CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024749	Fusobacterium nucleatum subsp. vincentii strain KCOM 2931 chromosome, complete genome	1 crisprs	DinG,WYL,DEDDh,PD-DExK,cas3,RT,csa3	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024749_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024749_1

747117-747196

Orphan

Consensus_repeat	Method
TTATCTTCTCCCATTGATAATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024749_1

>merge|NZ_CP024749|1|747117-747196|CRISPRCasFinder
TTATCTTCTCCCATTGATAATTATTTTAATAAAAAAAATAAAAATAAAAGTGTTTAATTATCTTCTCCCATTGATAATTA

>NZ_CP024749|1|1|747117-747196|CRISPRCasFinder
TTATCTTCTCCCATTGATAATTA	TTTTAATAAAAAAAATAAAAATAAAAGTGTTTAA
TTATCTTCTCCCATTGATAATTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024749.1\|WP_008797063.1\|746455_747094_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|225439
NZ_CP024749.1\|WP_100027898.1\|757353_760422_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP024749.1\|WP_008799610.1\|744834_745656_-\|sirohydrochlorin-cobaltochelatase	unknown	unknown	gnl\|CDD\|227159
NZ_CP024749.1\|WP_008797062.1\|748166_748787_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP024749.1\|WP_005912954.1\|738152_738623_-\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP024749.1\|WP_005914098.1\|751662_752013_-\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
NZ_CP024749.1\|WP_100027897.1\|756244_757354_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP024749.1\|WP_005914185.1\|736842_738132_-\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP024749.1\|WP_147383202.1\|754691_755963_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP024749.1\|WP_100027893.1\|743015_744575_+\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP024749.1\|WP_005914099.1\|750949_751573_-\|DUF374-domain-containing-protein	unknown	unknown	gnl\|CDD\|225032
NZ_CP024749.1\|WP_100027895.1\|748815_750726_-\|methionine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237028
NZ_CP024749.1\|WP_100027891.1\|740786_742091_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP024749.1\|WP_032841941.1\|742093_742768_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP024749.1\|WP_005913195.1\|754034_754670_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP024749.1\|WP_005912952.1\|738722_739766_-\|TRAP-transporter-substrate-binding-protein-DctP	unknown	unknown	gnl\|CDD\|270387
NZ_CP024749.1\|WP_100027890.1\|740058_740652_+\|uracil-DNA-glycosylase-family-protein	unknown	unknown	gnl\|CDD\|381683
NZ_CP024749.1\|WP_008799614.1\|752081_753818_-\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|273226
NZ_CP024749.1\|WP_100027894.1\|747269_748154_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP024749.1\|WP_005912939.1\|745822_746287_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP024749.1\|WP_008797063.1\|746455_747094_+\|OmpA-family-protein	gnl\|CDD\|225439	COG2885, OmpA, Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane].	1.60714e-57
NZ_CP024749.1\|WP_100027898.1\|757353_760422_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP024749.1\|WP_008799610.1\|744834_745656_-\|sirohydrochlorin-cobaltochelatase	gnl\|CDD\|227159	COG4822, CbiK, Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism].	2.04632e-131
NZ_CP024749.1\|WP_008797062.1\|748166_748787_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.81429e-08
NZ_CP024749.1\|WP_005912954.1\|738152_738623_-\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	6.65003e-31
NZ_CP024749.1\|WP_005914098.1\|751662_752013_-\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	4.65113e-31
NZ_CP024749.1\|WP_100027897.1\|756244_757354_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	3.28833e-54
NZ_CP024749.1\|WP_005914185.1\|736842_738132_-\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	7.45059e-138
NZ_CP024749.1\|WP_147383202.1\|754691_755963_+\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	9.49392e-66
NZ_CP024749.1\|WP_100027893.1\|743015_744575_+\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	1.69657e-73
NZ_CP024749.1\|WP_005914099.1\|750949_751573_-\|DUF374-domain-containing-protein	gnl\|CDD\|225032	COG2121, COG2121, Uncharacterized protein conserved in bacteria [Function unknown].	9.182e-85
NZ_CP024749.1\|WP_100027895.1\|748815_750726_-\|methionine--tRNA-ligase	gnl\|CDD\|237028	PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed.	0
NZ_CP024749.1\|WP_100027891.1\|740786_742091_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	5.42224e-45
NZ_CP024749.1\|WP_032841941.1\|742093_742768_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	7.08829e-78
NZ_CP024749.1\|WP_005912952.1\|738722_739766_-\|TRAP-transporter-substrate-binding-protein-DctP	gnl\|CDD\|270387	cd13669, PBP2_TRAP_TM0322_like, Periplasmic component of TRAP-type C4-dicarboxylate transport system TM0322 from Thermotoga maritima and similar proteins; the type 2 periplasmic binding protein fold. This subgroup includes the hyperthermophilic bacterium Thermotoga maritima TRAP-type C4-dicarboxylate transport system TM0322 and its closely related proteins. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.52471e-140
NZ_CP024749.1\|WP_100027890.1\|740058_740652_+\|uracil-DNA-glycosylase-family-protein	gnl\|CDD\|381683	cd10033, UDG_like, uncharacterized family of the uracil-DNA glycosylase superfamily. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil may arise from mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations; thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other. UDG family 1 is the most efficient uracil-DNA glycosylase (UDG, also known as UNG) and shows a specificity for uracil in DNA. UDG family 2 includes thymine DNA glycosylase which removes uracil and thymine from G:U and G:T mismatches, and mismatch-specific uracil DNA glycosylase (MUG) which in Escherichia coli is highly specific to G:U mismatches but also repairs G:T mismatches at high enzyme concentration. UDG family 3 includes Human SMUG1 which can remove uracil and its oxidized pyrimidine derivatives from, single-stranded DNA and double-stranded DNA with a preference for single-stranded DNA. Pedobacter heparinus SMUG2, which is UDG family 3 SMUG1-like, displays catalytic activities towards DNA containing uracil or hypoxanthine/xanthine. UDG family 4 includes Thermotoga maritima TTUDGA, a robust UDG which like family 1, acts on double-stranded and single-stranded uracil-containing DNA. UDG family 5 (UDGb) includes Thermus thermophilus HB8 TTUDGB which acts on double-stranded uracil-containing DNA; it is a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA except for the C/I base pair, as well as a xanthine DNA glycosylase which acts on both double-stranded and single-stranded xanthine-containing DNA. UDG family 6 hypoxanthine-DNA glycosylase lacks any detectable UDG activity; it excises hypoxanthine. Other UDG families include one represented by Bradyrhizobium diazoefficiens Blr0248 which prefers single-stranded DNA and removes uracil, 5-hydroxymethyl-uracil or xanthine from it.	3.95786e-96
NZ_CP024749.1\|WP_008799614.1\|752081_753818_-\|signal-peptide-peptidase-SppA	gnl\|CDD\|273226	TIGR00705, Protease_4, signal peptide peptidase SppA, 67K type. This model represents the signal peptide peptidase A (SppA, protease IV) as found in E. coli, Treponema pallidum, Mycobacterium leprae, and several other species, in which it has a molecular mass around 67 kDa and a duplication such that the N-terminal half shares extensive homology with the C-terminal half. This enzyme was shown in E. coli to form homotetramers. E. coli SohB, which is most closely homologous to the C-terminal duplication of SppA, is predicted to perform a similar function of small peptide degradation, but in the periplasm. Many prokaryotes have a single SppA/SohB homolog that may perform the function of either or both. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	5.06084e-88
NZ_CP024749.1\|WP_100027894.1\|747269_748154_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	1.05969e-163
NZ_CP024749.1\|WP_005913195.1\|754034_754670_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.21106e-08

>NZ_CP024749.1|WP_008797063.1|746455_747094_+|OmpA-family-protein
MKNKKIIASCMLALSLVGCTGFEAGNGGYTAGGAAGGAAVGALAGQIIGKDTKGTLIGAAVGSLLGMGWGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANISSGFYSALNGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVASNRIVANGFGSSNPVASNSTQEGRLQNRRVEIKILPAQ
>NZ_CP024749.1|WP_005912939.1|745822_746287_+|hypothetical-protein
MKKEWAFLKLLTTKGYRKVVLIPLAFCLGIFLYYLYIDFTGGEVDKTVYDDGSIRISAQSDLGSCKLPKILDVLNIPIHDELKIRNYNVYLDKDENINSVEIYCSTDKDGNEIIEWYKEKLNSTNDAKGIWNNFEMDVSFNKFSNLVSIVLKKQ
>NZ_CP024749.1|WP_008799610.1|744834_745656_-|sirohydrochlorin-cobaltochelatase
MSKKALFMVHFGTTHNDTKELTIDKMNKKFADEFKDYNLFTAYTSRIVLKKLKDRGEALSTPIRVLNSLADQGYEELLVQTSHIIPGIEYENLVREVNSFSNKFKSIKIGKPLLYYIDDYKKCVEALADEYVPKNKKEALVLVCHGTDSPLATSYAMIEYVFDEYGYDNAFVVCTKAYPLMGTLLKKLKKHDIEEVRLAPFMFVAGEHAKNDMAITYKKELEENGFKVNQVILKGLGEFDAIQNIFLNHLKTAIEKDDEDIADFKKEYSEKYL
>NZ_CP024749.1|WP_100027893.1|743015_744575_+|glycosyltransferase-family-39-protein
MFSTKRKDIFVLTILSFFALLSLVWIREIDSSEARNLISAREILQNSNWWTPTLNGHFYFENPPLPVWITAFVMMITHSHSEVVLRLPNMLCCIFTVLFLYRSMIRIKKDRLFAFLCSFVLLSTFMFIKLGAENTWDIYTYSFAFCASLAFYVYIKYGEKKNLYRMGILLVLSFLSKGPVGFYSLFIPFLLAHYIIFPKEIFRKKTFSVIFSIIIAIAIASIWGISMYLNHGNYFLDVIKNEVIAWRTKHHHSFIFYTDFVVYMGSWLFFSIYVLFKIPKEKESKIFYLWTILVLIFITLIKMKKKKYGFPLYLTSSITIGQLCIYYFRKPYLELKKREKTLLIVQQVFLIVVVIGSLGFLAYFGFYKKGISFGLFFLYAILHLLFLFLFAVGYTEISYAKRVIIFTGLTMLLVNFSSSWILVSKYMQNNLLRFRIPISQEVLENPAPIYSQGFDIEDVWKLGKEIKSLNKNIPDERVIFFLGKEEPKELLKAYEIKKVYNYQKVTHDMERIYLLEKIY
>NZ_CP024749.1|WP_032841941.1|742093_742768_-|response-regulator-transcription-factor
MNKILIIEDDKNIQRLLALELRHKNYFVDSAYDGEQGIEIFSKNSYDVVLLDLMLPKKSGKEVCQELRKLADTPIIVITAKDSVLDKVELLDLGANDYICKPFAMEELLARIRVSTRNKENSNNKHFYLENEIKMDILAKKVFLNEEEIALTKTEFLILEYFMKNKGLSCSREKIIIGVWGYDFDGEEKIVDVYINSLRKKIDSKSKYIHTIRGFGYIFQYKED
>NZ_CP024749.1|WP_100027891.1|740786_742091_-|HAMP-domain-containing-histidine-kinase
MKKISKELLKTYYWVIALFAIFSIFIIVNFSVYLWKENQNDIKVIEEFVEYQMSELENREDLDYLSKEWILKKILDKSPKIRDVYLEIFYNGKKYTKPPYLPDKEHNFLDYYSVTKFYQIKGFDEIEVKITRRNVRDRLLILNAFTSFIFFLLFCLYVIIRIQKRFFDKFKKSLDNLKIFTQDYNLDSEIRIHSEENFIEFSILQKSFKNMLIRLKEQSQLQIDFVNNASHELKTPIFVIKGYVDMLNDWGKDDKEVLDEGLIVLKKEIQNMQELTEKLLFLAKSKNLIAEKNNINLDNVLKEVIDNLSFAYPKQKINYISSEIFIDSDIALLKLLFKNLIENAMKYGKDNPINIELKKEKKVKLIIEDFGVGISEKALPHIFERFYREDEARNREIKSYGLGLSIVKEIISLLDIDIQVESQLGKGTKITLLF
>NZ_CP024749.1|WP_100027890.1|740058_740652_+|uracil-DNA-glycosylase-family-protein
MNRDEKLKKIIEEIKNDEENKKHTEQGIDPLFSAPEKARIVIVGQAPGLKAQENRLYWKDKSGDKLRIWTGIDEKTFYSSNLLAIIPMDFYYPGKGKSGDLPPRKDFGDKWHNKILELLPNVELFILIGKYAQGFYLKGKLKDNLTDTVKAYKEYLPKFFPIVHPSPLNIGWLKKNPWFEDEVVPTLKEMVTKIMKR
>NZ_CP024749.1|WP_005912952.1|738722_739766_-|TRAP-transporter-substrate-binding-protein-DctP
MKKILSLIFLSLLTLALVACGGKKEEATKGEGEAKKEARVIKVTTKFVDDEQTAKSLVKVVEAINQRSNGSLELQLFTSGTLPIGKDGMEQVANGSDWILVDGVNFLGDYVPDYNAVTGPMLYQSFEEYLRMVKTPLVQDLNAQALEKGIKVLSLDWLFGFRNIEAKKAIKTPEDMKGLKLRVPTSQLYTFTIEAMGGNPVAMPYPDTYAALQQGVIDGLEGSILSFYGTKQYENVKEYSLTRHLLGVSAVCISKKCWDSLTDEERTIIQEEFDKGALDNLTETEKLEDEYAQKLKDNGVTFHEVDAEAFNKAVAPVYEKFPKWTPGIYDKIMENLTQIREDIKNGK
>NZ_CP024749.1|WP_005912954.1|738152_738623_-|TRAP-transporter-small-permease
MKDFFKKFELYIGSIFISITTVVVIMNVFTRYFLKFTYFWSEEVAVGCFVWTIFLGTAAAYREKGLIGVEAIVVLLPEKIRNIVEFLTYILLTILSGLMCVFSFTYVSSSSKITAALELSYGYINISIVISFALMTLYSIIFTVGSFKKAFLKKDN
>NZ_CP024749.1|WP_005914185.1|736842_738132_-|TRAP-transporter-large-permease
MEALYPVIVLFVLFFLNIPIAFALMGSALFYFIFLNTTMSMDMVIQQFVTSVESFPYLAVPFFIMVGSVMNYSGISEELMNMAEVLAGHMKGGLAQVNCLLSAMMGGISGSANADAAMESKILVPEMIKKGFSKEFSAAVTAASSAVSPVIPPGTNLILYALIANVPVGDMFLAGYTPGILMTAAMMVTVYIISKKRGYEPSRERMARPVEILKQAIKSIWALAIPFGIIMGMRIGIFTPTEAGGVAVFFCFLVGFFIYKKLKLHHIPIILMETVKNTGAVMIIIASAKVFGYYMTLERIPQFITNSLMNFTDNKLVLLMVINVLLLFIGMFIEGGAALVILAPLLVPAVRELGVDPLHFGVIFIVNIMIGGLTPPFGSMMFTVCSIVGVRLEAFIKEVWPFIVALLIVLLLVTYSESIALFIPNLFLK
>NZ_CP024749.1|WP_100027894.1|747269_748154_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVASGITDILIITGRNKNSIEDHFDFSYELENTLKNDHKSELLDKVSHISNMANIYYVRQNMPLGLGHAILKAKSFIGDEPFVIALGDDIIYNPEKPVAKQMIEKYELYGKSMIGCQEVAKEDVSKYGIAKLGDKLDEATFQMLDFLEKPSVDNAPSRTACLGRYLLSGKVFKYLEETKPGKNGEIQLTDGILAMMKDEEEVLAYNFIGKRYDIGSKFGLLKANIEFGLRNDETKEDIKEYLKNLDIEKV
>NZ_CP024749.1|WP_008797062.1|748166_748787_-|hypothetical-protein
MGKIISKKDEDFFENVEYFSEIIDRINDIQANNNYSDEEMNNDLDVALWRAFVYINLWSYKGYAKAEKILKRVEKKGRENPIWCYRYGVSIARLRKYEEALKYFILGTEVDPMYPWNWLELGRLYYKFGKLDNVYKCIEKGLELVPNDYEFLTLKDDVKNDRGYFYSINHYINEEVDKTEDRELDYSDDKEWEKFIKETHYGEKCL
>NZ_CP024749.1|WP_100027895.1|748815_750726_-|methionine--tRNA-ligase
MKKNFFVSTPIYYVNGNPHVGSAYTTIAADVINRYNKAMGMDTHFMTGLDEHGQKVEQAAEQNGYTPQAWTDKMTPNFKNMWAALDIKYDDFIRTTEDRHKKAVKRILDMVNAKGDIYKGEYEGKYCISCETFFPENQLNGSNKCPDCGKELRVLKEESYFFKMSKYADALLKHIEEHPDFILPHSRRNEVISFIKQGLQDLSISRNTFTWGIPIDFAPGHITYVWFDALTNYLTSAGFENDDKKFDKFWNNARVVHLIGKDIIRFHAIIWPCMLLSAGIKLPDSIVAHGWWTSEGEKMSKSRGNVVNPYDEIKKYGVDAFRYYLLREANFGTDGDYSTKGIVGRLNSDLANDLGNLLNRTLGMYKKYFNGVIVASSTSEPIDDEIKTMFDDIIKDVEKYMYLFEFSRALETIWKFISRLNKYIDETMPWSLAKDEAKKGRLATVMNILCEGLYKIAFLIAPYMPESAQKISNQLGIDKDITNVKFDDIKEWNIFKEGHKLGEASPIFPRIEIEKKEVVESKKELKVENPIDIKEFNKVEIKVVEILDVDKVKDTDKLLKFKVFDGKFERQIISGLAKFYPDFKKLIGEKVLAVANLKFTKLKGEISQGMLLTTEDKNGVSLIKIDKSIEAGAIIS
>NZ_CP024749.1|WP_005914099.1|750949_751573_-|DUF374-domain-containing-protein
MEENKKYRILGTLLYYLLRIISSTLRIEIINKYGIDMQKPHIYGFWHSKLFITPIFFKDVEKKLAMSSPTKDGELVSVPLEKMGYILVRGSSDKNQISSTISLLKYLKKGYSIGTPLDGPKGPKEKAKKGLLYLSQKTSVPLVPVGILYSKKWILKKTWDQFEIPKPFSKVKIFLGEPIIIKDEDDLDKYTEIVENGINSLNNQIEF
>NZ_CP024749.1|WP_005914098.1|751662_752013_-|YbaB/EbfC-family-nucleoid-associated-protein
MVRKLKGTKTAGGNQADIVKQAQVMQQQMLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELIEVKLSDEVLKDAANDKEMLEDLILTAVKDAMAKAEELAEGEMAKVTGGINIPGLF
>NZ_CP024749.1|WP_008799614.1|752081_753818_-|signal-peptide-peptidase-SppA
MKILHYLKRFILFVIKEILSFFIKLFLFLFVAGIIISAIIKSFEEKPTVAIKNKAYVLINLADSYNERLLKSNLFEDDSINFYTLLQSIENVSYDDRVEGIILKINGDSLSYAQSEELAHELSMARAANKKIIAYFENVGRKNYYLASYANEIYMPSANSTNVNIYPYFREEFYIKQLADKFGVKFNIIHVGDYKSYMENLASSTMSKEAREDTVRVLDKNYNNFLDVVSLNRKINRDDLDKIIKDGELVAASSVDLMNNNLIDKYAYWDNVISMVGGKDKIITVQEYTKNYYKEGSMTDSNNIIYVIPLEGDIVESETEVFSGEENINVSETLEKLNIAKENDKIKAVVLRVNSPGGSALTSDIIAEKVKELAEEKPVYVSMSSVAASGGYYISANANKIFVDRNTITGSIGVVSILPDFSKLITDNGVNIEKISDGEYSDLYSVDSFTEKKYNKIYNSNLKVYEDFLNVVSKGRKIDKEKLKTIAEGRIWTGDEAIKIGLADEIGGLNETIYALAEDNDMDEYAIVVAKDKLEIGNIYKKYSRYIKMNTKDLIKEKIFKDYLYNKPVTYLPYDVLD
>NZ_CP024749.1|WP_005913195.1|754034_754670_+|TetR/AcrR-family-transcriptional-regulator
MNSDIDKKNLILEKAKDMIITESYSSLSISKLTSELSISKGSFYTYFPSKDKMLGEILDEYIKNIIIFKNNLLENSKNIDDCLDYYINSILSLSDEELKLELVITNLKRNYEVFNEENFKKLKIIACTMIDFIKEVLNKYKKDINIDEKDIEKCSKMIFSIAEVFLVMENVDFNSDRFSFKTLDEVKKMYRSDDMKEHLEFIKKSIKKIIY
>NZ_CP024749.1|WP_147383202.1|754691_755963_+|TolC-family-protein
MKKILTVFLLMTNIILARDLTLEQAIDLSLSNSKEMKISEKNLDISKLNVNKAIKNALPSVTYAGTYTVGEHERQILTQSERDRVNKKRGYTQNLKLTQPLFTGGVVTAGIKGAKAYENIASYSYLQSKIKNRLDTIKIFSDIINAQRNLEALKYSEGILLKRYQKQEEQLKLRLITKTDVLQTEYSIEDIRAQMINIKNVIDTNMEKLYIRTGINKSEPLNLIPFDIPNNFSEKINLNSDLKQAINESLSAKLAEEQVKVASATRMAAVGDLLPKVNAFASYGTGERTTFERSYKDGEWTGGIEVSWKVFSFGSDLDNYRVAKLQEEQEELKETSTKENIEINVRSAYLNVLSLEKQIASQSKALEAAKVNFELNQEKYDAGLISTVDYLDFENTYRRARMAYNKVLLDYYYAFETYRSLLI
>NZ_CP024749.1|WP_100027897.1|756244_757354_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MKKILTVFLAASLLLVACGKDKEEKKETTKQEATVTDEQKSVKSVEVAEVKTREMSKLFDSSAVWEPLAKVDFSTDKGGTVKKIFKKNGEFVKKGEVIVKLSDAQTEADFLQAKANYQSATSNYNIARNNYQKFKTLYDKQLISYLEFSNYEATFTSAQGNLEVAKAAYMNAQDSYGKLIARAEISGVVGNLFIKEGNDIAAKETLFTILNDSQMQSYVGIAPEAISKVKIGDSIKVRIDALGKDYTAKIAELNPIADNTTKNFKVKLTLDNPDKEIKDGMFGNVVIPVGQSSVLSIEDEAIVTRDLVNYVFKYENGKVKQVEVKVGATNLPYTEISSPEIKEGDKIVVKGLFGLQDNDNVKIKNEVNK
>NZ_CP024749.1|WP_100027898.1|757353_760422_+|efflux-RND-transporter-permease-subunit
MSLAGISIRRPVATTMVMVSFIFIGLLAMFSMKKELIPDINIPVVTISTTWNGAVAEDVETQVTKKIKDSLSNVEAIDKIQTVSSYGSSSVVVNFDFGVNTNDKVTQIQREVSKIANDLPKDANTPIVRKVDAATGSMTAIIAFNSDNKTALNTFIKEKLKPRLESLAGIGEVTIAGNPEKQLQIQVDSDKLSAYNLSPMELYNIIRTAVTTYPIGKLSTGNKDMIIRFMGELDYIDQYENILINSDGNTLRLKDVANVVLTTEDPDRLGYLKGKDSIVVLLSKSSDGDTIGLNSAAFKVIEEMKPYMPAGTEYSIELDNSENINSSISNVTSSAIQGLVLATIILFAFLKSFRTTILISLALPVAIIFTFAFLSMRGTTLNLISLMGLSIGVGMLTDNSVVVVDNIYRHITELNSPVLEAAENGTEEVTFSVIASALTTMVVFIPILFIPGLAREFFRDMSYAIIFSNLAAIIVAITMIPMLASRFLNRKSMKTEDGRLFKKVKARYLKIIHWAYTHKGKTVFIMVFLFFLSIFVGPKLLKFEFMPKQDEGKYSLMAELQNGTDIEKAKRIARELENIVKNESHTKSYLMLVSTSNISINADVGKKGTRKESVFDIMNDVRNQAKNVLDARISLSNQFSGGRSTKDVEFLIQGMNQDEIKQFGKQILKKLQNYDGIVDLSSTLDPGIIELRINIDRDKITSYGINPTVVAQTLSYYMLGGDKANTATLKTDSEEIDVLIRLPKDKRNDVNILQSLNIKVGDNKFVKLSDVATIQYAEGTSKINKKNGIYTVTISANDGGVGLAAIQQKMIEEFNSLNPPSSISYSWGGQTENMQKTMSQLSFALSISIFLIYALLASQFESFIMPIIIIGSIPLALIGVIWGLVVTGQSIDIMVMIGVILLAGVVVNNAIVLIDFIKTMRIRGHDKEYSVMYSCETRLRPILMTTMTTVFGMMPMALGLGEGSEFYRGMAITVIFGLSFSTILTLVLIPVLYSVIDDFTTKLITKIKNISNKSKKKGVNNG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP045225	Clostridioides difficile strain TW11 plasmid p_TW11, complete sequence	36165-36198	5	0.853
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP047287	Proteus cibarius strain G11 plasmid p52, complete sequence	23106-23139	5	0.853
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP053373	Proteus cibarius strain G32 plasmid pG32-51, complete sequence	19417-19450	5	0.853
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP047341	Proteus cibarius strain ZF1 plasmid pZF1-cfr, complete sequence	13732-13765	5	0.853
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP045009	Proteus cibarius strain ZF2 plasmid pZF2-cfr, complete sequence	31062-31095	5	0.853
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP007647	Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence	48949-48982	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	200339-200372	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_007930	Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence	26012-26045	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP017108	Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence	152313-152346	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_003042	Clostridium perfringens str. 13 plasmid pCP13, complete sequence	16214-16247	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_LT604075	Lactobacillus salivarius isolate LPM01 plasmid II	184340-184373	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	CP002037	Lactobacillus salivarius CECT 5713 plasmid pHN3, complete sequence	26223-26256	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_022551	Blattabacterium sp. (Nauphoeta cinerea) plasmid unnamed, complete sequence	2601-2634	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_021183	Clostridium pasteurianum BC1 plasmid pCLOPA01, complete sequence	50763-50796	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	274219-274252	6	0.824
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	107329-107362	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	KP027447	Staphylococcus phage phiIPLA-C1C, complete genome	114625-114658	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_015919	Borreliella bissettii DN127 plasmid lp54, complete sequence	119-152	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MN694663	Marine virus AFVG_250M439, complete genome	105-138	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MN694663	Marine virus AFVG_250M439, complete genome	59606-59639	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP020426	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence	4568-4601	7	0.794
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP013615	Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence	227262-227295	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP013615	Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence	112639-112672	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MT080583	UNVERIFIED: Staphylococcus phage vB_SauM_EW13, complete genome	8346-8379	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MT080586	UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome	128831-128864	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MT080594	UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome	42994-43027	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MT080582	UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome	60897-60930	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP009595	Bacillus cereus strain 3a plasmid pBFC_3, complete sequence	4155-4188	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP009606	Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence	182868-182901	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	177611-177644	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP030782	Escherichia albertii strain 07-3866 plasmid unnamed, complete sequence	61042-61075	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP031075	Bacillus mycoides strain BPN401 plasmid pl37, complete sequence	26751-26784	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP053994	Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence	256639-256672	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	42401-42434	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	159973-160006	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	288294-288327	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	71463-71496	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	2218-2251	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP053992	Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence	239655-239688	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP045267	Bacillus megaterium strain FDU301 plasmid pFDU301E, complete sequence	26516-26549	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP043831	Bacillus sp. BS98 plasmid unnamed1	246931-246964	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_AP017915	Candidatus Azobacteroides pseudotrichonymphae plasmid pAPPJ1 DNA, complete sequence, phylotype ProJPt-1	13259-13292	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP024376	Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp26, complete sequence	29053-29086	8	0.765
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_011783	Borreliella burgdorferi ZS7 plasmid ZS7_lp25, complete sequence	17774-17807	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_001850	Borreliella burgdorferi B31 plasmid lp25, complete sequence	17738-17771	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	46137-46170	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP038900	Piscirickettsia salmonis strain Psal-006b plasmid unnamed2, complete sequence	43723-43756	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	KC595513	Bacillus phage Shanette, complete genome	106594-106627	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	KF554508	Bacillus phage CP-51, complete genome	73501-73534	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	165846-165879	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP019601	Brachyspira hyodysenteriae strain BH718 plasmid pBH718, complete sequence	28020-28053	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_012226	Brachyspira hyodysenteriae WA1 plasmid pBHWA1, complete sequence	9871-9904	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP026954	Staphylococcus aureus strain FDAARGOS_48 plasmid unnamed1	1783-1816	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP013040	Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence	32239-32272	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_007391	Spiroplasma citri pSci5 plasmid	25561-25594	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	10301-10334	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP033050	Virgibacillus halodenitrificans strain Bac324 plasmid unnamed, complete sequence	244382-244415	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_015712	Clostridium perfringens plasmid pCPPB-1, complete sequence	31612-31645	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	10283-10316	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP029650	Staphylococcus aureus strain AR_0471 plasmid unnamed1, complete sequence	12985-13018	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	14938-14971	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	28548-28581	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	29785-29818	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	3413-3446	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	34957-34990	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP023513	Enterococcus sp. FDAARGOS_375 plasmid unnamed2, complete sequence	7111-7144	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	33136-33169	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_016942	Staphylococcus argenteus MSHR1132 plasmid pST75 complete sequence	4233-4266	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP053311	Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence	2192-2225	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP042473	Spiroplasma citri strain CC-2 plasmid pScpCC2-1, complete sequence	23095-23128	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	AP018319	Nostoc sp. HK-01 plasmid plasmid1 DNA, complete genome	473246-473279	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	10223-10256	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_022589	Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence	42298-42331	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	10306-10339	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_017345	Staphylococcus aureus subsp. aureus TCH60 plasmid unnamed, complete sequence	6016-6049	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP013848	Clostridium botulinum strain Af650 plasmid pRSJ14_1, complete sequence	32692-32725	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	253459-253492	9	0.735
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	140443-140476	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_017235	Borreliella afzelii PKo plasmid lp28-7, complete sequence	5381-5414	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	MN693868	Marine virus AFVG_250M1130, complete genome	32194-32227	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP032824	Arcobacter cryaerophilus ATCC 43158 plasmid pACRY43158, complete sequence	61286-61319	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP024336	Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence	41829-41862	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP045275	Bacillus megaterium strain FDU301 plasmid pFDU301C, complete sequence	31473-31506	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP053838	Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence	130667-130700	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	19978-20011	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP039267	Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence	7819-7852	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	16900-16933	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_MK715471	Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence	9341-9374	10	0.706
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_022874	Bacillus thuringiensis YBT-1518 plasmid pBMB0229, complete sequence	35617-35650	11	0.676
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	192698-192731	11	0.676
NZ_CP024749_1	1.1\|747140\|34\|NZ_CP024749\|CRISPRCasFinder	747140-747173	34	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	473221-473254	11	0.676

1. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP045225 (Clostridioides difficile strain TW11 plasmid p_TW11, complete sequence) position: , mismatch: 5, identity: 0.853

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
attttataaaaaaaataaaattaaaa-tatttaat	Protospacer
 *** *************** ***** *.*****

2. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP047287 (Proteus cibarius strain G11 plasmid p52, complete sequence) position: , mismatch: 5, identity: 0.853

ttttaataaaaaaaataaaaataaaagtgtttaa--	CRISPR spacer
ttttaagaaaaaaaagaaaaat--aagtttttaaaa	Protospacer
****** ******** ******  **** *****

3. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP053373 (Proteus cibarius strain G32 plasmid pG32-51, complete sequence) position: , mismatch: 5, identity: 0.853

ttttaataaaaaaaataaaaataaaagtgtttaa--	CRISPR spacer
ttttaagaaaaaaaagaaaaat--aagtttttaaaa	Protospacer
****** ******** ******  **** *****

4. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP047341 (Proteus cibarius strain ZF1 plasmid pZF1-cfr, complete sequence) position: , mismatch: 5, identity: 0.853

ttttaataaaaaaaataaaaataaaagtgtttaa--	CRISPR spacer
ttttaagaaaaaaaagaaaaat--aagtttttaaaa	Protospacer
****** ******** ******  **** *****

5. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP045009 (Proteus cibarius strain ZF2 plasmid pZF2-cfr, complete sequence) position: , mismatch: 5, identity: 0.853

ttttaataaaaaaaataaaaataaaagtgtttaa--	CRISPR spacer
ttttaagaaaaaaaagaaaaat--aagtttttaaaa	Protospacer
****** ******** ******  **** *****

6. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP007647 (Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

7. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

8. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_007930 (Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

9. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP017108 (Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

10. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_003042 (Clostridium perfringens str. 13 plasmid pCP13, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaagaaaaaaaattaaaataaaaggcattac	Protospacer
****** ********* **********   ***

11. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_LT604075 (Lactobacillus salivarius isolate LPM01 plasmid II) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

12. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to CP002037 (Lactobacillus salivarius CECT 5713 plasmid pHN3, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaa-gtgtttaa	CRISPR spacer
ttttagtaaaaaaaacaaaaataaaaggtaggta-	Protospacer
*****.*********.********** **.  **

13. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_022551 (Blattabacterium sp. (Nauphoeta cinerea) plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataa---aagtgtttaa	CRISPR spacer
ttttcataaaaaaaataaaaataatataaatgat---	Protospacer
**** *******************   **.** *

14. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_021183 (Clostridium pasteurianum BC1 plasmid pCLOPA01, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaata-aaagtgtttaa	CRISPR spacer
aatttataaaaaaaataaaaatagaaagtaatta-	Protospacer
  ** ****************** *****. ***

15. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 6, identity: 0.824

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
cttttataaagaaaataaaaat-aaagtattcaag	Protospacer
.*** *****.*********** *****.**.**

16. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaaaaaaaaaaaaaaaaaataaaa	Protospacer
*************** ***** ****. .*  **

17. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to KP027447 (Staphylococcus phage phiIPLA-C1C, complete genome) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagtgtttaa---	CRISPR spacer
ttttaagaaaaaaaataaa---aaaaatttgtaaaac	Protospacer
****** ************   ****.* * ***

18. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_015919 (Borreliella bissettii DN127 plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagt--gtttaa	CRISPR spacer
ttataataaaaaaaataataataaatattgattt--	Protospacer
** *************** ****** .*  .***

19. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MN694663 (Marine virus AFVG_250M439, complete genome) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagtgtttaa-----	CRISPR spacer
tttaaataaaaaaaataaaagtaaa-----ttaaaagtg	Protospacer
*** ****************.****     ****

20. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MN694663 (Marine virus AFVG_250M439, complete genome) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagtgtttaa-----	CRISPR spacer
tttaaataaaaaaaataaaagtaaa-----ttaaaagtg	Protospacer
*** ****************.****     ****

21. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP020426 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttattaaaaaaaatataaataatattaattta	Protospacer
***** *********** ****** * *. ** *

22. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP013615 (Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaaaataagagtaaaagagagatg	Protospacer
******************.*.****** *    .

23. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP013615 (Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataagaaaaataaatataattattcttca	Protospacer
*********.********* ****  .* .** *

24. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MT080583 (UNVERIFIED: Staphylococcus phage vB_SauM_EW13, complete genome) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
atttaataaaaaaaataaaactaaattagagaaa	Protospacer
 ******************* ****   *   **

25. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MT080586 (UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
atttaataaaaaaaataaaactaaattagagaaa	Protospacer
 ******************* ****   *   **

26. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MT080594 (UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
atttaataaaaaaaataaaactaaattagagaaa	Protospacer
 ******************* ****   *   **

27. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MT080582 (UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
atttaataaaaaaaataaaactaaattagagaaa	Protospacer
 ******************* ****   *   **

28. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP009595 (Bacillus cereus strain 3a plasmid pBFC_3, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
atttaataaaaaaattaaaattaaaa-cattaagg	Protospacer
 ************* ***** ***** ..** *.

29. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP009606 (Bacillus cereus strain S2-8 plasmid pBFR_2, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
atttaataaaaaaattaaaattaaaa-cattaagg	Protospacer
 ************* ***** ***** ..** *.

30. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
atttaataaaaaaattaaaattaaaa-cattaagg	Protospacer
 ************* ***** ***** ..** *.

31. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP030782 (Escherichia albertii strain 07-3866 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tgtcaataaaaaaaataaaaatataaatggatgt	Protospacer
* *.******************* **.**  *.

32. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP031075 (Bacillus mycoides strain BPN401 plasmid pl37, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaa---gtgtttaa	CRISPR spacer
ctttagtaaaaaaaattaaaataaaaaatgaatt---	Protospacer
.****.********** *********   * .**

33. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP053994 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
atttaataaaaaaattaaaattaaaa-cattaagg	Protospacer
 ************* ***** ***** ..** *.

34. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaa---gtgtttaa	CRISPR spacer
ctttagtaaaaaaaattaaaataaaaaatgaatt---	Protospacer
.****.********** *********   * .**

35. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gcttcctaaaaaaaataaaaaaataagtgttgga	Protospacer
 .**  *************** * ******* .*

36. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaaattaaaaattaagggaggaaa	Protospacer
************** ******* **.* .   **

37. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa---	CRISPR spacer
atttaataaaaaaattaaaattaaaca---ttaaggg	Protospacer
 ************* ***** **** .   ****

38. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaa---gtgtttaa	CRISPR spacer
ctttagtaaaaaaaattaaaataaaaaatgaatt---	Protospacer
.****.********** *********   * .**

39. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP053992 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa-	CRISPR spacer
atttaataaaaaaattaaaattaaaa-cattaagg	Protospacer
 ************* ***** ***** ..** *.

40. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP045267 (Bacillus megaterium strain FDU301 plasmid pFDU301E, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gtttaataaaaaagatataaataaacattttgat	Protospacer
 ************.*** ******* .* ** *

41. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP043831 (Bacillus sp. BS98 plasmid unnamed1) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa---	CRISPR spacer
atttaataaaaaaattaaaattaaaca---ttaaggg	Protospacer
 ************* ***** **** .   ****

42. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_AP017915 (Candidatus Azobacteroides pseudotrichonymphae plasmid pAPPJ1 DNA, complete sequence, phylotype ProJPt-1) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa---	CRISPR spacer
tttcaatacaaaaaataaaaataa---ttcctaatta	Protospacer
***.**** ***************   * ..***

43. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP024376 (Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp26, complete sequence) position: , mismatch: 8, identity: 0.765

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tttttataaaaaaaacaaaaataatataataaaa	Protospacer
**** **********.******** *  .*  **

44. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_011783 (Borreliella burgdorferi ZS7 plasmid ZS7_lp25, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ctttattaataaaaataaaaataaaaataaaaat	Protospacer
.**** *** ****************.*.   *

45. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_001850 (Borreliella burgdorferi B31 plasmid lp25, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ctttattaataaaaataaaaataaaaataaaaat	Protospacer
.**** *** ****************.*.   *

46. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aatttataaaaaaaataaaaataaaaataaaaat	Protospacer
  ** *********************.*.   *

47. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP038900 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aatttataaaaaaaataaaaataaaaataaaaat	Protospacer
  ** *********************.*.   *

48. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to KC595513 (Bacillus phage Shanette, complete genome) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaagacaaaaataaaaagagtacc	Protospacer
*************.*.**********. . *

49. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to KF554508 (Bacillus phage CP-51, complete genome) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaagacaaaaataaaaagagtacc	Protospacer
*************.*.**********. . *

50. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aaataataaaaaaaataacaataaatgttgttcg	Protospacer
   *************** ****** **  ** .

51. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP019601 (Brachyspira hyodysenteriae strain BH718 plasmid pBH718, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aattaataaaaaaaataaaaattatagaaataga	Protospacer
  ******************** * ** . * .*

52. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_012226 (Brachyspira hyodysenteriae WA1 plasmid pBHWA1, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aattaataaaaaaaataaaaattatagaaataga	Protospacer
  ******************** * ** . * .*

53. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP026954 (Staphylococcus aureus strain FDAARGOS_48 plasmid unnamed1) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

54. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP013040 (Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gattaataaacaaaacaaaaataaaattataaat	Protospacer
  ******** ****.********** *.*  *

55. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_007391 (Spiroplasma citri pSci5 plasmid) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaacaaaaaaaatataaataatattttaagg	Protospacer
******.********** ****** * * *  ..

56. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

57. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP033050 (Virgibacillus halodenitrificans strain Bac324 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tagacaaaaataaaataaaaataaaactgttata	Protospacer
*    * *** *************** ****  *

58. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_015712 (Clostridium perfringens plasmid pCPPB-1, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gattaataaacaaaacaaaaataaaattataaat	Protospacer
  ******** ****.********** *.*  *

59. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

60. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP029650 (Staphylococcus aureus strain AR_0471 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

------ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aatgcctctt------aaaattcaaaataaaagtgtttaa	Protospacer
      *.**      **** * *****************

61. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

62. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

63. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

64. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

65. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaacaaaaaaaatataaataatattttaagg	Protospacer
******.********** ****** * * *  ..

66. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP023513 (Enterococcus sp. FDAARGOS_375 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tgctataaaaaaaaataaaaataaacttgttatt	Protospacer
* .**  ******************  ****

67. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaacaaaaaaaatataaataatattttaagg	Protospacer
******.********** ****** * * *  ..

68. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_016942 (Staphylococcus argenteus MSHR1132 plasmid pST75 complete sequence) position: , mismatch: 9, identity: 0.735

------ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aatgcctctt------aaaattcaaaataaaagtgtttaa	Protospacer
      *.**      **** * *****************

69. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP053311 (Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaacaaaaaaaatataaataatattttaagg	Protospacer
******.********** ****** * * *  ..

70. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP042473 (Spiroplasma citri strain CC-2 plasmid pScpCC2-1, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaacaaaaaaaatataaataatattttaagg	Protospacer
******.********** ****** * * *  ..

71. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to AP018319 (Nostoc sp. HK-01 plasmid plasmid1 DNA, complete genome) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa-----	CRISPR spacer
ttttgataaaaaaaatacaaataagaa-----aaaaatc	Protospacer
****.************ ******.*.     **

72. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

73. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_022589 (Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tgttaattaaaaaaagaaaaataaaaacattccg	Protospacer
* ***** ******* **********...**. .

74. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaatatagaaataataacggccat	Protospacer
************* ***.****** *..* ..*

75. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_017345 (Staphylococcus aureus subsp. aureus TCH60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

------ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aatgcctctt------aaaattcaaaataaaagtgtttaa	Protospacer
      *.**      **** * *****************

76. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP013848 (Clostridium botulinum strain Af650 plasmid pRSJ14_1, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaag--tgtttaa	CRISPR spacer
atttaataaaaaacatgaaaataaagaacagttc--	Protospacer
 ************ **.********..   ***.

77. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 9, identity: 0.735

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ggttaataaagaaaataaaattaaaattacaaaa	Protospacer
  ********.********* ***** *..  **

78. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
taacaataaaattaataaaaataaaagtatagtt	Protospacer
*  .*******  ***************.*

79. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_017235 (Borreliella afzelii PKo plasmid lp28-7, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
attaaataataaaaataaaaataaaaataaactt	Protospacer
 ** ***** ****************.*.  .

80. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to MN693868 (Marine virus AFVG_250M1130, complete genome) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaaagagaaaaataaagaacaaaca	Protospacer
*************.* *********..      *

81. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP032824 (Arcobacter cryaerophilus ATCC 43158 plasmid pACRY43158, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaagaaataaaaagaagaagagaaga	Protospacer
***********.********* **.*. .   .*

82. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP024336 (Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gattaaaaaaaaaaaaaaaaataaaaagatgcga	Protospacer
  **** ******** **********. .* ..*

83. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP045275 (Bacillus megaterium strain FDU301 plasmid pFDU301C, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaaagaataaaaacaacctcattctc	Protospacer
************.********.**   ..**.

84. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP053838 (Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaagaaataaaaagaagaagagaaga	Protospacer
***********.********* **.*. .   .*

85. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gctagaagaaaaaaagaaaaataaaagtgatttt	Protospacer
 .* .* .******* ************* **

86. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP039267 (Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gattaaataaaaaaataaaaataaaaaaatcttt	Protospacer
  ****  ******************. .*.*

87. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
tatttataaaaaaaataaatataaaaacccggag	Protospacer
* ** ************** ******.. .  *.

88. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_MK715471 (Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence) position: , mismatch: 10, identity: 0.706

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
ttttaataaaagaaataaaaagaagaagagaaga	Protospacer
***********.********* **.*. .   .*

89. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_022874 (Bacillus thuringiensis YBT-1518 plasmid pBMB0229, complete sequence) position: , mismatch: 11, identity: 0.676

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
gtttaataaaagaaataaaaatgaaaagaaaggt	Protospacer
 **********.**********.***. .   .

90. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 11, identity: 0.676

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
aattaagaaaaaatataaaaataaaagctccgcc	Protospacer
  **** ****** *************. ..

91. spacer 1.1|747140|34|NZ_CP024749|CRISPRCasFinder matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 11, identity: 0.676

ttttaataaaaaaaataaaaataaaagtgtttaa	CRISPR spacer
cattaaaaataaaaataaaaataaaaataaaatg	Protospacer
. **** ** ****************.*.    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

468693 : 475671

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100027759.1\|468693_470208_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.0e-59	43.9
WP_100027760.1\|470246_471056_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_100027761.1\|471083_471674_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.7e-18	34.8
WP_100027762.1\|471661_472681_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A127KMF9	Cyanophage	7.3e-65	44.4
WP_008802673.1\|472872_474222_-	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	6.5e-53	31.8
WP_100027763.1\|474255_474969_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.9e-43	43.2
WP_005890431.1\|475197_475671_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-26	49.0

DBSCAN-SWA_2

804653 : 832182

Clostridium_phage(33.33%)

tail,plate,holin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100027923.1\|804653_805673_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_100027924.1\|805915_806602_-	thymidylate kinase	NA	NA	NA	NA
WP_005913399.1\|806589_807753_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_100027925.1\|807771_808662_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_100027926.1\|808654_809347_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.8e-19	54.5
WP_100027927.1\|809479_810373_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_005899316.1\|810374_810587_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_100027928.1\|810798_811347_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_147383210.1\|811359_812391_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_147383358.1\|812371_813523_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_005890909.1\|813522_814596_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.1e-07	39.5
WP_005913388.1\|814620_815055_-	hypothetical protein	NA	NA	NA	NA
WP_005913387.1\|815059_816088_-	N-acetylmuramoyl-L-alanine amidase	A0A067ZJB6	Vibrio_phage	2.3e-18	33.2
WP_008799658.1\|816183_816468_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_020975305.1\|816915_817302_-\|holin	phage holin family protein	A0A0E3Y658	Fusobacterium_phage	1.9e-42	76.3
WP_023036248.1\|817313_817763_-	DUF1353 domain-containing protein	R4IFV5	Cronobacter_phage	1.6e-11	42.0
WP_023036249.1\|817749_818133_-	hypothetical protein	NA	NA	NA	NA
WP_023036250.1\|818188_818692_-	M15 family metallopeptidase	A0A0E3Y6B0	Fusobacterium_phage	2.6e-87	94.5
WP_100027930.1\|818881_819604_-	penicillin-binding protein	A0A0E3U2P7	Fusobacterium_phage	6.7e-81	64.9
WP_100027931.1\|820656_821307_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_023036254.1\|821299_822364_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	4.3e-44	35.9
WP_005914090.1\|822365_822794_-	DUF2634 domain-containing protein	A0A0A7RUS1	Clostridium_phage	1.3e-20	40.7
WP_005914088.1\|822795_823248_-	DUF2577 family protein	NA	NA	NA	NA
WP_005914086.1\|823244_824288_-	hypothetical protein	A0A0A7RTP6	Clostridium_phage	1.1e-26	28.0
WP_100027932.1\|824292_824739_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_100027933.1\|824752_826693_-\|tail	phage tail tape measure protein	H9A124	Staphylococcus_phage	1.6e-44	32.5
WP_100027934.1\|826744_827536_-	phage antirepressor KilAC domain-containing protein	A0A0C5AEJ9	Bacteriophage	7.4e-65	62.0
WP_023036258.1\|827528_827831_-	hypothetical protein	NA	NA	NA	NA
WP_023036259.1\|827950_828118_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_100027935.1\|828219_829080_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_100027936.1\|829240_829462_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.3e-16	59.5
WP_172436253.1\|829467_829605_-	hypothetical protein	NA	NA	NA	NA
WP_100027937.1\|829674_830082_-	hypothetical protein	NA	NA	NA	NA
WP_100027938.1\|830265_830640_-	regulator	NA	NA	NA	NA
WP_100027939.1\|830649_831090_-\|tail	phage tail tube protein	A0A0K2SUB8	Clostridium_phage	1.8e-28	46.6
WP_100027940.1\|831102_832182_-\|tail	phage tail sheath protein	A0A0A8WJL8	Clostridium_phage	1.9e-42	35.4

DBSCAN-SWA_3

850337 : 861987

Fusobacterium_phage(78.57%)

integrase

attL 850219:850234|attR 859304:859319

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
850219:850234	attL	NA	NA	NA	NA
WP_100027956.1\|850337_850754_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2MV59	Bacillus_phage	7.2e-19	44.2
WP_100027957.1\|850768_851212_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_100027958.1\|851431_851809_+	hypothetical protein	A0A0E3Y6I8	Fusobacterium_phage	1.1e-58	84.8
WP_100027959.1\|851842_852073_+	hypothetical protein	A0A0E3Y5I4	Fusobacterium_phage	4.8e-25	70.7
WP_100027960.1\|852082_852331_+	hypothetical protein	A0A0E3U243	Fusobacterium_phage	2.9e-07	39.3
WP_100027961.1\|852574_853267_+	hypothetical protein	A0A0E3Y6D2	Fusobacterium_phage	1.2e-124	97.8
WP_100027962.1\|853278_853734_+	siphovirus Gp157 family protein	A0A0E3U2R8	Fusobacterium_phage	1.0e-63	89.4
WP_100028561.1\|853890_854478_+	hypothetical protein	A0A0E3Y6J2	Fusobacterium_phage	1.2e-107	96.4
WP_100027963.1\|854474_854912_+	hypothetical protein	NA	NA	NA	NA
WP_100027964.1\|855008_855245_+	hypothetical protein	NA	NA	NA	NA
WP_172436255.1\|855246_855408_+	hypothetical protein	A0A0E3Y654	Fusobacterium_phage	5.2e-10	73.9
WP_100027965.1\|855404_855635_+	hypothetical protein	NA	NA	NA	NA
WP_100027966.1\|855646_856132_+	hypothetical protein	NA	NA	NA	NA
WP_100027967.1\|856131_856407_+	hypothetical protein	NA	NA	NA	NA
WP_100027968.1\|856393_856606_+	hypothetical protein	NA	NA	NA	NA
WP_100027969.1\|856592_856982_+	hypothetical protein	A0A0E3Y4X1	Fusobacterium_phage	1.4e-13	42.4
WP_008799911.1\|856984_857440_+	methyltransferase	A0A0E3Y6D6	Fusobacterium_phage	1.5e-81	90.7
WP_100027970.1\|857444_857975_+	dUTP diphosphatase	A0A0E3U2S3	Fusobacterium_phage	2.7e-47	55.7
WP_100027971.1\|857988_858180_+	hypothetical protein	NA	NA	NA	NA
WP_100027972.1\|858217_859279_+\|integrase	site-specific integrase	A0A0E3Y5J2	Fusobacterium_phage	6.9e-50	35.5
WP_005911775.1\|859804_859924_+	type II toxin-antitoxin system YoeB family toxin	NA	NA	NA	NA
859304:859319	attR	NA	NA	NA	NA
WP_005887816.1\|860012_860987_-	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	7.1e-09	33.0
WP_005911776.1\|860979_861987_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.8e-19	31.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage