CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024647	Bacillus sp. Lzh-5 chromosome, complete genome	1 crisprs	csa3,DinG,casR,cas3,DEDDh,WYL	0	0	6	0
NZ_CP024648	Bacillus sp. Lzh-5 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024647_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024647_1

701837-701904

Orphan

Consensus_repeat	Method
GGCTACCCGGGGTACGGTTTTGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024647_1

>merge|NZ_CP024647|1|701837-701904|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGGCCACGGAGGCTTCGGAGGATATCCGGGATACGGTTTCGGCGG

>NZ_CP024647|1|1|701837-701904|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGG	CCACGGAGGCTTCGGA
GGATATCCGGGATACGGTTTCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024647.1\|WP_007408934.1\|703496_703760_+\|spore-coat-protein-CotJB	unknown	unknown	gnl\|CDD\|378904
NZ_CP024647.1\|WP_007408938.1\|706521_706884_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP024647.1\|WP_003155696.1\|706110_706437_-\|heme-degrading-oxygenase-HmoA	unknown	unknown	gnl\|CDD\|225209
NZ_CP024647.1\|WP_038461258.1\|692932_693247_+\|plasmid-maintenance-system-killer-protein	unknown	unknown	gnl\|CDD\|226079
NZ_CP024647.1\|WP_022552721.1\|697458_697854_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379476
NZ_CP024647.1\|WP_038461754.1\|695603_696059_-\|TIGR01741-family-protein	unknown	unknown	gnl\|CDD\|130802
NZ_CP024647.1\|WP_022552722.1\|698695_700579_-\|ribonuclease-YeeF-family-protein	unknown	unknown	gnl\|CDD\|227731
NZ_CP024647.1\|WP_022552715.1\|693262_694336_+\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP024647.1\|WP_022552724.1\|702261_703131_+\|aminoglycoside-6-adenylyltransferase	unknown	unknown	gnl\|CDD\|377357
NZ_CP024647.1\|WP_003155704.1\|703264_703513_+\|spore-coat-associated-protein-CotJA	unknown	unknown	gnl\|CDD\|378536
NZ_CP024647.1\|WP_079891363.1\|694961_695090_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367610
NZ_CP024647.1\|WP_022552716.1\|695101_695584_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP024647.1\|WP_022552718.1\|696150_696621_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP024647.1\|WP_022552726.1\|704996_705275_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372929
NZ_CP024647.1\|WP_017419063.1\|705388_706078_+\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP024647.1\|WP_003155709.1\|700877_701597_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NZ_CP024647.1\|WP_003155700.1\|703774_704344_+\|spore-coat-protein-CotJC	unknown	unknown	gnl\|CDD\|252986
NZ_CP024647.1\|WP_022552725.1\|704432_704966_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235142
NZ_CP024647.1\|WP_015417243.1\|698388_698679_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376019
NZ_CP024647.1\|WP_014417142.1\|707044_707911_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912

Protein	Function_ID	Function_description	E-value
NZ_CP024647.1\|WP_007408934.1\|703496_703760_+\|spore-coat-protein-CotJB	gnl\|CDD\|378904	pfam12652, CotJB, CotJB protein. CotJ is a sigma E-controlled operon involved in the spore coat of Bacillus subtilis. This protein has been identified as a spore coat protein.	2.72958e-30
NZ_CP024647.1\|WP_007408938.1\|706521_706884_-\|hypothetical-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.20004e-35
NZ_CP024647.1\|WP_003155696.1\|706110_706437_-\|heme-degrading-oxygenase-HmoA	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.45762e-20
NZ_CP024647.1\|WP_038461258.1\|692932_693247_+\|plasmid-maintenance-system-killer-protein	gnl\|CDD\|226079	COG3549, HigB, Plasmid maintenance system killer protein [General function prediction only].	0.00184777
NZ_CP024647.1\|WP_022552721.1\|697458_697854_-\|hypothetical-protein	gnl\|CDD\|379476	pfam14112, DUF4284, Immunity protein 22. A predicted immunity protein with an alpha+beta fold and conserved tryptophan,tyrosine and an acidic residues. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the ColD/E5, Tox-REase-4, Ntox49 or Ntox14 families. The domain is also found in heterogeneous polyimmunity loci.	2.36379e-17
NZ_CP024647.1\|WP_038461754.1\|695603_696059_-\|TIGR01741-family-protein	gnl\|CDD\|130802	TIGR01741, staph_tand_hypo, conserved hypothetical protein. This model represents a tandem array of 10 proteins in Staphylococcus aureus and the C-terminal region of one protein each in Bacillus subtilis and Bacillus halodurans.	1.93774e-64
NZ_CP024647.1\|WP_022552722.1\|698695_700579_-\|ribonuclease-YeeF-family-protein	gnl\|CDD\|227731	COG5444, COG5444, Uncharacterized conserved protein [Function unknown].	2.6239e-82
NZ_CP024647.1\|WP_022552715.1\|693262_694336_+\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	6.88993e-13
NZ_CP024647.1\|WP_022552724.1\|702261_703131_+\|aminoglycoside-6-adenylyltransferase	gnl\|CDD\|377357	pfam04439, Adenyl_transf, Streptomycin adenylyltransferase. Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.	6.41428e-147
NZ_CP024647.1\|WP_003155704.1\|703264_703513_+\|spore-coat-associated-protein-CotJA	gnl\|CDD\|378536	pfam11007, CotJA, Spore coat associated protein JA (CotJA). CotJA is part of the CotJ operon which contains CotJA and CotJC. The operon encodes spore coat proteins. Interaction of CotJA with CotJC is required for the assembly of both CotJA and CotJC into the spore coat.	6.06894e-07
NZ_CP024647.1\|WP_079891363.1\|694961_695090_-\|hypothetical-protein	gnl\|CDD\|367610	pfam03691, UPF0167, Uncharacterized protein family (UPF0167). The proteins in this family are about 200 amino acids long and each contain 3 CXXC motifs.	5.98715e-10
NZ_CP024647.1\|WP_022552716.1\|695101_695584_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	3.52443e-54
NZ_CP024647.1\|WP_022552718.1\|696150_696621_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	3.49359e-56
NZ_CP024647.1\|WP_022552726.1\|704996_705275_+\|hypothetical-protein	gnl\|CDD\|372929	pfam14150, YesK, YesK-like protein. The YesK-like protein family includes the B. subtilis YesK protein, which is functionally uncharacterized. Its expression is regulated by the sporulation-specific sigma factor sigma-E. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length.	5.3629e-11
NZ_CP024647.1\|WP_017419063.1\|705388_706078_+\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	3.31508e-65
NZ_CP024647.1\|WP_003155709.1\|700877_701597_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	5.42044e-137
NZ_CP024647.1\|WP_003155700.1\|703774_704344_+\|spore-coat-protein-CotJC	gnl\|CDD\|252986	pfam05067, Mn_catalase, Manganese containing catalase. Catalases are important antioxidant metalloenzymes that catalyze disproportionation of hydrogen peroxide, forming dioxygen and water. Two families of catalases are known, one having a heme cofactor, and this family that is a structurally distinct family containing non-heme manganese.	9.22523e-95
NZ_CP024647.1\|WP_022552725.1\|704432_704966_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|235142	PRK03624, PRK03624, putative acetyltransferase; Provisional.	1.14429e-05
NZ_CP024647.1\|WP_015417243.1\|698388_698679_-\|hypothetical-protein	gnl\|CDD\|376019	pfam18593, CdiI_2, CdiI immunity protein. Contact-dependent growth inhibition (CDI) is an important mechanism of inter-bacterial competition found in many Gram-negative pathogens. CDI+ cells express cell-surface CdiA proteins that bind neighboring bacteria and deliver C-terminal toxin domains (CdiA-CT) to inhibit target-cell growth. CDI+ bacteria also produce CdiI immunity proteins, which specifically neutralize cognate CdiA-CT toxins to prevent self-inhibition. Structure analysis of CdiI immunity protein from Yersinia kristensenii shows that it is composed of eight alpha-helices packed together to form a nearly spherical structure with weak structural homology to a putative TetR family transcriptional repressor. The CdiI protein fits into the curved cavity of the CdiA-CTYkris toxin domain where it most likely neutralizes toxin activity by blocking access to RNA substrates. This domain is mostly found in gammaproteobacteria.	1.0199e-10
NZ_CP024647.1\|WP_014417142.1\|707044_707911_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	6.84253e-36

>NZ_CP024647.1|WP_003155709.1|700877_701597_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKNIIERAIEKAKGGAEENFDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGKNGGNMGVSGSVAYMFDATAVIGVEGKTADEALELLMEADVDVRDILEEDDSVIVYAEPDQFHAVQEAFKNAGVEEFTVAELTMLAQNEVELPEDAKAQFEKLIDVLEDLEDVQQVYHNVDLGE
>NZ_CP024647.1|WP_022552722.1|698695_700579_-|ribonuclease-YeeF-family-protein
MKLFEANSLLAAAKQRAGEYKKLRGQMVNLKKAFQGMADLGDGDFSGRGADNIKAFFQDHAGVTDSWLDLIDMKIAFLTSLPGKVEDAGLSNSHVEESFLEHELTHALSKSKAIMEEQKKDMRSILGEIEDIISLDLFSTESTDQKLSSADKKRIETIHKLGKLDHDLTKEYAETEANEQFIQADFQQLQNATGKGKSATPLHYNAKAYRESDIHKKKGDIARHSDAYLTIKKEEAKEREIKDLKKKLADGVTDPDEYLEIAKKIGYENLEPAQVQYVMQLEQAKQLEEVGETAWDIVKGIGVGLYDVGKDTITGVKDLAVGAWDFYHLSDEQKVAKTISGVLNTPSYAKIIWTNLADSWNDKMVNGDAYSRSHYITYAIGSIVGLKGSGSAVKVSSKLAKTGAAKVDNVLEAGEKAAVKHVKTGIEKGKDYINSVSKNKYEPALAGMAQNIENTHNVKNTPLLKSIIEDQKESVLSKSVTSDNSGIHSVKQGDSSPLAPGGGLAAHEAKGGHLIERHVGKTDKELIKRLRTDPNPHITASSTFNDRATAERIATSVLNDPKNTKKIENWIDDPKKPKLMLRYKGDGEIIGRSVSRNSELVENVTNAKIILKKDNNGNFILTGYPTK
>NZ_CP024647.1|WP_015417243.1|698388_698679_-|hypothetical-protein
MDERYDFLDELENFLGATFHQDIQSPEHALDEFIEEISKEGLLFTVKYCEEFLNSDLTKEEKEDIIKCNAEIYFPTIGLPPIEWLKSVIEQLKEAI
>NZ_CP024647.1|WP_022552721.1|697458_697854_-|hypothetical-protein
MERQNYVSLWIGSIKDNESLSKYVELVYNEDEGDFLPSQFLIDFDIDIDDLDEDFIEKVAHENSRNNLPALIDGCSYDSVILPRFEDMVGTTLPDQINAAVLLYNFEYDGREKEINAKNYSFKFIGAVSYV
>NZ_CP024647.1|WP_022552718.1|696150_696621_-|antitoxin-YezG-family-protein
METEKMGIIYQKIAEQINEIIPSEWEKVALYAEILDDSSEVYFFFTTPQNQEYIYSHDIPEHFNVDEDIYDELLYELHDYLEELRDEFKTNNEDLWTNLTLHLERSGKFSIDYDYTDVIASDLNGTQRQVVWEYKNLGILPEDEDDKQFVISYFGL
>NZ_CP024647.1|WP_038461754.1|695603_696059_-|TIGR01741-family-protein
MQDLYQIIGEKLNDIIPCEWTKIYLYAEVLDDSTMVLFHFKTPEKCQLIYSQDIPVRYSVSKDIFKTLLREIRELFEELRAEHKNNNDQVWTNLTLTLESNGPFQLDYNDDDILASELDGYQRIALWEYKTLGILPEDEEDQEFLISYLNL
>NZ_CP024647.1|WP_022552716.1|695101_695584_-|antitoxin-YezG-family-protein
METEKMGELYQQIAEGINEIIPSEWEKVILYAEILDDSSEVFFYFNPPQSEDYIYSHNIPEHFHVSEDIYDELLLQLHDSFEELRDEFKENNQDIWTNLTLQLEINGKLSIEYDYEDVLQSQYTISQRKAIWVYEHLGTYPKRESVRTFLEQYIQSKSEY
>NZ_CP024647.1|WP_079891363.1|694961_695090_-|hypothetical-protein
MSLPTFQYNPNPVALNVISKEVATCPVCKQESEYVYEGHFLF
>NZ_CP024647.1|WP_022552715.1|693262_694336_+|HigA-family-addiction-module-antidote-protein
MGNEFIVHTGSVIKEYLEEIGMSPNDCAKRLGVRENDLSNLLSGKSRLTEEMALNLEKIFKGIPASYWLNYDRKYQEYQDNEVIHSKTYKAEDLNKLSKRFRFNTVFNGLDWSLTKQASEMLKLLKIDNFEQFDTVYSKLNVDFMEDGGETEAIAIWLNLAREEVEIQNKDLSDKEFSKEKLIESLGKFKSLSLNNDYESSLKSARKLLNRLGVYLVFINAIENSKVRGALTTYKEKPAIFLSGRFKTHDHVWFALIHEIGHLIKHYIPNEPIVTLENELEDLKPNTDKKEEEANEFARDFFIDKSEYKKFVESRRFDEQSIYEFANAQSILPGIVLARLQHDGYVSFDKLNHLKQR
>NZ_CP024647.1|WP_038461258.1|692932_693247_+|plasmid-maintenance-system-killer-protein
MKISFATRKLEKILTNERLIKKEYTLFYKKVINRISEIRVANNLDEIPHVPPPRRHKLDGDYNDCWGIDISKNFRIVLRPIGDWDESELKSINEIEILSIGDYH
>NZ_CP024647.1|WP_022552724.1|702261_703131_+|aminoglycoside-6-adenylyltransferase
MRSEDEMMKLILDIAMKDERIRLVTLEGSRTNKNVPRDKFQDYDISYFVTDMDSFTSDESWLDQFGERLMMQKPEDMELFPPELGDWFSYLMLFKDHHKIDLTLIPLSQTEDYFTQSDGLAEIVLDKDDRINSKIIASDEQYHIKKPTPREFDDCCNEFWMVSTYVIKGLMRKEILFALDHMNDILRPNVLRMIAWNIGIEHQFSLSVGKNYKYIQHYMNAKDWEILLNTYVGNTYESVWKALFDCQGLFRAYSKSVAVLLRYEYPEYDQQITEYTLKHYQRFQSDFSL
>NZ_CP024647.1|WP_003155704.1|703264_703513_+|spore-coat-associated-protein-CotJA
MKENQPFTPVKSYKPFHSRFDPCPPIGRKYYRTPPHLYMRFQPYHLEQFSPMEALRKGTLWKDLYDFYDNPYRGGIEYGEKD
>NZ_CP024647.1|WP_007408934.1|703496_703760_+|spore-coat-protein-CotJB
MAKKIDDEYYRLLEQIQAADFVLVELTLYLDTHPHDRLALQQFHEYSRYSRQLRKRFEPEYGPLLQFGVSQVGAQWDWGRGPWPWQV
>NZ_CP024647.1|WP_003155700.1|703774_704344_+|spore-coat-protein-CotJC
MWVYEKKLQYPVKVSTCNPMLAKFLIEQYGGADGELAAALRYLNQRYTIPDKVIGLLTDIGTEEFAHLEMIATMIYKLTKDATPEQLRDAGLSDHYVNHDSALFYHNAAGVPFTASYIQAKGDPIADLYEDIAAEEKARATYQWIIDISDDPDLNDSLRFLREREIVHSMRFREAVEILKEERDKKKIF
>NZ_CP024647.1|WP_022552725.1|704432_704966_+|GNAT-family-N-acetyltransferase
MTPFTITEEKAGAFRVTPARKDDEEEVMDLLVQAAEWLRDKGSNQWSGLLQGEDTHNMREAIAKGYVFLFRQNEELAGVVMLLPEASGWDRRLWGDEGHEESVYLHRLAINRRFAGERLGRTIMTWAETGVSCPGKTKIRLDCVSENKALQSFYSGMGYESKGLAPGYHLFEKKMSK
>NZ_CP024647.1|WP_022552726.1|704996_705275_+|hypothetical-protein
MGFFYLICLAAFCLNFAVSAVLRKKWPKKMWPECLLAVLGLTALSTVVYSIFGVGGWEGMGLGLAAMFAGSGAAAGYAAEVCLRVVRSNQKQ
>NZ_CP024647.1|WP_017419063.1|705388_706078_+|DUF421-domain-containing-protein
MGHLLTVAWELVCGLGILFVILKLLGKTQFSQITPFDFISALILGELVGNAVYDKNVRIIEIIFASLLWGVLIYLIELITQKVKSTRKLLEGEPSIIIHKGKLKYDVLKKNKLDINQLQSLLRQANCFSIQEAEYAILETNGMVSVLPKFQYDTTKNGDMQIKPKQVSLPVTLIIDGEVLYENLKEAGLEEKQLNQELKKLNIKKTEDVLYAEWKPDKPLFVLPYEEKK
>NZ_CP024647.1|WP_003155696.1|706110_706437_-|heme-degrading-oxygenase-HmoA
MFVQIRKMTVKEGHADKVIERFSSEGVIEKQEGLIDVTVLEKKVRRGDEEVVVLIRWESEDHWKQWEKSEDHIAAHKANQGKPKPDYMLGTDVGMYHVRAVKTGVHEK
>NZ_CP024647.1|WP_007408938.1|706521_706884_-|hypothetical-protein
MIKKIATVAVYTDDQQKAKTFWTEKAGFETVAEHPMGPGAFWLEVAPKGAATHLVIYPKSMMKGAEHMKASIVFECEDVFAAYEQMKKNGITFLDEPKQMEWGSFVQFKDEDGHVFLLKS
>NZ_CP024647.1|WP_014417142.1|707044_707911_+|STAS-domain-containing-protein
MNKDQLLHDYIITHSAELTEKWLKLRRKLRGRFYSADQLSEEMKRLLIEQHTFTNTVIASAFLEDPAVFQHNKEKWAAQVAKSRVEQDAEVHEVVEAIGNSRTVFWEAVTRFMDEHQDIVTNEDARRWNHLVNSSFDQLMTDFTEQFQTLMIARLSSQQELISELSCPVILIADTIGTLPLIGSIDTRRARVILETVPENCVAKRITNLVIDLSGVPIVDTMVAQQLYMLSKTLFLLGIRTVFSGIRPDVAQTSIQLGLDFSEYQTYGSLEQALASMGVTCVIEEAKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

653709 : 663600

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022552701.1\|653709_655002_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	27.3
WP_014417101.1\|655077_655797_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.7e-47	44.3
WP_014417102.1\|655796_656051_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	4.7e-05	33.3
WP_014417103.1\|656047_656731_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_022552702.1\|656714_658943_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-156	40.5
WP_014417105.1\|658918_660349_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.2e-54	32.7
WP_014417106.1\|660440_661481_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.8e-63	41.1
WP_007408902.1\|661477_662065_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	38.8
WP_014417107.1\|662061_663600_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.3e-77	50.5

DBSCAN-SWA_2

1218259 : 1250131

Bacillus_phage(33.33%)

terminase,portal,tail,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089072425.1\|1218259_1219396_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	2.2e-94	47.9
WP_022553496.1\|1219385_1219520_+	PhrA family phosphatase inhibitor	NA	NA	NA	NA
WP_022553495.1\|1219662_1220616_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	4.1e-62	69.3
WP_007610770.1\|1220653_1221031_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.5e-15	41.4
WP_022553494.1\|1221140_1221746_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	6.1e-43	48.3
WP_014417517.1\|1221884_1222475_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.0e-39	51.7
WP_003154871.1\|1222622_1222961_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	8.4e-18	45.8
WP_014417518.1\|1223151_1223331_+	hypothetical protein	NA	NA	NA	NA
WP_022553493.1\|1223320_1224148_+	phage-like element PBSX protein xkdB	S6BFM4	Thermus_phage	5.2e-21	51.0
WP_022553492.1\|1224047_1224848_+	ATP-binding protein	A6XMI1	Bacillus_virus	4.0e-58	45.3
WP_014417522.1\|1225112_1225454_+	hypothetical protein	NA	NA	NA	NA
WP_003154859.1\|1225443_1225647_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.4e-12	48.5
WP_012117362.1\|1225753_1226266_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	2.9e-22	44.6
WP_022553491.1\|1226378_1227176_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	2.3e-58	49.4
WP_022553490.1\|1227172_1228471_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	2.7e-149	58.9
WP_089072483.1\|1228519_1229911_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.4e-138	55.8
WP_003154849.1\|1229930_1230776_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.5e-55	58.1
WP_022553488.1\|1230802_1231738_+	phage-like element PBSX protein xkdG	A0A1B1P7E3	Bacillus_phage	1.9e-104	62.8
WP_021494026.1\|1231754_1232138_+	DUF3199 family protein	NA	NA	NA	NA
WP_022553487.1\|1232134_1232491_+	DUF3599 family protein	NA	NA	NA	NA
WP_022553486.1\|1232487_1232991_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_022553485.1\|1232987_1233434_+	hypothetical protein	NA	NA	NA	NA
WP_022553484.1\|1233430_1233640_+	hypothetical protein	NA	NA	NA	NA
WP_007610810.1\|1233639_1235037_+\|portal	phage portal protein	A0A0A7RTT5	Clostridium_phage	9.0e-82	40.4
WP_003154837.1\|1235038_1235482_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003154836.1\|1235555_1236002_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	35.8
WP_015239684.1\|1236043_1236196_+	hypothetical protein	NA	NA	NA	NA
WP_038461382.1\|1236183_1241310_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	3.4e-41	46.6
WP_022553482.1\|1241302_1241962_+	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	1.8e-08	45.3
WP_022553481.1\|1241975_1242953_+	hypothetical protein	A0A1L6BY20	Clostridium_phage	3.7e-34	30.6
WP_022553480.1\|1242952_1243219_+	DUF2577 family protein	S6C459	Thermus_phage	3.4e-06	37.5
WP_003154825.1\|1243322_1243748_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	1.5e-11	35.9
WP_022553478.1\|1243740_1244787_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.0e-69	44.1
WP_029973069.1\|1244770_1245349_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	2.4e-12	31.0
WP_003154822.1\|1245345_1245618_+	hypothetical protein	NA	NA	NA	NA
WP_022553476.1\|1245620_1247243_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	8.1e-42	39.7
WP_022553475.1\|1247255_1247627_+	hypothetical protein	NA	NA	NA	NA
WP_007610833.1\|1247631_1247829_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	7.3e-14	61.8
WP_022553474.1\|1247885_1248647_+	hypothetical protein	NA	NA	NA	NA
WP_022553473.1\|1248698_1248962_+	hypothetical protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.5e-22	61.9
WP_003154813.1\|1248975_1249239_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-23	65.5
WP_007407257.1\|1249252_1250131_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.7e-81	60.5

DBSCAN-SWA_3

1808305 : 1814519

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014417834.1\|1808305_1808698_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	5.0e-30	59.1
WP_007611605.1\|1808657_1810760_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	85.7
WP_012117608.1\|1810777_1811767_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	83.0
WP_014417835.1\|1811815_1812436_+	hypothetical protein	A0A127AYS1	Bacillus_phage	5.4e-47	48.4
WP_022553310.1\|1812485_1813244_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.4e-52	50.0
WP_021493645.1\|1813277_1813502_-	hypothetical protein	NA	NA	NA	NA
WP_015417523.1\|1813550_1814519_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	8.0e-53	40.9

DBSCAN-SWA_4

2108815 : 2115985

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022553207.1\|2108815_2108992_-	hypothetical protein	O64196	Bacillus_phage	6.5e-22	93.1
WP_038461826.1\|2109353_2109707_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_021493939.1\|2110497_2110872_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	8.1e-30	52.8
WP_021493940.1\|2111118_2111571_-	hypothetical protein	O64117	Bacillus_phage	6.3e-61	76.7
WP_022553203.1\|2111938_2113054_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	3.1e-93	48.1
WP_029974280.1\|2113050_2113173_+	PhrK family phosphatase-inhibitory pheromone	NA	NA	NA	NA
WP_022553201.1\|2113716_2114733_+	hypothetical protein	NA	NA	NA	NA
WP_021493945.1\|2114793_2115153_-	hypothetical protein	O64028	Bacillus_phage	7.5e-33	61.4
WP_022553199.1\|2115760_2115985_-	helix-turn-helix transcriptional regulator	A0A1P8CWU2	Bacillus_phage	3.4e-23	80.3

DBSCAN-SWA_5

2272401 : 2278654

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007409428.1\|2272401_2272995_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	36.6
WP_007409427.1\|2272984_2273740_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.9e-10	25.7
WP_003153376.1\|2273947_2274037_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_021494254.1\|2274124_2274646_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003153373.1\|2274711_2275086_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003153372.1\|2275202_2275667_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-43	59.3
WP_014418281.1\|2275699_2276896_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.7
WP_021494255.1\|2276910_2277558_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.6e-39	44.3
WP_022553020.1\|2277538_2278654_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.3e-54	36.3

DBSCAN-SWA_6

3699438 : 3707216