAPVVVLVDAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKSIQASGIVPDVLLAPEPQPGDADAPASLTDYSEATLPGHLRGDDEGEEGYSAGDVLPGDGPITEALAELKQPGAAAKAQAARKAKAQAAQKAKAAKTGAEPKPAAARPATTDKPRSAEPAGKAKPATAPAAPAEPVQPTPPADKPAEPVN
>NZ_CP021001.1|WP_022557787.1|4106969_4107962_+|D-2-hydroxyacid-dehydrogenase-family-protein
MRVVVPDDYQGAVARLPCLQQLQGHQVQVLGALDEALDARAACLADADALVLIRERTRVDAALLQRLPRLKLISQTGRVGAHVDVAACTALGVAVAEGVGSPVAPAELTWALILSASRRLADYQHALQQGRWQALGDPGLGRVLHGRTLGIWSYGRIGQRVAGFGHAFGMQVLVWGGEASCAQAARDGFAVAGSREELFERSDVLSLHRRLTAQTRHDITAQDLARMRDDALLVNTSRAELIAPGALLAALDAGRPAQAALDVFEHEPVLDPRDPLLRHVRVLATPHLGYVERDSYALYFDAAFDNVLAFAAGTPRNLVNPEVLATTQRV
>NZ_CP021001.1|WP_033481284.1|4106649_4106970_+|DUF1820-family-protein
MSKPLYKVTFLNHGKVYELYAREVTGSHLWGFNQIGELVFDVHDGLVVDPTEERLREEFGNTRTLHLPMQSIVRIEEVEKKGQSVIRDATTGDKVVTPFPSPIKPR
>NZ_CP021001.1|WP_003482177.1|4105848_4106541_+|rhomboid-family-intramembrane-serine-protease
MFVSLPSRKKPTPRWAVPLLFATVWLAYLWSISRPGEARNTLWLDWGALSSGVSNLGDWWATLRDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERILGPWRLLLLFLVGGAASNLAAIFAIGTPDRVIIGASGAVSALIGTYLALFPGAKLGVVLPLGVFLEFIRVPAPLLIGAWALLQVVFAYIGPAFGMVAWSAHIAGFVFGIVYGLYVRAAIARRLRKRHGF
>NZ_CP021001.1|WP_007968187.1|4104288_4105629_-|outer-membrane-protein-transport-protein
MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAFAGSGSAPDDASIIATNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVSGGNGGDAGMIAPVPALYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVGRYHGTKTELQAIDFNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSVLAARRVPGFAPGSADGYSRIKGDSTEVGFTLGGLFSIDENTHIGFSYRSQVEHKITDGTADFTVPGSAAAVLSVAAPGTFVDTKGRATVKLPASATASFTHNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFSYRDTTFASIGADYRLSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSAQTEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF
>NZ_CP021001.1|WP_033481283.1|4103322_4104024_-|2OG-Fe(II)-oxygenase
MSQPDFIQITDNAIAHEECVAIVQRMRQSQQLHPGRIGGGVFPDLKHSRDLRISGMAEWAEVENRLQQAVFEGVLTYLRQYPQALISPLMLQVTTADGTRHRLVAEDIVQMSNQALGDLARTCLRPGAINLQWYTADQGGYPYWHCELYPRDANADTLHRHLLWTLYLNDDFAQGETEFLFQQRKARPRTGSLLIAPTAFTHTHRGNRPVGGDKFIATSWILFQSAQALYGGE
>NZ_CP021001.1|WP_022557784.1|4102010_4103138_-|PA0069-family-radical-SAM-protein
MQKNSSPSASAAAERDVRSSRTVIKGRGTTAYVPGRFSVTTAVEIDDGWGALDADGETAFRPKTVVAEEIARSIISRNNSPDIGFSQSVNPYRGCEHGCVYCFARPSHAYLDLSPGLDFETRIFAKPNAAALLRAEIARPSYQCSPIALGINTDAYQPAERRLHISRQCLEVLAQARHPVSFVTKAALIERDIDVLAEMAQHNLVSVYFSVTTLDNRLAAKMEPRAAAPHARLRAMQALHAAGVPVGVLVAPVIPMINDKELERILDAAAAHGARSAGYVLLRLPHELTQLWREWLELHYPDRAKHVMSLIQQMRGGKDYDSRFGKRMVGEGPFAELIAQRFSIAYRRLGFGRLPRLDTTQFRPPRPDTPQLDLF
>NZ_CP021001.1|WP_033481282.1|4101521_4101887_+|DUF1330-domain-containing-protein
MVAFSPDALSAFLDNQDTSAIVMLNLIRFQADGGRERYHRYLRLATPILARFDAHIVFSGDGLPVLTAGQAQAWDAVTLVQYPGRSAFKQMIADAEYQHAFEVGRSAIAEIVLQPFHGITL
>NZ_CP021001.1|WP_022557782.1|4100747_4101473_+|YafY-family-transcriptional-regulator
MSRTTRLFELLGLLRAHRRPVSAAALASELGVSQRSLYRDIDTLRALGAPLEGQAGVGYYLKPGFFLPSLAFSQEELDAVMLGLDWVKQRADPALARCGESALAKILSARKHGDGTGIDVAPPAILTAASPSEAVDHPQTAVLRDAIRRQCKLAIGYVDAQDTPSERIVWPIALVYFDDVRVLAAWCERRSAFRHFRVDRLQVRAVLEARYPQSRQALVKQWRQQDRDWRSLLTVSDTAQG
>NZ_CP021001.1|WP_022557791.1|4111966_4113763_+|M28-family-peptidase
MPRKILLCLATTLALAGCKREPADAPSAPAAQTPTESAPSAPVSRHTFSPDMTAGDFAELVKTLASDDFEGRGPGTPGEEKTVTYIRDQMQRIGLQPGNGDSWFQEVPMVETTADASTAPSLRSGEQTRTLAFGTDIVVGTRTGQAEVKLDNSELVFVGYGVDAPEQQWNDYAGQEWKGKTVVMFVNDPGFHTDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAALIVHDTPGASYGWDVVKNSWSGPQYDLPAKDDPDPRLPVQGWISAETARQLFANAGLDLAQAYKDASKRGFKPVPLKASWSVDLKSTIAAKTSRNVVGVLPGTSHADEAVLYMAHWDHLGKHPGESGDNIYNGAVDNATGVAGILEIADAFAHQDPKPARSVVFLAVTLEESGLLGSKYYVANPSFPLDKIAAVINLDAMSVAGRARDVTVVGMGSSELEDILKPIAAMQGRTLHAEATPQNGSYFRSDHFNFAKAGVPALYADGGEDLREGGTAAGRAAAEDYGRHRYHAPGDEYDAATWKLDGTIEDLQVVYGVGKEVAAGERWPNWYPGNPFKAARDRMMAGRPGTSAASAQPADAASTATQTNTANPPR
>NZ_CP021001.1|WP_022557792.1|4114072_4114516_-|PepSY-domain-containing-protein
MTQRLMKTALIGVLALVSQGALAQAADKPAKALTSGEFTSMLTAKGYTKVHDVKFEHGVWTADARSGDGKDVDVHIDPVTGRVYGDQTTSKLSEADVRASLSTGGYADVHDLKFTDGLWKADAKRNGQKVELHVDPEDGHVVSVDND
>NZ_CP021001.1|WP_007968176.1|4114811_4115945_-|glycoside-hydrolase-family-5-protein
MSAVCFSLRTLLRSTLLFIVFGSLPLAHAQTRALTYAGVNLSGAEYASSKKPGVLNKDYMYAAASDYTYFAGVGMNTIRLPILWERLQPTAGGELDPAQLALLQQAVARAKAAGMYLVIDIHNYAKYYGYKIGSPEVPVATFTDLWRRLALVFNSDNAVMFGLMNEPNNISASEWAGAAQAAIDAIRRTGANNLILVPGALWTGAHSWYSTTNDGYSNATALTSIYDPLDRYAFEVHQYLDADSSGTSSTCVSSTIGAERLRNFTQWLRTNRKRGFLAEFGTANNAVCNQALQGMLSHMETNADVWLGWTWWAAGSWWNLSYAYSVHPNKDGTDKPQMAILSPQAALATRAPVAAAAARTSAASTSATSVSVARTTR
>NZ_CP021001.1|WP_022557793.1|4116582_4117635_-|glycoside-hydrolase-family-5-protein
MKSLTTHTRRLRCRALSFLLLATMPLAQAQSATGLKYAGVNLSGAEIKSSQKPGVLNIDYRYPAADEYAYFAGKHMNTVRLPILWERLQPRAGGELDPAQLALIRQAVANAKAAKMYVIVDVHNYAKYYGHTIGSTKVPFSTFNDLWRRLAIAFKSDNAVIFGLMNEPYDIDPQAWATAAQASIDTIRKTGATNLILVPGALWTGAHSWYSTVAGQSNAVAMAFIRDPLNRYAIEAHQYLDADSSGTSGGCVSATVGVERLRSFTEWLRLNKKRGFLAEFGTGNTVTCNLALNGMLGYMESNGDVWMGWSWWAAGAWWSGAYPFNVQPDAQGRDKPQMSILSPRARRITD
>NZ_CP021001.1|WP_022557794.1|4118411_4119485_-|glycoside-hydrolase-family-5-protein
MFHTPPHLSRLRTAALALTLIAAIPLVQAKEPAGPKKESAGLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPASALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTINAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGSWWKPDYPFTVQPGKDGSDKPQMAILSKYARRAGK
>NZ_CP021001.1|WP_022557795.1|4119794_4120853_+|NAD(P)-dependent-alcohol-dehydrogenase
MSTAHAYAAQAADQPLAPFVFERRAPGPNDVQIDIAYCGVCHSDLHTARNEWHNTLYPSVPGHEIVGRVTAVGNAVTGFKVGDLAGVGCMVDSCRSCASCQEGEEQYCEAGFTGTYNGPMFGGGENTYGGYSDHIVVDQKYVLRITHSDNLAAVAPLLCAGITTYSPLAHWKVGPGQKVGVVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADALRLGASEVVISKDEAQMAAQYNTLDFILNTVAAPHNLDPFLNALKRDGAMVLVGVPEQSHPSPAVFNLIMKRRTLAGSLIGGIRQTQEMLDFCAKHNIVSDIETIRADQINAAYERMLKSDVKYRFVIDMATLDKAA
>NZ_CP021001.1|WP_022557797.1|4121433_4122915_-|FAD-dependent-oxidoreductase
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGRFDKADAQYQAGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVQPSGHRVAVIGAGPAGLACADRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGKDISIEQLLAEYDAVFLGTGAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQLALPDLTGKRVVVLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSAREVANAREEGVRFLFNRQPLSIESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLLEADVVIIAFGFSPTLPDWLASQGVEAGSNGRIVAPADGNGRLPYQTTNPRLFAGGDCVRGADLVVTAVAEGRDAAGSIVQLLGVKAQVKEPAAA
>NZ_CP021001.1|WP_022557798.1|4123036_4127509_-|glutamate-synthase-large-subunit
MAPRTRQGLNDDGLYNSVRDERDACGFGMVAQLDDQPSRALVDTAIAALSRMTHRGGVAADGLTGDGCGLLIRKPDAFLRGLARDAGITLGTRYAAGVVFLPLDEADAARCRAELEAQLHSAGVHLRGWRVVPTDDSVCGQLARDTLPRIEQVFVDAGAEQTEDGFTLALFLARRRAEQALHAVENFYVTTLSPNGISYKGMVLPDKLSTFYPDLQRSDLSSSAIVFHQRFSTNTLPRWPLAHPFRLLAHNGEINTIEGNRRWAQARSKVWQTPRFDIAQFDPVISMHGSDSQSLDNMLELLIAGGMDLLQALRILVPPATQSLEFKDADLAAFYEFYGLNTEPWDGPAGIVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITRKGKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELIDPSLVEEPFSEQTLRSYHKLFQLSTEEVEQVLRPLAETEQEATGSMGDDTPMAVLSRQTRPLYDYFRQAFAQVTNPPIDPLREGIAMSLTTQLGKETNIFHAGAETVNHVILNSPVLSQRKLRQLLKMEQYVERNRLIDLSYSLEEGLKAGLERICQEVEAAARAGAVMLLLSDRYPVPDRPMAHALLATGAVHHHLCKVGLRCDVNLIIETGTARDPHHMACLLGVGATAVYPYLAYQTLFDLGRRGILQLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLDPDVVDLCFADTPARIGGVDLARLDTEARELTVRAWNDQLKPEVGGLLKYVHGGEYHMYNPDVVMTLQRATRTGDAGDWQKYVDAVHARPASTLRDLVQLKRADTPTPLDDVAPAEDVLRRFDSAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTEKRSKIKQVASGRFGVTPEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYSIEDLAQLIYDLKQVNPTALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPVSSIRYAGVPWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGADSFGFGTAPMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVEHFFRLLAEEVRQWLSYLGVRSLDEIVGRTDLLEQLDVSPRPGVKVDLSRLLTHAQYDGSHCAAQRLYESPDSLATQMDGLLADAIANKRGGDHRFLIHNTDRSIGARLSGAIARAHGNHGMSDAPLNLRFRGTAGQSFGAFNAGGLQLELEGEANDYVGKGMAGGRLVVRPPRGARFEARNTPIVGNTCLYGATGGELFAAGRAGERFAVRNSGALAVLEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGGLAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELTGSIWAQQILDEFRDYIGKFWLVKPKAASIESLTESLRRAA
>NZ_CP021001.1|WP_022557799.1|4127711_4128092_-|proteinase-inhibitor
MRAVLPIARLACTLVVLTALTACNKPQPDEQEAVTANAQHAAEQAAAPAPDAAPEAPPIGSCDATQVQSLVGQPLTDAVGEQARSDAGAKSVRVLKPGQMTTMEFNGERLNLEVDAKNVISSVRCG
>NZ_CP021001.1|WP_022557800.1|4128148_4129426_+|DNA-topoisomerase-IB
MACAHGVVAALTQPSPAAPNNRGQSFDLCAMKAKRVLRNATVAASTVGKLAAVATGAAVATAAVASAAAVAQAKATARAAGLTYVNDQQPGISRRKAGKSFSYRDADGQRIADAETLQRIRSLAIPPAYTEVWICAKPNGHLQATGRDARRRKQYRYHADWAQVRGEGKFERVIAFGTALPKLRRRLRRDLLLPGFPREKVLAIVVALLADTLVRVGNAEYARSNRSYGLTTLRNRHMEFLKGGRARLKFRGKSGQDHDIEVDDKQLVKLIRQCQQLPGQSLFQYRDDDGQLQPVDSGEVNDYLREAMGEDFTAKDFRTWGGTLAALQRLARLPLPERSSERALNQVQNDVIREVADALGNTPSVCRKAYIDPCVFEGWRAGQLQAMATGVRGERQWEAATLKFLSASRSKLKTQAKSVARRKSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021001_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021001_3

4324473-4324573

Orphan

Consensus_repeat	Method
TCGGCCGAAGGGCGCACCTGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021001_3

>merge|NZ_CP021001|3|4324473-4324573|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCACGGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGGTCGGCGGCCGGACGCACCTGGAC

>NZ_CP021001|3|3|4324473-4324573|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCAC	GGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGG
TCGGCGGCCGGACGCACCTGGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021001.1\|WP_007966372.1\|4325060_4325381_+\|DUF4156-domain-containing-protein	unknown	unknown	gnl\|CDD\|372679
NZ_CP021001.1\|WP_007974735.1\|4313379_4314405_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP021001.1\|WP_033481075.1\|4333071_4334244_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP021001.1\|WP_022557906.1\|4319029_4320376_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP021001.1\|WP_022557908.1\|4321421_4322039_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021001.1\|WP_003468167.1\|4335517_4335676_+\|DUF1328-domain-containing-protein	unknown	unknown	gnl\|CDD\|227774
NZ_CP021001.1\|WP_033481074.1\|4331324_4332872_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|294013
NZ_CP021001.1\|WP_022557904.1\|4315825_4317553_+\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
NZ_CP021001.1\|WP_022557916.1\|4336481_4337126_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225706
NZ_CP021001.1\|WP_022557905.1\|4317602_4319045_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP021001.1\|WP_022557912.1\|4327906_4328809_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|179147
NZ_CP021001.1\|WP_003488515.1\|4312851_4313364_+\|protein-export-chaperone-SecB	unknown	unknown	gnl\|CDD\|180234
NZ_CP021001.1\|WP_022557910.1\|4323710_4324187_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|349967
NZ_CP021001.1\|WP_022557907.1\|4320566_4321319_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021001.1\|WP_022557913.1\|4329666_4331316_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236443
NZ_CP021001.1\|WP_007972046.1\|4334442_4335453_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187552
NZ_CP021001.1\|WP_005912222.1\|4325482_4326499_+\|3-oxoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|181732
NZ_CP021001.1\|WP_022557903.1\|4314873_4315470_-\|Ax21-family-protein	unknown	unknown	gnl\|CDD\|275096
NZ_CP021001.1\|WP_022557909.1\|4322131_4323361_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP021001.1\|WP_007972041.1\|4328961_4329345_-\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|223799

Protein	Function_ID	Function_description	E-value
NZ_CP021001.1\|WP_007974735.1\|4313379_4314405_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	4.57783e-180
NZ_CP021001.1\|WP_033481075.1\|4333071_4334244_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	3.16439e-34
NZ_CP021001.1\|WP_022557906.1\|4319029_4320376_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	9.58921e-175
NZ_CP021001.1\|WP_022557905.1\|4317602_4319045_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	4.00603e-32
NZ_CP021001.1\|WP_003468167.1\|4335517_4335676_+\|DUF1328-domain-containing-protein	gnl\|CDD\|227774	COG5487, COG5487, Small integral membrane protein [Function unknown].	0.00222793
NZ_CP021001.1\|WP_033481074.1\|4331324_4332872_+\|transcriptional-regulator	gnl\|CDD\|294013	cd00383, trans_reg_C, DNA-binding effector domain of two-component system response regulators. Bacteria and some eukaryotes use two-component signal transduction systems to detect and respond to changes in the environment. The systems consists of a sensor histidine kinase and a response regulator. The former autophosphorylates a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. This C-terminal effector domain belongs to the winged helix-turn-helix family of transcriptional regulators and contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunit of RNA polymerase.	7.65381e-20
NZ_CP021001.1\|WP_022557910.1\|4323710_4324187_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|349967	cd18094, SpoU-like_TrmL, SAM-dependent tRNA methylase related to TrmL. tRNA (Um34/Cm34) methyltransferase TrmL catalyzes the methyl transfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH at position 34 in both tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	1.1762e-81
NZ_CP021001.1\|WP_022557916.1\|4336481_4337126_+\|hypothetical-protein	gnl\|CDD\|225706	COG3165, COG3165, Uncharacterized protein conserved in bacteria [Function unknown].	8.0745e-43
NZ_CP021001.1\|WP_007966372.1\|4325060_4325381_+\|DUF4156-domain-containing-protein	gnl\|CDD\|372679	pfam13698, DUF4156, Domain of unknown function (DUF4156). The function of this family is unknown but members are annotated as putative lipoprotein outer membrane proteins.	1.76533e-09
NZ_CP021001.1\|WP_022557912.1\|4327906_4328809_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|179147	PRK00870, PRK00870, haloalkane dehalogenase; Provisional.	2.17567e-46
NZ_CP021001.1\|WP_003488515.1\|4312851_4313364_+\|protein-export-chaperone-SecB	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	3.40232e-69
NZ_CP021001.1\|WP_022557904.1\|4315825_4317553_+\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
NZ_CP021001.1\|WP_022557913.1\|4329666_4331316_+\|AMP-binding-protein	gnl\|CDD\|236443	PRK09274, PRK09274, peptide synthase; Provisional.	0
NZ_CP021001.1\|WP_007972046.1\|4334442_4335453_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187552	cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs. Extended SDR family domains belonging to this subgroup have the characteristic active site tetrad and a fairly well-conserved NAD(P)-binding motif. 3b-HSD catalyzes the NAD-dependent conversion of various steroids, such as pregnenolone to progesterone, or androstenediol to testosterone. This subgroup includes an unusual bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis thaliana, and Saccharomyces cerevisiae ERG26, a 3b-HSD/C-4 decarboxylase, involved in the synthesis of ergosterol, the major sterol of yeast. It also includes human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/ [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase; HSD3B7]. C(27) 3beta-HSD/HSD3B7 is a membrane-bound enzyme of the endoplasmic reticulum, that catalyzes the isomerization and oxidation of 7alpha-hydroxylated sterol intermediates, an early step in bile acid biosynthesis. Mutations in the human NSDHL (NAD(P)H steroid dehydrogenase-like protein) cause CHILD syndrome (congenital hemidysplasia with ichthyosiform nevus and limb defects), an X-linked dominant, male-lethal trait. Mutations in the human gene encoding C(27) 3beta-HSD underlie a rare autosomal recessive form of neonatal cholestasis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.51368e-82
NZ_CP021001.1\|WP_005912222.1\|4325482_4326499_+\|3-oxoacyl-ACP-synthase-III	gnl\|CDD\|181732	PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
NZ_CP021001.1\|WP_022557903.1\|4314873_4315470_-\|Ax21-family-protein	gnl\|CDD\|275096	TIGR04273, activator_of_XA21-mediated_immunity_Ax21, sulfation-dependent quorum factor, Ax21 family. This family consists of proteins closely related to Ax21 (Activator of XA21-mediated immunity), a protein that is secreted by a type I secretion system (RaxABC), and that appears to be sulfated on an N-terminal region tryosine in a motif LSYN. Ax21 acts in a quorum-sensing system. Homologous peptide-mediated quorum-sensing systems appear to exist in other species, such as the emerging opportunistic pathogen Stenotrophomonas maltophilia. Intriguingly, the rice genome encodes a receptor (XA21) for this protein that triggers innate immunity. [Cellular processes, Pathogenesis].	7.42598e-108
NZ_CP021001.1\|WP_022557909.1\|4322131_4323361_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.57122e-20
NZ_CP021001.1\|WP_007972041.1\|4328961_4329345_-\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|223799	COG0727, COG0727, Predicted Fe-S-cluster oxidoreductase [General function prediction only].	2.27067e-20

>NZ_CP021001.1|WP_022557910.1|4323710_4324187_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MSAPVLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLHVHADLPSALAAIAPKRVFALSTRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNFAGGQ
>NZ_CP021001.1|WP_022557909.1|4322131_4323361_+|MFS-transporter
MPMTKARPRGTRALEALHFSVADVQDGLGPFLSVFLQSKGWSVAAIGTVMSVGGIAGMLATTPAGALVDATRRKRAVVVIGCLAILLATALIWLQPTSSGVVAAQIASALAAAGIGPALTGITLGLVHARGFDHQLARNQVANHAGNVLAAVLAGWLGWRYGFAAVFLLTAFFGVLALMAVLAIPAAAIDHRAARGLASTNGGDALSGWRVLLTCRPLALLAVTLGLFHLGNAAMLPLYGMAIVAAHAGDPSALTATTIVVAQATMVVIALLAMRWIRVHGHWWVLLVAFMALPLRALVAASVIHGWGVFPVQILDGLGAGLQSVVVPALVARLLQGTGRVNVGQGAVMTVQGVGAALSPAFGGWLAHAFGYRIAFLSLGAIALLAVALWAGCRGMLQAGASVQAETML
>NZ_CP021001.1|WP_022557908.1|4321421_4322039_+|hypothetical-protein
MHWVDPDFLPATRGTLARFLLNPKADIDGLLLTDGTEVHTPPHLSEALLKALKPGSALTVRGLKPRDVEMLVALAIDPEGGKRILDEGPHGPHAKPKPKPPGKPTKPEVAQHSGTITRLLHGPHGQVHGVLLDDAVTVRFPPHAGGDFAKQLVVGKPLVAEGETKATPHGVLIHAHALGGKAATLKQIEHPPRGPAHKPKPKPKH
>NZ_CP021001.1|WP_022557907.1|4320566_4321319_+|hypothetical-protein
MMRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPVAATPVSVSGTVERFLLNPNGDVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVVKGFRLGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQSDGTIHRLVYGPAGEVNGALVSDGTVVRMPPHLALQFADLLRVGAPLSASGLGVATPDGRAIEATQLGRDRSSLRALFTAPRPDGPLPPPPPGAPVPPAGR
>NZ_CP021001.1|WP_022557906.1|4319029_4320376_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MARILIIDDDAAFRTTLQATLRSLGHTAVAAENGPDGLARLSEGGIDMAFVDFRMPGMDGIAVLRARLDDAQARQVPLVMLTAHVSSGNTIEAMTLGAFDHLVKPVGRADIVEVVERALLGRADARAAATDALSAPAEDDDALVGHSPAMRTVHKRIGLAAASDLPVLITGETGTGKELAARALHRASPRASAPFVAVNCAAIPLELMESELFGHRKGAFSGASSDRRGLIREADGGTLFLDEIGDMPLPMQAKLLRFLQEGEVTPLGGSGPQKVDVRVLAATHRDLAACVADGRFRSDLRYRLNVVPIELPPLRERGQDILLLAQHFLSANAAHAQSLSPAAQERLLAHRWPGNVRELRNVMQRSQVLVRGASIDAADLEEALGEAGEAPPNVASALTGTLPEAVAQLEKQMIQSALEQSQGNRAEAARRLGIHRQLLYRKLEEYGL
>NZ_CP021001.1|WP_022557905.1|4317602_4319045_+|HAMP-domain-containing-histidine-kinase
MPRSLLRQLLLIWMVIVAACLGVATMLYGLYRQTEGVRLEEARQQLGGQCARIVQRYAGASEAARRGDDGVGLAAVVVQLVLADAPGVEGGVWDLHKGFVAYAYPTYDGSDHKTDIPAAEWANIVNTAQQSVTTKQAAQYRRDGRREVLLISACPLASGSAAWTMTRVPASKADAWRPLVVGMLLIFAMVAISAIALGVLVRRWSQRLQRIQQALAADTETPHIPPTGTPELDRLGAAVNDYAQRNAQALAQTRRLADELSRHERLAALGRMTATVAHEIRNPIATMRLALENEIARDDATPDDAAHGELMLGQIRRLDGVVESLLGMVQPIRLHLETVVVQDWLATLLEPSPLPPGTPPPRVLLPAAPLRWTLDPQQLGRAVHNLLRNAAQHADPGSEVTLQAEAVEGILQLQVCNRGAPIAEPIAAHLFEPFVSGRADGNGLGLALVREIARAHGGHARYAHADGLTHFILELPWRVS
>NZ_CP021001.1|WP_022557904.1|4315825_4317553_+|ubiquinone-dependent-pyruvate-dehydrogenase
MAKKRTLARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIEWMHVRHEEVAAFAAGAEAAVTGELAVCAGSCGPGNLHLINGLFDCHRSRQPVLAIAAHIPSSEIGLSYFQETHPQELFRECSHFVELVTNPAQLPEVLHRAMRSAILQQGVAVVVIPGDIALLEVDKHVSSAWPALRQPRVLPAAEDVQQLAELLQQSKAVTVLCGSGCAGAHDAVVALADTLGAPVVHALRGKEYVEWDNPFDVGMTGLIGFSSGYHAMLNCDTLLMLGTDFPYRQFYPKDATIVQVDRDPSALGRRTPLQLGIAADVGETIAALLPQLQRREERGFLEKSLAHYRKAREGLDDLAVPADPGEPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNGKRRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISLAQLNLPVKVVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGILGIRVDESSQLERALRQVFAHSGPALVDVRVATQELAVPPAIKLEQAKGMGLYLLKAVMSGRGDEVIALVKTNLR
>NZ_CP021001.1|WP_022557903.1|4314873_4315470_-|Ax21-family-protein
MKTSLLALGLLAALPFAASAAENLSYNFVEGDYVRTPTEGRDADGWGVKASYAIAPNFHVFGDYSKQNADDNNNVFENTDSDFQQWGVGVGFNHEIATSTDFVARVAYRKLDLDTPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDFSKKRGIDIGDNFYGRLGAQVKLNRNWGINGDIRMDGDGNKEWSVGPRFSW
>NZ_CP021001.1|WP_007974735.1|4313379_4314405_+|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase
MSDLTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTIDRTHENARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRPAGAGVAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAFAQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGLNEMLRLAAVIGARPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLDEAIREIGQVVESVQTADEVMRQAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLFT
>NZ_CP021001.1|WP_003488515.1|4312851_4313364_+|protein-export-chaperone-SecB
MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDANQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAIDVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRQNEGTSLADSEPAGNA
>NZ_CP021001.1|WP_007966372.1|4325060_4325381_+|DUF4156-domain-containing-protein
MRVLMLSVLVATTTAACTWVPIEQSGKGVRVLPAGPVPAGCQQQGEVVVTVKSKVGFYNRNPLRVQEELETLARNEAPGANANAVQAQGQPADGSQRFNAFRCPPR
>NZ_CP021001.1|WP_005912222.1|4325482_4326499_+|3-oxoacyl-ACP-synthase-III
MLFQNVSIAGLAHVDAPHTLTSKEINERLQPTYDRLGIKTDVLGDVAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLVNTSVSRDYLEPSTASIVSGNLGVGDHCVTFDVANACLAFINGMDIAARMLERGEIDYALVVDGETANLVYEKTLERMTSPDVTEEEFRNELAALTLGCGAAAMVMARTELVPDAPRYKGGVTRSATEWNKLCRGNLDRMVTDTRLLLIEGIKLAQKTFMAARQVLGWAVDELDQFVIHQVSRPHTAAFVKSFGIDPAKVMTIFGEHGNIGPASVPIVLSKLKELGRLKKGDRIALLGIGSGLNCSMAEVVW
>NZ_CP021001.1|WP_022557912.1|4327906_4328809_+|alpha/beta-fold-hydrolase
MNYPGYPFTPKRLDVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSYLWRHLVSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDSLLRHLGITGAVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPMPWQIAMGRHWRPGEWFIRTFNAFSSGASWLGVSRRMPSEVRRAYVAPYNNWRNRISTIRFMQDIPLSPADKGWSLLDRSAQALPAFADRPAFIAWGLRDICFDKHFLAGFRKALPQAEVTAFDDANHYVLEDKHEVLVPAIRAFLERNPL
>NZ_CP021001.1|WP_007972041.1|4328961_4329345_-|YkgJ-family-cysteine-cluster-protein
MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIELTEALRTHERVMRGTSQSQPRCIALDAEIGRYSRCSIHDRRPSSCAAVPASLEFGERSAQCDKSRLAHGLHALTDADWVGVDDAQRNPLPPV
>NZ_CP021001.1|WP_022557913.1|4329666_4331316_+|AMP-binding-protein
MTTLCNIAATLPQLARERPDQIAIRCPGGRGANGFAAYDVTLSYAELDARSDAIAAGLARHGVGRGARAVVMVRPSPEFFLLMFALFKAGAVPVLVDPGIDKRALKQCLDEAQPQAFIGIALAQLARRLLRWARSAKQIVTVGGRYGWGGVTLARVERDGAGAGSQLADTGPDDVAAILFTSGSTGVPKGVVYRHRHFVGQIELLRNAFGMQPGGVDLPTFPPFALFDPALGLTSVIPDMDPTRPGSADPRKLHDAINRFGVTQLFGSPALMRVLADHGQPLPDVRLATSAGAPVPPDVVAKIRALLPADAQFWTPYGATECLPVAAIEGRTLDATRAATEAGAGTCVGHVVPPNQVRIIAIDDAAIADWSGVRVLATGEVGEITVAGPTATDTYFNRDAATRIAKIRERCSDGSERVVHRMGDVGYFDAEGRLWFCGRKTHRVEAASGPLYTEQVEPVFNVHPQVRRTALVGVGAPGQQQPVLCVELQPGVSASAFAQVESDLRALGAAHPHTAGVARFLRHSGFPVDIRHNAKIGRETLAVWATQQR
>NZ_CP021001.1|WP_033481074.1|4331324_4332872_+|transcriptional-regulator
MRARYRLDDLRIDIARQRVERDGVALEVTGLSFRLLHYLLQQGQRVVDFDELIQHVWAPALVNEETVTQRVRLLRQALGDDSRQPRYLRSVRGQGYQLCVPVQQEQVPPAMRRHYAWPVAAVAALVCIGAGVIGWLQTRDAPPAAAALVQRAAYYAGIGQRDDNDRAIDLYGQRLQQAPDDRQAQLGLSRAYSARVCQYDGDAAYAARALQLANGVVTAQPDLAAAHAARGYALDCQGRNADALAAYEQALQLDADADAVRGSAAYLYERRGKLVQALTANLAVRDPTRVRFLPIQIASNLSLLGYAGAAETRYRTNFQLYPDDPFSNLAWPTFLFEHGRAAEAETALNASLNRGTAYAGLSVLQAELAWARGDESLARQAALHAIQLRPQGSFAQTVAWAVHAQPLPAPAVLRMRAQELLNSVERGGDPFDAIDAAVLLLCADAPEVAMRALQRAEAAGYRNAGYLRQSPLLKPLRRSPEFIALLARIDADLAAQRAQLRRRNLLPTDAVSGSN
>NZ_CP021001.1|WP_033481075.1|4333071_4334244_-|serine-hydrolase
MCRPSLLLSALLAASALHAAPPIAASPATTPTAAGPAKATLPPATPPVLGDGWPVASVATSGWNLALLAQMEQALADDLAPSTTSVLIVRDGVLVYEKYLGDATRETLHDTRSLTKSVTALLVGAAIERKLLPSAQAKVFDYFGDRQWQHPDPRKRAITVEDLLTMSSQLECNDDNEFSAGNEERMYLSADWTQFALDLPIRGYAPWMQRPEHSPYGRAFSYCTAGSFLLGALLEKATGQPLRAFAGEVLETPLGIKNVQWTVSSEGVGMGGGGTRYRSRDLAKLGQLLVAQGRWQGRQVIPADWIRAMTRVQAQAREDADYGYLTWHFRFPVHGVQRDTWAMSGNGGNYVFVVPAERLVVVLTRSAYNTRQMHQQSQRVLTDYVLKALP
>NZ_CP021001.1|WP_007972046.1|4334442_4335453_+|NAD-dependent-epimerase/dehydratase-family-protein
MKVLVTGGGGFLGQALCRGLRARGHEVVSFQRGDYPVLQRLGVGQIRGDLADPQAVRHAFAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVIEACRANGVPRLIYTSTPSVTHRATNPVEGLGADEVPYGDDLRAAYAATKAIAERAVLAANDAQLATVALRPRLIWGPGDNHLLPRLAARARAGRLRMVGDGGNLVDSTYIDNAAQAHFDAFQHLAVGAACAGKAYFISNGEPLPMRELLNRLLAAVDAPAVTRSLSFNTAYRIGAVCETLWPLLRLPGEVPLTRFLVEQLCTPHWYSMEPARRDFGYVPRISIEEGLQRLRSSSSNDIAITR
>NZ_CP021001.1|WP_003468167.1|4335517_4335676_+|DUF1328-domain-containing-protein
MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVISMFRRGKV
>NZ_CP021001.1|WP_022557916.1|4336481_4337126_+|hypothetical-protein
MPGSLFNSLKPLAGQALQAALNRALALDPDTRDALLPLEGQRIALTLEAPALALQIRVHERRLLVGPVDQAQEPDLAVRSSLAGLLGQLPLLANARRTGAPAGRLKVSGDAELARQLQQLAGRFDPDWQLPFVSVFGDILGVQIAGAVRAALQQARRSAVDLAQSAAEFVTEESRDVVPRAELEAFHDDVDELRDDVERLAARVSRLRTSGGAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	841356-841379	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	841102-841125	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	741221-741244	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	811287-811310	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	740336-740359	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	742914-742937	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	742903-742926	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	741208-741231	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	741227-741250	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	741205-741228	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	841425-841448	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	841424-841447	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	841409-841432	2	0.917
NZ_CP021001_2	2.8\|4111347\|24\|NZ_CP021001\|CRISPRCasFinder	4111347-4111370	24	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	934481-934504	2	0.917
NZ_CP021001_2	2.7\|4111293\|24\|NZ_CP021001\|CRISPRCasFinder	4111293-4111316	24	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	114529-114552	3	0.875
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	463188-463214	3	0.889
NZ_CP021001_2	2.8\|4111347\|24\|NZ_CP021001\|CRISPRCasFinder	4111347-4111370	24	NC_015059	Granulicella tundricola MP5ACTX9 plasmid pACIX904, complete sequence	14492-14515	4	0.833
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1614849-1614875	4	0.852
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP039905	Agrobacterium tumefaciens strain CFBP6623 plasmid pAtCFBP6623a, complete sequence	51861-51887	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	367183-367209	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	AF440695	Virus PhiCh1, complete genome	58196-58222	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NC_004084	Natrialba phage PhiCh1, complete genome	58196-58222	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	657721-657747	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	345670-345696	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP029362	Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence	61592-61618	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1778077-1778103	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	22147-22173	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	72444-72470	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	MH271303	Microbacterium phage MementoMori, complete genome	20739-20765	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	MN813682	Microbacterium phage Matzah, complete genome	21015-21041	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	MK937591	Microbacterium phage Cinna, complete genome	21039-21065	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	116472-116498	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	59488-59514	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	MT152150	Pseudomonas phage 8P, complete genome	40493-40519	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1178659-1178685	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	399632-399658	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1241207-1241233	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1145574-1145600	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	836227-836253	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1245812-1245838	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	149317-149343	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	303664-303690	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	66861-66887	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP049358	Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence	208557-208583	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	75944-75970	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	321626-321652	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	375217-375243	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	646126-646152	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	434813-434839	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	558560-558586	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	616941-616967	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	507884-507910	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	293668-293694	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP031159	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence	184933-184959	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	269636-269662	5	0.815
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	321288-321314	5	0.815
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	155076-155102	6	0.778
NZ_CP021001_2	2.9\|4111401\|27\|NZ_CP021001\|CRISPRCasFinder	4111401-4111427	27	NZ_CP031159	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence	275912-275938	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP005961	Pseudomonas mandelii JR-1 plasmid unnamed, complete sequence	193825-193851	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	349994-350020	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1667668-1667694	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	436000-436026	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	182702-182728	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	473219-473245	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP009572	Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence	81085-81111	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	MT553342	Microbacterium phage Kelcole, complete genome	23692-23718	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NC_048068	Microbacterium phage OneinaGillian, complete genome	23339-23365	6	0.778
NZ_CP021001_2	2.10\|4111458\|27\|NZ_CP021001\|CRISPRCasFinder	4111458-4111484	27	NZ_CP033874	Caulobacter sp. FWC26 plasmid p2	4960-4986	7	0.741
NZ_CP021001_2	2.11\|4111293\|31\|NZ_CP021001\|PILER-CR	4111293-4111323	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	513842-513872	8	0.742
NZ_CP021001_2	2.4\|4111395\|39\|NZ_CP021001\|CRT	4111395-4111433	39	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	463182-463220	9	0.769
NZ_CP021001_2	2.11\|4111293\|31\|NZ_CP021001\|PILER-CR	4111293-4111323	31	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	114529-114559	9	0.71

1. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

2. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

3. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

4. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

5. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

6. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

7. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

8. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

9. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

10. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

11. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

12. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

13. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

gagatcggtgccggtgcgcaaacc	CRISPR spacer
gagaccggtgccggcgcgcaaacc	Protospacer
****.*********.*********

14. spacer 2.8|4111347|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 2, identity: 0.917

cgcatcggcgacaacgcgcgtacc	CRISPR spacer
cgcagcggcgacaacgcgcgcacc	Protospacer
**** ***************.***

15. spacer 2.7|4111293|24|NZ_CP021001|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 3, identity: 0.875

gagatcggtgccggtgcgcaaacc	CRISPR spacer
cagagcggtgccggtgcgcatacc	Protospacer
 *** *************** ***

16. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 3, identity: 0.889

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
tcgctgggcctgaaggcgatcgtgtcc	Protospacer
 ********* *****.**********

17. spacer 2.8|4111347|24|NZ_CP021001|CRISPRCasFinder matches to NC_015059 (Granulicella tundricola MP5ACTX9 plasmid pACIX904, complete sequence) position: , mismatch: 4, identity: 0.833

cgcatcggcgacaacgcgcgtacc	CRISPR spacer
cgcatcggcgacaacgcgcttctg	Protospacer
******************* * .

18. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ttcgtcgagcgcggcagccagatcatg	Protospacer
.***.********************

19. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP039905 (Agrobacterium tumefaciens strain CFBP6623 plasmid pAtCFBP6623a, complete sequence) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
ttggcgggccagaaggtgatcgtgtgc	Protospacer
 .* .******************** *

20. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
aaagcgggccagaaggtggtcgtgtcc	Protospacer
* . .*************.********

21. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to AF440695 (Virus PhiCh1, complete genome) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
cagctggggcagacggtgatcgtgtcg	Protospacer
  ****** **** ************

22. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NC_004084 (Natrialba phage PhiCh1, complete genome) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
cagctggggcagacggtgatcgtgtcg	Protospacer
  ****** **** ************

23. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
tggatgggccagaaattgatcgtgtcc	Protospacer
  * **********. ***********

24. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
ttgcgcggccagaaggtgaccgtgtcc	Protospacer
 .**  *************.*******

25. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP029362 (Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gtgaccgagcgcagcagccagatcagg	Protospacer
 * .********.*************

26. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
accggcgagcgcggcagccagatcgct	Protospacer
 .** *******************. *

27. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gccgccgagcgcagcagcccgatcagc	Protospacer
 .**********.****** ******.

28. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcggcgagcgcggcggccagatcctc	Protospacer
**** **********.********  .

29. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to MH271303 (Microbacterium phage MementoMori, complete genome) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgagcgcggcatcccgatcctc	Protospacer
**************** ** ****  .

30. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgagcgcggcatcccgatcctc	Protospacer
**************** ** ****  .

31. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to MK937591 (Microbacterium phage Cinna, complete genome) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgagcgcggcatcccgatcctc	Protospacer
**************** ** ****  .

32. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gccgccgagcgcagcagcccgatcagc	Protospacer
 .**********.****** ******.

33. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gtgaccgagcgcagcagccagatcagg	Protospacer
 * .********.*************

34. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to MT152150 (Pseudomonas phage 8P, complete genome) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gtccttgagcgcggcagccagatcagc	Protospacer
 ** ..********************.

35. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

36. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

37. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

38. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

39. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

40. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

41. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

42. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

43. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

44. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP049358 (Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
catgccgagcgcggcagtcaggtcagc	Protospacer
* .**************.***.****.

45. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ttggccgagcgcggcaggcagagcagc	Protospacer
.* ************** **** ***.

46. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

47. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

48. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

49. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

50. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

51. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

52. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

53. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

54. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP031159 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
catgccgagcgcggcagtcaggtcagc	Protospacer
* .**************.***.****.

55. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

56. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.815

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgggcgcggcagccggataaag	Protospacer
*******.***********.*** *.

57. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
cagctgggccagaaagtgatcgtggaa	Protospacer
  ************.*********

58. spacer 2.9|4111401|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP031159 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence) position: , mismatch: 6, identity: 0.778

acgctgggccagaaggtgatcgtgtcc	CRISPR spacer
acgctgggccagcaggtggtcgtcgtt	Protospacer
************ *****.****  ..

59. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP005961 (Pseudomonas mandelii JR-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
aagaccgggcgcggcagccagaccagt	Protospacer
   .***.**************.****

60. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gacgccgagcgcggcagccaggtgatg	Protospacer
  *******************.* *

61. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gacgccgagcgcggccgccagctcaac	Protospacer
  ************* ***** ***..

62. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
atcgccgagcgcggcagccaactgggc	Protospacer
 *******************. * .*.

63. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gtcgccgagcgcggcatcgagatcgcg	Protospacer
 *************** * *****.

64. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
atcgccgagcgcggcagccaactgggc	Protospacer
 *******************. * .*.

65. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP009572 (Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
accgccgagcgcggcggccagttcaag	Protospacer
 .*************.***** ***.

66. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to MT553342 (Microbacterium phage Kelcole, complete genome) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgagcgcgtcagccagggcgag	Protospacer
************* *******. *..

67. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NC_048068 (Microbacterium phage OneinaGillian, complete genome) position: , mismatch: 6, identity: 0.778

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
ctcgccgagcgcgtcagccagggcgag	Protospacer
************* *******. *..

68. spacer 2.10|4111458|27|NZ_CP021001|CRISPRCasFinder matches to NZ_CP033874 (Caulobacter sp. FWC26 plasmid p2) position: , mismatch: 7, identity: 0.741

ctcgccgagcgcggcagccagatcagt	CRISPR spacer
gcggccgagcgcgtcagccagatcgaa	Protospacer
 . ********** **********..

69. spacer 2.11|4111293|31|NZ_CP021001|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 8, identity: 0.742

gagatcggtgccggtgcgcaaaccaagaatg	CRISPR spacer
gcattgggtgccggtgcgcaagccaacaaca	Protospacer
* . * ***************.**** **..

70. spacer 2.4|4111395|39|NZ_CP021001|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 9, identity: 0.769

tcgatcacgctgggccagaaggtgatcgtgtccggcggg	CRISPR spacer
cagcgctcgctgggcctgaaggcgatcgtgtccggcccg	Protospacer
. *  * ********* *****.*************  *

71. spacer 2.11|4111293|31|NZ_CP021001|PILER-CR matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 9, identity: 0.71

gagatcggtgccggtgcgcaaaccaagaatg	CRISPR spacer
cagagcggtgccggtgcgcatacctctgggg	Protospacer
 *** *************** ***   .. *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

239501 : 305450

Bacillus_phage(26.67%)

protease,transposase,integrase,holin

attL 291822:291839|attR 305537:305554

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022558430.1\|239501_241583_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_022558431.1\|241736_243896_+	S46 family peptidase	NA	NA	NA	NA
WP_007968929.1\|243989_244634_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_022558432.1\|244963_246262_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_022558433.1\|246329_247406_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_022558434.1\|247619_248366_+	CvpA family protein	NA	NA	NA	NA
WP_003483730.1\|248396_249863_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.1e-85	39.9
WP_007968937.1\|250058_250883_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_007968939.1\|252847_253267_+	hypothetical protein	NA	NA	NA	NA
WP_007973708.1\|253455_254199_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_022558435.1\|254599_255142_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_022558436.1\|255122_256259_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_022558437.1\|256470_257997_-	exopolyphosphatase	NA	NA	NA	NA
WP_022558438.1\|258167_260270_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_080720753.1\|260382_261726_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	6.5e-29	33.3
WP_003483753.1\|261783_262473_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_033481216.1\|262655_264302_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_033481211.1\|264451_264760_+	glutaredoxin 3	A0A2L0UZG6	Agrobacterium_phage	2.7e-07	43.2
WP_022558442.1\|264756_265152_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_003483762.1\|265378_266386_+	isocitrate dehydrogenase	NA	NA	NA	NA
WP_005927840.1\|266531_267293_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_007968966.1\|270128_271421_+	trigger factor	NA	NA	NA	NA
WP_002806026.1\|271513_272140_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.0e-56	57.4
WP_003483788.1\|272265_273552_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	5.3e-137	59.9
WP_022558443.1\|273695_276167_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.2e-224	52.2
WP_002806049.1\|276380_276653_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.2e-21	64.0
WP_033481213.1\|277291_279262_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_022558445.1\|279891_281070_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_022558446.1\|281066_281834_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_007968977.1\|281846_282503_+	hypothetical protein	NA	NA	NA	NA
WP_022558447.1\|282530_282983_+	ribonuclease HI	J9Q745	Salmonella_phage	1.8e-39	52.9
WP_022558448.1\|282991_283726_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.1e-35	40.6
WP_007968980.1\|284022_284727_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_022558449.1\|285269_285674_+	hypothetical protein	A0A1C9C5K8	Heterosigma_akashiwo_virus	1.1e-16	35.9
WP_022558450.1\|285864_286914_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_022558451.1\|286934_287684_+	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_007973306.1\|287683_288433_+	MBL fold metallo-hydrolase	A0A0A0RUN7	Bacillus_phage	1.4e-09	26.0
WP_022558452.1\|288432_289464_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_007968987.1\|289460_289841_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_022558453.1\|289866_290364_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_016849059.1\|290360_290606_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_033481214.1\|290602_291049_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
291822:291839	attL	NA	NA	NA	NA
WP_033481215.1\|292255_293089_+	hypothetical protein	NA	NA	NA	NA
WP_022558458.1\|293078_293342_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|293445_294426_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022558459.1\|294781_295141_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|296117_297344_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022558460.1\|297470_298112_-	type III effector protein	NA	NA	NA	NA
WP_033481895.1\|298696_299323_+	hypothetical protein	NA	NA	NA	NA
WP_022558462.1\|299315_300728_+	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|301668_302895_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022558463.1\|303123_303594_-	hypothetical protein	NA	NA	NA	NA
WP_022558464.1\|303593_303881_-	hypothetical protein	NA	NA	NA	NA
WP_022558465.1\|303917_305450_-\|integrase	site-specific integrase	NA	NA	NA	NA
305537:305554	attR	NA	NA	NA	NA

DBSCAN-SWA_2

607284 : 665762

uncultured_virus(44.44%)

tRNA,transposase,integrase

attL 593525:593540|attR 658627:658642

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
593525:593540	attL	NA	NA	NA	NA
WP_022558626.1\|607284_608043_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_007964565.1\|608265_609060_-	thiazole synthase	NA	NA	NA	NA
WP_022558627.1\|609109_609310_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_033481344.1\|609498_611283_+	autotransporter domain-containing esterase	NA	NA	NA	NA
WP_033481345.1\|611727_613101_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_022558630.1\|613451_614729_+	SidA/IucD/PvdA family monooxygenase	NA	NA	NA	NA
WP_080720848.1\|614762_615152_+	hypothetical protein	NA	NA	NA	NA
WP_022558631.1\|615579_615975_+	H-NS histone family protein	NA	NA	NA	NA
WP_033481347.1\|616117_617287_+	hypothetical protein	NA	NA	NA	NA
WP_080720850.1\|617665_618262_+	DUF1629 domain-containing protein	NA	NA	NA	NA
WP_022558633.1\|618294_620865_+	hypothetical protein	NA	NA	NA	NA
WP_022558634.1\|620998_621208_+	hypothetical protein	NA	NA	NA	NA
WP_022558635.1\|621411_622743_-	HipA domain-containing protein	NA	NA	NA	NA
WP_033481352.1\|622743_623112_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_022558637.1\|623435_624065_+	hypothetical protein	NA	NA	NA	NA
WP_022558638.1\|624006_625245_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_011345585.1\|625587_626814_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_033481814.1\|626987_629381_+	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	5.3e-106	32.2
WP_033481816.1\|629383_631483_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_022558641.1\|631475_632657_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_022558642.1\|633080_634976_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_131701852.1\|635254_635455_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|635559_636786_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022558643.1\|636839_637274_-	hypothetical protein	NA	NA	NA	NA
WP_022558644.1\|637331_638195_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_022558645.1\|638215_638536_-	helix-turn-helix transcriptional regulator	F8TVE5	EBPR_siphovirus	8.3e-07	32.3
WP_022558648.1\|639775_640213_+	hypothetical protein	NA	NA	NA	NA
WP_033481788.1\|640272_641397_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_033481790.1\|641421_641934_+	hypothetical protein	NA	NA	NA	NA
WP_022558651.1\|642023_642914_+	MobA/MobL family protein	NA	NA	NA	NA
WP_022558652.1\|642927_643122_+	hypothetical protein	NA	NA	NA	NA
WP_080720971.1\|643138_643468_-	hypothetical protein	NA	NA	NA	NA
WP_022558654.1\|643575_643887_-	hypothetical protein	NA	NA	NA	NA
WP_022558655.1\|644031_644400_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_022558656.1\|644742_646383_+	MobA/MobL family protein	NA	NA	NA	NA
WP_131701854.1\|646550_646778_+	hypothetical protein	NA	NA	NA	NA
WP_080720970.1\|646804_647401_+	hypothetical protein	NA	NA	NA	NA
WP_022558657.1\|647472_648423_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|648527_649754_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_033481809.1\|650644_651304_+	thermonuclease family protein	NA	NA	NA	NA
WP_003490667.1\|651414_651807_+	hypothetical protein	NA	NA	NA	NA
WP_003490669.1\|651897_652290_+	H-NS histone family protein	NA	NA	NA	NA
WP_007962333.1\|652923_655056_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_022558661.1\|655552_656440_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.7e-31	32.4
WP_033481811.1\|656626_657103_+	hypothetical protein	NA	NA	NA	NA
WP_003490678.1\|657128_657806_+	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	7.4e-05	27.4
WP_080720975.1\|657975_659133_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
658627:658642	attR	NA	NA	NA	NA
WP_022558664.1\|659234_659630_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_007975311.1\|659885_660866_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_127171639.1\|661340_661715_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|664535_665762_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3

DBSCAN-SWA_3

1227402 : 1315678

Ralstonia_phage(17.65%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003486879.1\|1227402_1228098_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_022558994.1\|1228282_1230298_-	M13 family metallopeptidase	NA	NA	NA	NA
WP_022558995.1\|1230481_1232581_-	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	6.7e-73	30.7
WP_022558996.1\|1232965_1235107_-	metallopeptidase	A0A1V0SHG2	Klosneuvirus	3.4e-72	27.7
WP_048481479.1\|1235419_1237180_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_022557821.1\|1237293_1238277_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_007963962.1\|1238391_1241454_-	TonB-dependent receptor	NA	NA	NA	NA
WP_022558998.1\|1241813_1244615_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.1e-14	35.6
WP_007963958.1\|1244952_1245804_+	iron-sulfur cluster carrier protein ApbC	Q8JL10	Natrialba_phage	7.1e-05	27.0
WP_022558999.1\|1245900_1246470_+	dCTP deaminase	S5VM63	Pseudomonas_phage	4.1e-73	70.6
WP_022559000.1\|1246626_1246812_-	hypothetical protein	NA	NA	NA	NA
WP_003486900.1\|1247057_1247225_-	hypothetical protein	NA	NA	NA	NA
WP_005912999.1\|1247252_1247687_-	HIT family protein	NA	NA	NA	NA
WP_007963954.1\|1247683_1248346_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_022559001.1\|1248631_1248892_+	hypothetical protein	NA	NA	NA	NA
WP_022559002.1\|1248888_1249965_+	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	1.4e-50	35.8
WP_033481761.1\|1249965_1250703_+	hypothetical protein	NA	NA	NA	NA
WP_022559004.1\|1250699_1251758_+	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	1.7e-104	55.8
WP_022559005.1\|1251711_1252155_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	9.7e-14	38.8
WP_011345585.1\|1252592_1253819_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022559006.1\|1255673_1256147_-	hypothetical protein	NA	NA	NA	NA
WP_080720949.1\|1256590_1256809_-	hypothetical protein	NA	NA	NA	NA
WP_022559008.1\|1257028_1258177_+	N-acetylmuramoyl-L-alanine amidase	M1IEI0	Bacillus_phage	1.4e-08	40.6
WP_022559009.1\|1258213_1259131_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_007965770.1\|1259740_1261108_+	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	1.2e-25	38.4
WP_007965767.1\|1261111_1261597_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_022559011.1\|1261632_1262448_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	4.2e-31	34.6
WP_007965764.1\|1262444_1263287_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_022559012.1\|1263454_1263835_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_022559013.1\|1263831_1265346_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_022559014.1\|1265502_1265847_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_007965756.1\|1265850_1266474_+	hypothetical protein	NA	NA	NA	NA
WP_022559016.1\|1266685_1268641_-	DUF839 domain-containing protein	NA	NA	NA	NA
WP_022559017.1\|1269075_1271688_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_022559018.1\|1271945_1273508_+	sodium/solute symporter	A0A240F465	Aeromonas_phage	3.6e-87	41.0
WP_022559019.1\|1273706_1275563_-	EAL domain-containing protein	NA	NA	NA	NA
WP_022559020.1\|1276011_1276998_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_003481988.1\|1277180_1277747_-	response regulator transcription factor	NA	NA	NA	NA
WP_080720948.1\|1277743_1278973_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_022559022.1\|1279175_1280441_+	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_022559023.1\|1282774_1283479_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_099770954.1\|1283622_1284492_-	DMT family transporter	NA	NA	NA	NA
WP_022559025.1\|1284527_1285580_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_007965740.1\|1285576_1286632_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_022559026.1\|1286637_1287411_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_033481610.1\|1287407_1287692_-	DUF4190 domain-containing protein	NA	NA	NA	NA
WP_022559029.1\|1288272_1289805_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_022559030.1\|1290389_1290836_-	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
WP_022559031.1\|1290832_1292086_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	NA	NA	NA	NA
WP_022559032.1\|1292089_1293988_-	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB	NA	NA	NA	NA
WP_033481600.1\|1293969_1295928_-	poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA	NA	NA	NA	NA
WP_033481602.1\|1296659_1298360_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_011345585.1\|1311999_1313226_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022557821.1\|1313304_1314288_-\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_145958483.1\|1314309_1314594_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|1314697_1315678_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5

DBSCAN-SWA_4

1490846 : 1544519

Ralstonia_phage(27.27%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007975311.1\|1490846_1491827_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_011345585.1\|1492388_1493615_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_099421717.1\|1494381_1494987_-	hypothetical protein	NA	NA	NA	NA
WP_033481747.1\|1495023_1496547_-	FkbM family methyltransferase	NA	NA	NA	NA
WP_033481745.1\|1496543_1497167_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_033481744.1\|1497156_1498302_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_017154665.1\|1498305_1498959_-	acetyltransferase	NA	NA	NA	NA
WP_033481743.1\|1498955_1499690_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.7e-07	26.8
WP_007962158.1\|1499686_1500451_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_033481742.1\|1500447_1501485_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003482998.1\|1501490_1501712_-	acyl carrier protein	NA	NA	NA	NA
WP_033481740.1\|1501776_1502886_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_033481738.1\|1503004_1504489_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_003482992.1\|1504481_1504865_-	response regulator transcription factor	NA	NA	NA	NA
WP_033481737.1\|1504873_1506277_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003482986.1\|1506493_1507126_-	response regulator transcription factor	NA	NA	NA	NA
WP_033481736.1\|1507194_1507761_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_008575949.1\|1507760_1508054_-	hypothetical protein	NA	NA	NA	NA
WP_003482976.1\|1508062_1508476_-	flagellar export chaperone FliS	NA	NA	NA	NA
WP_033481735.1\|1508626_1509952_-	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_127459501.1\|1509932_1510214_+	hypothetical protein	NA	NA	NA	NA
WP_007962409.1\|1510221_1511421_-	flagellin	NA	NA	NA	NA
WP_007975311.1\|1511606_1512587_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_003482970.1\|1512900_1514106_-	flagellar hook-associated protein FlgL	NA	NA	NA	NA
WP_033481772.1\|1514105_1515980_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_007971975.1\|1515991_1517170_-	flagellar assembly peptidoglycan hydrolase FlgJ	A0A0A7RU71	Clostridium_phage	5.5e-16	41.9
WP_007971976.1\|1517171_1518290_-	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_007971977.1\|1518300_1518993_-	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_003482961.1\|1519031_1519817_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_019300290.1\|1520579_1521335_-	flagellar basal-body rod protein FlgF	NA	NA	NA	NA
WP_003482957.1\|1521479_1522703_-	flagellar hook protein FlgE	NA	NA	NA	NA
WP_003482955.1\|1522734_1523400_-	flagellar basal body rod modification protein FlgD	NA	NA	NA	NA
WP_003482953.1\|1523437_1523845_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_033481774.1\|1523848_1524250_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_003482947.1\|1524571_1525516_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	5.6e-27	30.0
WP_007975311.1\|1525708_1526689_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_123766556.1\|1526763_1526991_-	hypothetical protein	NA	NA	NA	NA
WP_022559119.1\|1526989_1527634_+	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_003482943.1\|1527700_1528012_+	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
WP_003482942.1\|1528027_1528360_+	flagella protein	NA	NA	NA	NA
WP_022559120.1\|1528526_1529753_+	sensory protein of a two component system	NA	NA	NA	NA
WP_007964288.1\|1529879_1531601_-	EAL domain-containing protein	NA	NA	NA	NA
WP_046121200.1\|1531604_1533698_-	PAS domain S-box protein	NA	NA	NA	NA
WP_080720667.1\|1534127_1536644_+	EAL domain-containing protein	G3MA91	Bacillus_virus	5.5e-13	34.1
WP_022559123.1\|1537603_1537891_-	hypothetical protein	NA	NA	NA	NA
WP_005914458.1\|1537977_1539168_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-14	32.2
WP_007964280.1\|1539314_1539929_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_022559124.1\|1539928_1541065_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_022559125.1\|1541061_1541520_-	NUDIX hydrolase	NA	NA	NA	NA
WP_005914463.1\|1541773_1542094_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.0e-12	45.7
WP_022559128.1\|1542236_1544519_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.3e-175	45.0

DBSCAN-SWA_5

1681562 : 1691022

Xanthomonas_phage(45.45%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022559200.1\|1681562_1682366_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-09	25.6
WP_033481018.1\|1682547_1682886_+	phage-like protein	Q38057	Xanthomonas_phage	8.3e-42	74.1
WP_022559202.1\|1682952_1683264_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	1.0e-49	92.2
WP_022559203.1\|1683283_1684606_-	filamentous phage protein I	Q4LAU4	Stenotrophomonas_phage	1.2e-131	56.5
WP_022559204.1\|1684607_1684928_-	hypothetical protein	Q4LAU3	Stenotrophomonas_phage	3.5e-21	44.2
WP_080720658.1\|1684938_1686012_-	attachment protein	Q9XJ91	Xanthomonas_phage	5.2e-45	66.6
WP_005918131.1\|1686108_1686237_-\|coat	Phi-Lf prophage-derived major coat protein	NA	NA	NA	NA
WP_005918133.1\|1686268_1686385_-\|coat	Phi-Lf prophage-derived minor coat protein	NA	NA	NA	NA
WP_080720657.1\|1686330_1686492_-\|coat	coat protein	NA	NA	NA	NA
WP_022559206.1\|1686523_1686820_-	DNA-binding protein	B1NI78	Stenotrophomonas_phage	1.9e-26	66.3
WP_022559207.1\|1686816_1687926_-	phage-related protein	S0F3I3	Stenotrophomonas_phage	1.0e-160	75.0
WP_022559208.1\|1687918_1688101_-	hypothetical protein	NA	NA	NA	NA
WP_022559209.1\|1688097_1688322_-	hypothetical protein	A0A1D6ZIV2	Xanthomonas_phage	2.1e-17	78.5
WP_022559210.1\|1688449_1688845_+	filamentous phage Phi Lf replication initiation protein II	A0A077JCZ5	Xanthomonas_phage	4.5e-47	76.2
WP_011345585.1\|1689795_1691022_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3

DBSCAN-SWA_6

1963449 : 2045087

uncultured_Mediterranean_phage(37.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022559372.1\|1963449_1964289_+\|tRNA	serine--tRNA ligase	A0A1B1INV8	uncultured_Mediterranean_phage	6.3e-14	39.8
WP_007972342.1\|1964520_1965825_+	DUF445 family protein	NA	NA	NA	NA
WP_022559373.1\|1965968_1970063_+	response regulator	A0A1V0SGX0	Hokovirus	1.2e-57	28.9
WP_007962775.1\|1970096_1971083_+	response regulator	W8CYM9	Bacillus_phage	1.3e-05	27.6
WP_022559374.1\|1971646_1973083_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_022559375.1\|1973277_1973700_-	hypothetical protein	NA	NA	NA	NA
WP_022559376.1\|1973696_1974047_-	oxidoreductase	NA	NA	NA	NA
WP_007975311.1\|1974273_1975254_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022559377.1\|1975388_1976243_-	oxidoreductase	NA	NA	NA	NA
WP_022559378.1\|1976383_1976959_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_022559379.1\|1977090_1978173_+	alkene reductase	NA	NA	NA	NA
WP_022559380.1\|1978221_1979010_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_022559381.1\|1979234_1980236_+	NADP-dependent oxidoreductase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	1.3e-05	27.0
WP_033481698.1\|1980505_1980802_-	hypothetical protein	NA	NA	NA	NA
WP_033481697.1\|1981303_1986313_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_007962520.1\|1986591_1987251_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_022559385.1\|1987265_1988570_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007969992.1\|1988582_1991753_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_022559386.1\|1992090_1993086_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_022559387.1\|1993247_1995764_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.5e-10	29.3
WP_022559388.1\|1995760_1996717_+	1-phosphofructokinase	NA	NA	NA	NA
WP_022559389.1\|1996869_1998591_+	PTS fructose transporter subunit IIB'BC	NA	NA	NA	NA
WP_046833752.1\|1998904_2000041_+	carbohydrate porin	NA	NA	NA	NA
WP_022559391.1\|2000276_2000927_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|2006122_2007349_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_158525803.1\|2007912_2008083_-	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|2008149_2009376_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_080948419.1\|2009366_2009891_-	DUF1629 domain-containing protein	NA	NA	NA	NA
WP_145958732.1\|2010364_2010625_-	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|2010789_2011770_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_007975311.1\|2012139_2013120_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022559396.1\|2013853_2014411_-	hypothetical protein	NA	NA	NA	NA
WP_003489762.1\|2015837_2016806_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.0e-27	29.5
WP_080720938.1\|2016865_2018734_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_003489768.1\|2018900_2019254_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_022559400.1\|2019385_2020531_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.4e-85	45.6
WP_022559401.1\|2020612_2021683_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_022559402.1\|2021838_2022270_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_022559403.1\|2022392_2023889_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_022559404.1\|2024240_2024948_-	glycosyl transferase	NA	NA	NA	NA
WP_022559405.1\|2025321_2026701_-	metallophosphoesterase family protein	NA	NA	NA	NA
WP_096035810.1\|2026697_2027816_-	phytase	NA	NA	NA	NA
WP_080720939.1\|2027815_2030332_-	TonB-dependent receptor	NA	NA	NA	NA
WP_005931906.1\|2030525_2031158_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_022559408.1\|2031459_2033220_-	cellulase precursor	NA	NA	NA	NA
WP_022559409.1\|2033509_2035288_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_003489796.1\|2035284_2035569_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.1e-18	57.0
WP_003489798.1\|2035801_2036287_-	hypothetical protein	NA	NA	NA	NA
WP_005917071.1\|2036345_2036852_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.2e-25	41.1
WP_007970851.1\|2036848_2037472_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_022559410.1\|2037711_2039616_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	4.6e-113	36.7
WP_007975311.1\|2044106_2045087_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5

DBSCAN-SWA_7

2072645 : 2111148

Ralstonia_phage(83.33%)

transposase,integrase

attL 2101629:2101683|attR 2111149:2111203

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007975311.1\|2072645_2073626_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_080720940.1\|2074363_2074630_+	hypothetical protein	NA	NA	NA	NA
WP_022559424.1\|2074540_2074837_-	hypothetical protein	NA	NA	NA	NA
WP_033481652.1\|2074929_2076570_-	DUF5597 domain-containg protein	NA	NA	NA	NA
WP_022559426.1\|2076566_2078906_-	S9 family peptidase	NA	NA	NA	NA
WP_022559427.1\|2078895_2080482_-	APC family permease	NA	NA	NA	NA
WP_022559428.1\|2080545_2082411_-	DUF885 family protein	NA	NA	NA	NA
WP_022559429.1\|2082407_2084225_-	DUF885 family protein	NA	NA	NA	NA
WP_022559430.1\|2084342_2085542_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_022559431.1\|2085538_2087155_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_022559432.1\|2087365_2088274_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_080720942.1\|2088270_2089605_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_022559434.1\|2089576_2089822_-	hypothetical protein	NA	NA	NA	NA
WP_022559435.1\|2089818_2091096_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_022559436.1\|2091095_2092034_-	proline racemase	NA	NA	NA	NA
WP_007965956.1\|2092194_2092911_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_033481654.1\|2093116_2094727_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_022559439.1\|2095073_2096147_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_008571381.1\|2096170_2096446_+	oxidative damage protection protein	NA	NA	NA	NA
WP_007965960.1\|2096821_2098444_-	PAS domain-containing protein	NA	NA	NA	NA
WP_022559440.1\|2098775_2099234_-	hypothetical protein	NA	NA	NA	NA
WP_005914053.1\|2099666_2099867_+	general stress protein	NA	NA	NA	NA
WP_022559441.1\|2100104_2100959_+	excinuclease Cho	NA	NA	NA	NA
WP_005914051.1\|2101113_2101389_-	hypothetical protein	NA	NA	NA	NA
2101629:2101683	attL	NA	NA	NA	NA
WP_033481656.1\|2101982_2102246_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|2102473_2103454_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022559443.1\|2103589_2104147_-	hypothetical protein	NA	NA	NA	NA
WP_022559445.1\|2104563_2104743_+	hypothetical protein	NA	NA	NA	NA
WP_127459505.1\|2104711_2105245_-	hypothetical protein	NA	NA	NA	NA
WP_022557821.1\|2105408_2106392_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_131701847.1\|2106524_2106719_-	hypothetical protein	NA	NA	NA	NA
WP_022557821.1\|2106797_2107781_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_131705194.1\|2107852_2108443_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|2109089_2110070_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022559447.1\|2110301_2110490_+	hypothetical protein	NA	NA	NA	NA
WP_022559448.1\|2110497_2111148_+\|integrase	site-specific integrase	K4PAZ9	Burkholderia_phage	6.1e-41	52.0
2111149:2111203	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2303973 : 2314741

uncultured_Caudovirales_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033481262.1\|2303973_2305932_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-12	42.0
WP_003481884.1\|2307240_2307453_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	1.3e-13	76.5
WP_022559538.1\|2307592_2310241_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-84	40.0
WP_007966764.1\|2310342_2310831_-	recombination regulator RecX	NA	NA	NA	NA
WP_003481871.1\|2311128_2312163_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.1e-114	61.3
WP_007966767.1\|2312335_2312977_-	transcriptional repressor LexA	A0A1W6JNS2	Morganella_phage	2.4e-13	40.2
WP_022559539.1\|2313064_2314741_-	2-polyprenylphenol 6-hydroxylase	G8DDN0	Micromonas_pusilla_virus	1.1e-41	29.7

DBSCAN-SWA_9

2729699 : 2790778

Tupanvirus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022559762.1\|2729699_2732540_-\|protease	autotransporter serine protease	A0A1V0SBG2	Catovirus	3.9e-07	24.3
WP_022559763.1\|2732696_2733872_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_003489455.1\|2733994_2734336_+	hypothetical protein	NA	NA	NA	NA
WP_022559764.1\|2734564_2734891_+	hypothetical protein	NA	NA	NA	NA
WP_022559765.1\|2734998_2736708_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	9.5e-17	37.5
WP_022559766.1\|2736946_2737504_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_003489443.1\|2737500_2737866_+	hypothetical protein	NA	NA	NA	NA
WP_007967364.1\|2738104_2739127_+	ligase-associated DNA damage response exonuclease	NA	NA	NA	NA
WP_022559767.1\|2739123_2739357_+	hypothetical protein	NA	NA	NA	NA
WP_022559768.1\|2739353_2740958_+	ATP-dependent DNA ligase	A0A2H4JD86	uncultured_Caudovirales_phage	2.4e-09	29.0
WP_022559769.1\|2740954_2743456_+	ligase-associated DNA damage response DEXH box helicase	NA	NA	NA	NA
WP_022559770.1\|2743445_2744090_+	ligase-associated DNA damage response endonuclease PdeM	NA	NA	NA	NA
WP_022559771.1\|2744117_2745389_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_003488188.1\|2745484_2745691_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	9.3e-20	70.1
WP_003488190.1\|2745778_2746531_-	S-methyl-5'-thioinosine phosphorylase	NA	NA	NA	NA
WP_003488192.1\|2746613_2747168_-	hypoxanthine-guanine phosphoribosyltransferase	NA	NA	NA	NA
WP_022559772.1\|2747167_2748172_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_022559773.1\|2748289_2749867_-	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	6.9e-46	28.0
WP_033481246.1\|2750047_2751082_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_033481244.1\|2751098_2751782_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_022559776.1\|2751998_2752496_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_033481243.1\|2752671_2754006_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	F5CA72	Streptococcus_phi-m46.1-like_phage	5.0e-29	27.2
WP_022559778.1\|2754165_2754888_+	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_022559779.1\|2755285_2756008_-	DNA repair protein RecO	NA	NA	NA	NA
WP_022559780.1\|2756240_2757140_-	GTPase Era	NA	NA	NA	NA
WP_022559781.1\|2757136_2757817_-	ribonuclease III	A0A2K9L8W0	Tupanvirus	1.7e-17	29.5
WP_016850781.1\|2757806_2758214_-	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_007970507.1\|2758214_2759015_-	signal peptidase I	NA	NA	NA	NA
WP_007967401.1\|2759112_2760918_-	elongation factor 4	A0A2K9L6L3	Tupanvirus	1.6e-22	41.2
WP_022559782.1\|2761085_2762663_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.6e-26	29.9
WP_022559783.1\|2762772_2763666_-	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_022559784.1\|2763662_2764283_-	RNA polymerase sigma factor RpoE	NA	NA	NA	NA
WP_022559785.1\|2764518_2766600_+	fatty acid oxidation complex, subunit alpha fadj protein	NA	NA	NA	NA
WP_157768171.1\|2766725_2766863_-	hypothetical protein	NA	NA	NA	NA
WP_123766548.1\|2766875_2767229_-	hypothetical protein	NA	NA	NA	NA
WP_022559786.1\|2767279_2767573_-\|transposase	transposase	NA	NA	NA	NA
WP_007975311.1\|2768602_2769583_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_007975311.1\|2769919_2770900_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022559787.1\|2771321_2771525_-	hypothetical protein	NA	NA	NA	NA
WP_022559788.1\|2771665_2772631_-	cation transporter	NA	NA	NA	NA
WP_022559789.1\|2772850_2773738_-	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
WP_022559790.1\|2773908_2775096_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_022559791.1\|2775095_2775893_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_022559792.1\|2775889_2777071_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_022559793.1\|2777081_2778587_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_033481709.1\|2778724_2780110_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_022559795.1\|2780629_2783323_+	TonB-dependent receptor	NA	NA	NA	NA
WP_022559796.1\|2783512_2784724_+	arabinogalactan endo-1,4-beta-galactosidase	NA	NA	NA	NA
WP_022559797.1\|2784720_2787285_+	glycoside hydrolase family 2 protein	L0N6M2	Herpes_simplex_virus	1.1e-29	27.3
WP_033481711.1\|2787522_2787876_-	hypothetical protein	NA	NA	NA	NA
WP_022559798.1\|2788043_2789972_-	alpha-L-fucosidase	NA	NA	NA	NA
WP_033481713.1\|2790511_2790778_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

2998626 : 3039017

uncultured_virus(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011345585.1\|2998626_2999853_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_046830891.1\|2999865_3000513_-	hypothetical protein	NA	NA	NA	NA
WP_039731143.1\|3000512_3001259_-	abortive infection family protein	NA	NA	NA	NA
WP_022557849.1\|3001554_3002781_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_157858990.1\|3002872_3003109_+	hypothetical protein	NA	NA	NA	NA
WP_022557849.1\|3004060_3005287_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_007963395.1\|3005476_3005785_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_022559915.1\|3005791_3006055_-	hypothetical protein	NA	NA	NA	NA
WP_022559916.1\|3006833_3007364_-	hypothetical protein	NA	NA	NA	NA
WP_080720930.1\|3007491_3007875_-	hypothetical protein	NA	NA	NA	NA
WP_057668590.1\|3008928_3009147_+	hypothetical protein	NA	NA	NA	NA
WP_080720927.1\|3009188_3010235_-	hypothetical protein	NA	NA	NA	NA
WP_022559919.1\|3010600_3011191_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007962497.1\|3011261_3011975_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_123766547.1\|3012228_3012441_+	hypothetical protein	NA	NA	NA	NA
WP_022559921.1\|3015736_3017029_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	2.0e-75	38.0
WP_022559922.1\|3017591_3018056_-	hypothetical protein	NA	NA	NA	NA
WP_007962453.1\|3018278_3019142_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_007972198.1\|3019141_3020269_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_005996155.1\|3020967_3021354_-	response regulator	W8CYM9	Bacillus_phage	5.6e-10	31.8
WP_003483926.1\|3021850_3022750_-	DnaJ domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	7.0e-19	28.0
WP_022559923.1\|3023161_3023638_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_003483924.1\|3023800_3024283_+	peroxiredoxin	A0A1D8KSL1	Synechococcus_phage	7.0e-26	38.3
WP_003483923.1\|3024325_3024886_+	bacterioferritin	NA	NA	NA	NA
WP_033481616.1\|3025233_3027654_-	penicillin-binding protein 1C	NA	NA	NA	NA
WP_007962234.1\|3028058_3029006_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	3.8e-07	36.0
WP_022559926.1\|3029153_3032141_-	TonB-dependent receptor	NA	NA	NA	NA
WP_033481614.1\|3032363_3037286_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_007975311.1\|3038036_3039017_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5

DBSCAN-SWA_11

3135166 : 3146935

Enterobacteria_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005913455.1\|3135166_3136513_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.5e-33	27.1
WP_022559974.1\|3136559_3137963_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.1e-47	30.0
WP_022559975.1\|3138237_3139404_-	nucleotide sugar dehydrogenase	M1HZB2	Paramecium_bursaria_Chlorella_virus	2.5e-117	58.6
WP_007962671.1\|3139744_3140644_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-27	36.2
WP_016851441.1\|3140640_3141198_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	6.6e-44	48.9
WP_022559976.1\|3141194_3142082_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.5e-93	57.5
WP_005913448.1\|3142133_3143189_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.4e-82	47.1
WP_022559977.1\|3143408_3144155_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_022559978.1\|3144154_3145099_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_005913435.1\|3145978_3146935_+	glycosyltransferase family 2 protein	A0A192Y8W7	Salmonella_phage	1.8e-25	27.1

DBSCAN-SWA_12

3683056 : 3744274

Ralstonia_phage(28.57%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099770788.1\|3683056_3684038_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	9.7e-99	60.2
WP_033481385.1\|3684549_3685266_+	hypothetical protein	NA	NA	NA	NA
WP_007967074.1\|3685262_3685829_+	hypothetical protein	NA	NA	NA	NA
WP_022560294.1\|3686265_3687165_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_022560295.1\|3688004_3690809_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	9.6e-67	30.1
WP_003487371.1\|3690885_3691176_+	DUF2782 domain-containing protein	NA	NA	NA	NA
WP_022560296.1\|3691485_3692529_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_022560297.1\|3692578_3699706_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_033481383.1\|3699717_3701394_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_022560299.1\|3701390_3701852_-	hypothetical protein	NA	NA	NA	NA
WP_022560300.1\|3701848_3705538_-	protein kinase	Q0N495	Clanis_bilineata_nucleopolyhedrovirus	9.2e-09	29.9
WP_033481382.1\|3706255_3706831_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_033481381.1\|3706827_3710358_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_022560303.1\|3710354_3711635_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_007967095.1\|3711616_3712951_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_022560304.1\|3713532_3714840_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_022560306.1\|3715123_3715672_-	hypothetical protein	NA	NA	NA	NA
WP_022560307.1\|3715668_3717636_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.1e-38	28.7
WP_022560308.1\|3717785_3719117_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_007967108.1\|3719346_3719661_-	hypothetical protein	NA	NA	NA	NA
WP_033481380.1\|3719704_3722224_-	serine/threonine protein kinase	A0A2P1EMR8	Moumouvirus	8.0e-12	29.2
WP_033481379.1\|3722202_3722742_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_022560311.1\|3723091_3723619_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_033481384.1\|3723615_3724686_+	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_022560313.1\|3725151_3728037_+	TonB-dependent receptor	NA	NA	NA	NA
WP_022560314.1\|3728140_3729442_+	histidine-type phosphatase	NA	NA	NA	NA
WP_007967121.1\|3729512_3730817_+	hypothetical protein	NA	NA	NA	NA
WP_022560315.1\|3731434_3732178_-	hypothetical protein	NA	NA	NA	NA
WP_022560316.1\|3732582_3734610_-	hypothetical protein	NA	NA	NA	NA
WP_033481378.1\|3734922_3735186_+	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|3735336_3736563_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_123766583.1\|3736739_3737234_-	hypothetical protein	NA	NA	NA	NA
WP_022560317.1\|3737367_3737865_-	hypothetical protein	NA	NA	NA	NA
WP_022560318.1\|3738078_3740823_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	6.7e-81	29.4
WP_022560319.1\|3740878_3741919_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_022560320.1\|3741882_3743766_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_007964038.1\|3743770_3744274_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_13

3970502 : 4011084

Ralstonia_phage(33.33%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011345585.1\|3970502_3971729_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022560442.1\|3972237_3973857_+	hypothetical protein	NA	NA	NA	NA
WP_022560443.1\|3973960_3974359_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_046121223.1\|3975122_3975815_-	DUF2306 domain-containing protein	NA	NA	NA	NA
WP_022560447.1\|3975845_3976748_-	ribosomal large subunit pseudouridine synthase	NA	NA	NA	NA
WP_022560449.1\|3977080_3978658_+	hypothetical protein	NA	NA	NA	NA
WP_022560450.1\|3979134_3979971_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|3980408_3981389_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022557821.1\|3981526_3982510_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_033481960.1\|3982951_3983218_-	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|3983718_3984699_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_022560451.1\|3985528_3986005_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_022560452.1\|3986067_3986637_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_033481799.1\|3986757_3987330_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_022560454.1\|3987414_3988158_+	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	5.0e-15	28.8
WP_003482333.1\|3989711_3990044_+	hypothetical protein	NA	NA	NA	NA
WP_022560456.1\|3990234_3992160_+	M61 family metallopeptidase	NA	NA	NA	NA
WP_005912356.1\|3992308_3992407_+	hypothetical protein	NA	NA	NA	NA
WP_022560457.1\|3992508_3993903_-	hypothetical protein	NA	NA	NA	NA
WP_022560458.1\|3994474_3996913_-	AAA family ATPase	A0A0N9S864	Staphylococcus_phage	8.0e-09	43.6
WP_022560459.1\|3997115_4001138_-	exodeoxyribonuclease V subunit beta	S5MMD7	Bacillus_phage	7.0e-10	21.5
WP_033481432.1\|4001134_4004539_-	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_022560461.1\|4004888_4009676_-	autotransporter domain-containing protein	F5B3Z3	Synechococcus_phage	3.4e-19	45.8
WP_007968272.1\|4009936_4010488_+\|tail	phage tail protein	NA	NA	NA	NA
WP_007968270.1\|4010556_4011084_+\|tail	phage tail protein	A0A0U4JYA4	Arthrobacter_phage	1.0e-09	28.0

DBSCAN-SWA_14

4042770 : 4106541

Enterobacteria_phage(10.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022560486.1\|4042770_4045800_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_022560487.1\|4045796_4046390_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	6.8e-39	48.6
WP_022557731.1\|4046601_4046856_+	plasmid stability protein	NA	NA	NA	NA
WP_022560489.1\|4048167_4049010_+	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|4049586_4050813_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_007975311.1\|4051654_4052635_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_017158359.1\|4052758_4053040_-	hypothetical protein	NA	NA	NA	NA
WP_108702726.1\|4053227_4053494_+	hypothetical protein	A0A0P0ZG22	Escherichia_phage	1.1e-15	60.0
WP_011153925.1\|4053522_4054152_+	AAA family ATPase	A2I303	Vibrio_virus	3.8e-40	44.2
WP_017154799.1\|4054148_4054403_+	hypothetical protein	NA	NA	NA	NA
WP_017154798.1\|4054542_4054935_+	hypothetical protein	NA	NA	NA	NA
WP_022560493.1\|4057394_4059869_-	glycoside hydrolase family 92 protein	NA	NA	NA	NA
WP_022560494.1\|4060708_4061098_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_022560495.1\|4064501_4065671_-	glycerate kinase	W6LM47	Streptococcus_phage	4.0e-43	39.0
WP_022560496.1\|4065696_4067007_-	MFS transporter	NA	NA	NA	NA
WP_022560497.1\|4067486_4068743_-	dipeptidase precursor	NA	NA	NA	NA
WP_022560498.1\|4069030_4069351_-	hypothetical protein	NA	NA	NA	NA
WP_007968235.1\|4069469_4070636_-	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_005912402.1\|4070900_4071857_+	TerC family protein	K4F9T9	Cronobacter_phage	1.3e-31	31.4
WP_033481510.1\|4072195_4072981_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_033481512.1\|4073100_4074195_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_022560502.1\|4074340_4076641_-	TonB-dependent receptor	NA	NA	NA	NA
WP_022560503.1\|4076832_4077690_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_022560504.1\|4077851_4079192_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_022560505.1\|4080769_4082494_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_007968218.1\|4082519_4082957_-	ribonuclease P protein component	NA	NA	NA	NA
WP_002805908.1\|4082995_4083136_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_022557774.1\|4083378_4084707_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_005912436.1\|4084983_4086084_+	DNA polymerase III subunit beta	A0A0A8IL17	Aurantimonas_phage	1.1e-53	37.1
WP_022557775.1\|4087117_4088224_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_022557776.1\|4088338_4090783_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.6e-113	34.7
WP_022557777.1\|4090850_4091687_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_022557778.1\|4091871_4092678_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_022557779.1\|4092955_4094149_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005921855.1\|4094302_4094971_+	energy transducer TonB	NA	NA	NA	NA
WP_005912445.1\|4095057_4095819_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_005912447.1\|4095865_4096288_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_005912449.1\|4096291_4096705_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_022557780.1\|4097207_4097615_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_007968197.1\|4097867_4098635_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_005912451.1\|4098642_4098912_-	hypothetical protein	NA	NA	NA	NA
WP_022557781.1\|4098986_4100447_-	cardiolipin synthase	NA	NA	NA	NA
WP_022557782.1\|4100747_4101473_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_033481282.1\|4101521_4101887_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_022557784.1\|4102010_4103138_-	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_033481283.1\|4103322_4104024_-	2OG-Fe(II) oxygenase	E3SK61	Synechococcus_phage	1.0e-17	47.2
WP_007968187.1\|4104288_4105629_-	outer membrane protein transport protein	NA	NA	NA	NA
WP_003482177.1\|4105848_4106541_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_15

4209659 : 4276070

Ralstonia_phage(37.5%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022557821.1\|4209659_4210643_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_022557821.1\|4210825_4211809_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	8.2e-98	59.9
WP_080720993.1\|4212398_4212782_+	hypothetical protein	NA	NA	NA	NA
WP_022557849.1\|4213047_4214274_-\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_011345585.1\|4214840_4216067_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022557850.1\|4216457_4220324_-	secreted protein	NA	NA	NA	NA
WP_007964720.1\|4220689_4223470_-	TonB-dependent receptor	NA	NA	NA	NA
WP_022557851.1\|4223755_4224778_+	sugar kinase	NA	NA	NA	NA
WP_033481584.1\|4225351_4226560_-	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_022557853.1\|4226841_4230189_+	AAA family ATPase	NA	NA	NA	NA
WP_007970760.1\|4230185_4230584_+	hypothetical protein	NA	NA	NA	NA
WP_033481586.1\|4230722_4231271_-	hypothetical protein	NA	NA	NA	NA
WP_022557855.1\|4232321_4232954_-	response regulator transcription factor	NA	NA	NA	NA
WP_033481588.1\|4232950_4234150_-	sensor histidine kinase	NA	NA	NA	NA
WP_022557857.1\|4234235_4235468_-	serine hydrolase	NA	NA	NA	NA
WP_022557858.1\|4235715_4236882_+	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_022557859.1\|4237018_4237978_-	Ku protein	NA	NA	NA	NA
WP_080720923.1\|4237977_4238286_-	hypothetical protein	NA	NA	NA	NA
WP_022557861.1\|4238527_4238707_+	hypothetical protein	NA	NA	NA	NA
WP_022557862.1\|4238812_4239208_-	DUF779 domain-containing protein	NA	NA	NA	NA
WP_033481593.1\|4239385_4240915_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_022557865.1\|4241999_4242296_-	hypothetical protein	NA	NA	NA	NA
WP_080720924.1\|4242502_4244698_-	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	1.1e-68	41.2
WP_016849085.1\|4244797_4246000_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_022557867.1\|4246265_4247276_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.6e-48	37.5
WP_022557868.1\|4247524_4247914_+	hypothetical protein	NA	NA	NA	NA
WP_080720925.1\|4248316_4249897_+	TldD/PmbA family protein	NA	NA	NA	NA
WP_080950217.1\|4250056_4250626_+	hypothetical protein	NA	NA	NA	NA
WP_007970327.1\|4250628_4252224_+	TldD/PmbA family protein	NA	NA	NA	NA
WP_007962710.1\|4252238_4253573_+	TldD/PmbA family protein	NA	NA	NA	NA
WP_033481683.1\|4253569_4254388_+	DUF4159 domain-containing protein	NA	NA	NA	NA
WP_007962712.1\|4254519_4255512_+	MoxR family ATPase	NA	NA	NA	NA
WP_007962713.1\|4255525_4256422_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_033481682.1\|4256465_4257665_+	membrane protein	NA	NA	NA	NA
WP_080720951.1\|4257583_4259920_+	hypothetical protein	NA	NA	NA	NA
WP_022557872.1\|4260077_4261859_+	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_040092218.1\|4262109_4262766_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_033481679.1\|4262943_4263735_-	EcsC family protein	NA	NA	NA	NA
WP_022557875.1\|4263905_4264379_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_007962295.1\|4264714_4266205_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	1.4e-53	31.4
WP_022557876.1\|4266737_4267067_-	thioredoxin family protein	NA	NA	NA	NA
WP_003487911.1\|4267087_4267486_-	host attachment protein	NA	NA	NA	NA
WP_033481685.1\|4267867_4271590_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_033481677.1\|4271873_4272344_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_022557879.1\|4272577_4273234_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_022557880.1\|4273343_4274414_+	M4 family metallopeptidase	NA	NA	NA	NA
WP_022557881.1\|4274410_4274722_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|4275089_4276070_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5

DBSCAN-SWA_16

4739903 : 4824957

uncultured_virus(13.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011345585.1\|4739903_4741130_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_007975311.1\|4741491_4742472_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_080720994.1\|4743261_4743651_+	hypothetical protein	NA	NA	NA	NA
WP_011345585.1\|4747138_4748365_+\|transposase	IS256-like element ISXax1 family transposase	A0A218MNI5	uncultured_virus	2.2e-52	50.3
WP_022558162.1\|4750116_4750923_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_099770788.1\|4751038_4752020_+\|transposase	IS5-like element ISXfu1 family transposase	A0A077K814	Ralstonia_phage	9.7e-99	60.2
WP_022558164.1\|4753566_4754301_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_033480920.1\|4754350_4755295_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_022558166.1\|4755541_4755853_+	hypothetical protein	NA	NA	NA	NA
WP_022558167.1\|4755941_4757528_-	SDR family oxidoreductase	M1NLX1	Moumouvirus	5.0e-36	27.8
WP_033480933.1\|4757884_4758664_+	SPFH domain-containing protein	A0A2D2W2L0	Stenotrophomonas_phage	3.1e-92	68.1
WP_022558168.1\|4758801_4759776_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_033480932.1\|4759847_4760243_+	VOC family protein	NA	NA	NA	NA
WP_080720613.1\|4760356_4760824_-	DUF4126 domain-containing protein	NA	NA	NA	NA
WP_022558171.1\|4762956_4763292_+	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_022558173.1\|4763692_4766020_-	S9 family peptidase	NA	NA	NA	NA
WP_022558174.1\|4766376_4767468_-	DUF1615 domain-containing protein	NA	NA	NA	NA
WP_022558175.1\|4767973_4769848_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.3e-14	31.5
WP_033480931.1\|4770194_4770389_+	hypothetical protein	NA	NA	NA	NA
WP_022558176.1\|4770616_4771174_-	hypothetical protein	NA	NA	NA	NA
WP_033480919.1\|4771379_4772264_-	hypothetical protein	NA	NA	NA	NA
WP_099770902.1\|4772452_4773337_+	DMT family transporter	NA	NA	NA	NA
WP_022558179.1\|4773437_4774217_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_022558180.1\|4774518_4774734_+	hypothetical protein	NA	NA	NA	NA
WP_022558181.1\|4775152_4776529_+	D-serine/D-alanine/glycine transporter	NA	NA	NA	NA
WP_080720610.1\|4776615_4777482_-	type III secretion system effector protein	NA	NA	NA	NA
WP_033480917.1\|4777865_4778768_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_022558183.1\|4779082_4779775_-	AIM24 family protein	NA	NA	NA	NA
WP_022558184.1\|4780120_4781794_-	alpha,alpha-trehalase TreA	NA	NA	NA	NA
WP_033480916.1\|4782942_4783695_+	endonuclease	NA	NA	NA	NA
WP_080720618.1\|4784190_4785180_+	hypothetical protein	NA	NA	NA	NA
WP_003489747.1\|4785678_4786608_-	GAF domain-containing protein	NA	NA	NA	NA
WP_022558187.1\|4787169_4790049_-	insulinase family protein	NA	NA	NA	NA
WP_033480915.1\|4790152_4792894_+	PAS domain S-box protein	G3MA91	Bacillus_virus	2.1e-10	29.2
WP_022558189.1\|4793613_4795818_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-11	65.7
WP_022558190.1\|4796069_4797494_-	cellulase family glycosylhydrolase	G0YQI7	Erwinia_phage	2.1e-54	33.6
WP_022558191.1\|4797706_4799194_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.3e-126	56.9
WP_022558192.1\|4800816_4802466_+	M28 family peptidase	NA	NA	NA	NA
WP_127459433.1\|4802656_4802905_-	hypothetical protein	NA	NA	NA	NA
WP_022558194.1\|4803532_4805470_+	glucans biosynthesis glucosyltransferase MdoH	NA	NA	NA	NA
WP_022558195.1\|4805630_4806299_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_007965004.1\|4806303_4807356_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.1e-18	33.5
WP_022558196.1\|4807386_4808124_+	response regulator transcription factor	NA	NA	NA	NA
WP_022558197.1\|4808154_4809069_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_005916853.1\|4809394_4810195_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_005916857.1\|4810743_4811709_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_003482775.1\|4811818_4812388_-	lipocalin family protein	NA	NA	NA	NA
WP_022558199.1\|4812766_4813078_+	hypothetical protein	NA	NA	NA	NA
WP_007973684.1\|4813145_4815239_+	S9 family peptidase	NA	NA	NA	NA
WP_022558200.1\|4815629_4816814_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_022558201.1\|4816923_4819059_+	S9 family peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	3.9e-28	25.4
WP_003482768.1\|4819421_4819820_+	YbaN family protein	NA	NA	NA	NA
WP_022558202.1\|4819876_4820131_+	hypothetical protein	NA	NA	NA	NA
WP_022558203.1\|4820120_4820975_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_080720608.1\|4820962_4821643_+	DUF484 family protein	NA	NA	NA	NA
WP_022558204.1\|4821823_4822741_+	tyrosine recombinase XerC	S5M872	Bacillus_phage	1.3e-12	26.8
WP_003482763.1\|4822937_4823489_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_022558205.1\|4823589_4824957_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	1.5e-41	29.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021003

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection