CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022549	Sphingorhabdus sp. YGSMI21 plasmid unnamed, complete sequence	1 crisprs	csa3	0	1	0	0
NZ_CP022548	Sphingorhabdus sp. YGSMI21 chromosome, complete genome	2 crisprs	DEDDh,WYL,DinG,csa3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022549_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022549_1

18917-18990

Orphan

Consensus_repeat	Method
AAACTTTCTTCGAGGAAAGTTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022549_1

>merge|NZ_CP022549|1|18917-18990|CRISPRCasFinder
AAACTTTCTTCGAGGAAAGTTTTTCTGGACCGCGAATCCAGTGGCGAAAAATACTTTCTTCGAGGAAAGTTTTT

>NZ_CP022549|1|1|18917-18990|CRISPRCasFinder
AAACTTTCTTCGAGGAAAGTTTTT	CTGGACCGCGAATCCAGTGGCGAAAA
ATACTTTCTTCGAGGAAAGTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022549.1\|WP_100095767.1\|8324_9305_-\|DUF1738-domain-containing-protein	unknown	unknown	gnl\|CDD\|226680
NZ_CP022549.1\|WP_100095776.1\|23070_23358_+\|type-IV-conjugative-transfer-system-protein-TraL	unknown	unknown	gnl\|CDD\|377786
NZ_CP022549.1\|WP_100095771.1\|16688_17120_-\|DUF2384-domain-containing-protein	unknown	unknown	gnl\|CDD\|131346
NZ_CP022549.1\|WP_100095779.1\|24738_26064_+\|conjugal-transfer-protein-TraB	unknown	unknown	gnl\|CDD\|319756
NZ_CP022549.1\|WP_100095764.1\|6828_7332_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_100095768.1\|9401_11465_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319263
NZ_CP022549.1\|WP_100095778.1\|23935_24739_+\|type-F-conjugative-transfer-system-secretin-TraK	unknown	unknown	gnl\|CDD\|368991
NZ_CP022549.1\|WP_100095772.1\|17665_18913_-\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NZ_CP022549.1\|WP_100095896.1\|22690_23014_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_123906367.1\|22390_22573_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_100095774.1\|20150_21347_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274585
NZ_CP022549.1\|WP_100095777.1\|23363_23939_+\|conjugal-transfer-protein-TraE	unknown	unknown	gnl\|CDD\|377500
NZ_CP022549.1\|WP_123906366.1\|7407_7620_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_100095780.1\|26081_26930_+\|DsbC-family-protein	unknown	unknown	gnl\|CDD\|239318
NZ_CP022549.1\|WP_100095775.1\|21689_22193_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NZ_CP022549.1\|WP_100095765.1\|7644_7842_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_100095766.1\|7831_8314_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022549.1\|WP_100095769.1\|11705_15917_-\|methylase	unknown	unknown	gnl\|CDD\|372772
NZ_CP022549.1\|WP_100095773.1\|19025_20090_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP022549.1\|WP_100095770.1\|16209_16692_-\|RES-domain-containing-protein	unknown	unknown	gnl\|CDD\|227941

Protein	Function_ID	Function_description	E-value
NZ_CP022549.1\|WP_100095771.1\|16688_17120_-\|DUF2384-domain-containing-protein	gnl\|CDD\|131346	TIGR02293, conserved_protein_of_unknown_function, putative toxin-antitoxin system antitoxin component, TIGR02293 family. Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. This family was proposed by Makarova, et al. (2009) to be the antitoxin component of a new class of type 2 toxin-antitoxin system, or addiction module. [Cellular processes, Other].	3.72712e-28
NZ_CP022549.1\|WP_100095779.1\|24738_26064_+\|conjugal-transfer-protein-TraB	gnl\|CDD\|319756	cd16430, TraB, TraB is a homolog of VirB10 which forms part of core complex in Type IV secretion system (T4SS). This family contains TraB (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TraB is localized similarly to related proteins in other systems, but unlike in other systems, Neisseria gonorrhoeae TraB does not require the presence of other T4SS components for proper localization. It has been shown to be expressed with TraK (VirB9 homolog) at low levels in wild-type cells, suggesting that gonococcal T4SS may be present in single copy per cell and the small amounts of these proteins are sufficient for DNA secretion.	1.35976e-67
NZ_CP022549.1\|WP_100095768.1\|9401_11465_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319263	cd16406, ParB_N_like, ParB N-terminal, parA-binding, -like domain of bacterial and plasmid parABS partitioning systems. This family represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	3.16858e-23
NZ_CP022549.1\|WP_100095778.1\|23935_24739_+\|type-F-conjugative-transfer-system-secretin-TraK	gnl\|CDD\|368991	pfam06586, TraK, TraK protein. This family consists of several TraK proteins from Escherichia coli, Salmonella typhi and Salmonella typhimurium. TraK is known to be essential for pilus assembly but its exact role in this process is unknown.	2.47877e-58
NZ_CP022549.1\|WP_100095772.1\|17665_18913_-\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	1.38517e-78
NZ_CP022549.1\|WP_100095774.1\|20150_21347_-\|AAA-family-ATPase	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	6.80416e-89
NZ_CP022549.1\|WP_100095777.1\|23363_23939_+\|conjugal-transfer-protein-TraE	gnl\|CDD\|377500	pfam05309, TraE, TraE protein. This family consists of several bacterial sex pilus assembly and synthesis proteins (TraE). Conjugal transfer of plasmids from donor to recipient cells is a complex process in which a cell-to-cell contact plays a key role. Many genes encoded by self-transmissible plasmids are required for various processes of conjugation, including pilus formation, stabilisation of mating pairs, conjugative DNA metabolism, surface exclusion and regulation of transfer gene expression. The exact function of the TraE protein is unknown.	3.04551e-56
NZ_CP022549.1\|WP_100095770.1\|16209_16692_-\|RES-domain-containing-protein	gnl\|CDD\|227941	COG5654, COG5654, Uncharacterized conserved protein [Function unknown].	8.86206e-26
NZ_CP022549.1\|WP_100095780.1\|26081_26930_+\|DsbC-family-protein	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	3.23006e-46
NZ_CP022549.1\|WP_100095775.1\|21689_22193_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	7.41479e-05
NZ_CP022549.1\|WP_100095767.1\|8324_9305_-\|DUF1738-domain-containing-protein	gnl\|CDD\|226680	COG4227, COG4227, Antirestriction protein [DNA replication, recombination, and repair].	1.79649e-89
NZ_CP022549.1\|WP_100095769.1\|11705_15917_-\|methylase	gnl\|CDD\|372772	pfam13872, AAA_34, P-loop containing NTP hydrolase pore-1.	8.50456e-146
NZ_CP022549.1\|WP_100095773.1\|19025_20090_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	1.07727e-24
NZ_CP022549.1\|WP_100095776.1\|23070_23358_+\|type-IV-conjugative-transfer-system-protein-TraL	gnl\|CDD\|377786	pfam07178, TraL, TraL protein. This family consists of several bacterial TraL proteins. TraL is a predicted peripheral membrane protein which is thought to be involved in bacterial sex pilus assembly. The exact function of this family is unclear.	1.29829e-28

>NZ_CP022549.1|WP_100095772.1|17665_18913_-|replication-initiator-protein-A
MARTKGVRGRRAVGEQFDLFLPYIADLNFRDQREMMERPFFSLAKTRRMKPIDYKSPDGKLWVHVSANPDYGMATIWDADILIYCASVLADMARRGQNDIPRTLHIMPYDLLRAIGRPTTGRAYELLGQGLDRLVSTTVKTNIRAENRREATFSWLDGWTQLVDEKTERSRGMTLELSNWFWEGVLMKGGVLSIDRAYFDISGGRERWLYKVARKHAGGAGDLGFAISMPTLFEKSGAEGQYRRFKFEILKLAEKNGLPGYDLIIEDVERGEPKLRMRKQGDHEPVKLASAGQGSETPKAASPENPVRTKPAAAAPKSDNHVTKTGALDEPVIDARTMIKRTLTGLSTAATRGYMTDETIELLRSECPGWDLYRLHADFETWVNGSEDRTPVDWQRAFIGFVRRHNKKHGHEIRR
>NZ_CP022549.1|WP_100095771.1|16688_17120_-|DUF2384-domain-containing-protein
MDSQDYSMNQLLGVSSDGEDLLSLALHIEEGLPVEAIDHLVAIVAPGNISLKYRFLPKPTLARRKKSAKKILTSEEGNKLARVAKVMRFALEIYGDIEKARTFLMKPHIMLGNRIPLEIVLATGPGADSVINILGRAAYGGGV
>NZ_CP022549.1|WP_100095770.1|16209_16692_-|RES-domain-containing-protein
MSAQHTDQILTAYRIGALNGKHPLYGDEGARFYPGRWNKWSSPIVYCSEHYSTQILEKLVLANAVMPPDLHFITIIIPKGICYEKFQTAAHPGWDGKSQRICQEFGDKWVRERRSAILFVPSIPARFETNILINLAHDASKAITYERAKPISWDDQLYRS
>NZ_CP022549.1|WP_100095769.1|11705_15917_-|methylase
MPIDPYSISHPKASILLSAGVNLSSKLDKPLTRDMLIKHLAAATGTSMVQFTIRDAFEMLECAIVAHIQRDEKAASQQLPSLIATYPDLPTHTVRSELQVRRQQFSTPAPLALFAQVRAALTPDDFVLEPSAGTGLLATEALRLGATLRLNELDTCRRALLTGLYPGAAITNCDGAEIAARWQGRAPTIVLMNPPFSSNADGYEDHFTALRHLHSALKVLSTGGRLVAILPSWIDRPGRNAASLAKMITGASIVERFTLGEGCFAKHGTNIATTLLVLDKLPDLPMAHNIHIAALAELTAQPKPLPRREITPPNKTRSPTKSLFGGFVRPAEPVQPIPAHRPVEDAITPVVYTALAEPAALGEQVGDYLPYRPARMIFEQAGEHPTALVESLAMGSVAPPKPHYRPMLPTRIVKDRLLSVAQLETVAYAGQAHADWLTGNIDDENKGEVIEQRIRKGYFLGDGTGAGKGRQIAATILDNWLKGYRRHIWVSKNATLLEDARRDWTAVGGIAADIQPLKNWPLGTNVAMSEGVLFVPYATLQSQREDSSRLTQILDWAGPDFEGVIAFDEAHAMGGVAGGETARGKTKGSEQGIAGVTLQDKLPAARVLYASATGASNVNNLAYAVRLGLWGPNTAFPTRDLFIEEIAAGGIAAMEVVARDLKSMGLYAARALSFAGVEYEMLEHILSAEQIETYDRYAEAWSIIHQNMEAALEESGVIDAVSGDTLNAGAKGAARSRFESVKQRFFQQLLMSLKLPSLFPAIETHIADEMAIIIQLVSTGEAMLDRRLADHDENGTDELDIDLSPREYLFDYLTRAFPTRQMQTYIDLEGEMRSQPMQDEHGNPVHCADAIARRDACLEQLGAMPPISSALDAIITRFGEDKVAEITGRSRRLSTASDGRQLVQRRSARSNAAETDAFMEDRKQILIFSDAGGTGRSYHASLDVPNQRRRVHFLLEPGWRADAAIQGLGRTHRTHQASSPLFRPVTTDCRGERRFISTIARRLDSLGALTRGQRQTGGQNLFDPADNLESDYAVSALNAWFRLLHSGKLKSASFQDFQKRTGLELEGEGGELRMDLPPIQRWLNRILALPIAMQNGVFDEFLGLVEQRVAKAREAGTLDLGVETIAVQTLEIVSERLLRTDRCGATTNLAELAITRKRFVRSNDDIDFRRSWDQSAEPMKNDKSGKVALMVSQRDSLLDDGTTVRRFKLIRPSRIDHIDDQALAESNWRKIHDTEFAKLWTVEADEARDTLENDTLFIATGLLLPVWRKIPSKMLSVVRIAAADGRSILGRVVDAGDLGALCQGLGLEAPKLTPNAMIESARSGARVPVNGLDELTLKTSRVAGAQRLEIIGAHAARLGWYKSRGCFTEIIAYKTRLFMPDTQAVTILEAICAESQTERTKVA
>NZ_CP022549.1|WP_100095768.1|9401_11465_-|ParB/RepB/Spo0J-family-partition-protein
MTIQIIPLNKLRLSLHNVRKSGAETNLDWLVANIEAKGVLQNLIGGTAKKKGFYDIFAGGRRLRALNILAASGKIAKNHGIPVMVSDESAEGIAETSLAENFLREKMTPTDECQAFLHFLGTEGDIDAVAKRFGQTRRFVEGRLRLATLAEPIFDILAVGEMTMEVAKAYAATADQAKQLAVFEEVKGSWLENNAHEIRKRILGASIPASHPVALLVGEDAYIKAGGRVARDLFTEVEAAEWLDGDLAVDLASTLLQEAAAIHAEKSGIGTVVPLLAKGSTWTDREELMQARLDREPLSEAAEARIAEIEAEHAQIEQLFESTEMDDEELDAINERVAKLEREEEELRDTEVLIDEERKASLTQFMVIGEDGKPRVETNYWEVPQARKLGDGDGHKDPKKVAAKVQGLSGVLADELSIARRDILALHVASNPAIALDLAIFTLADRAVGKYSEHGCSLEVARRNDPNVRGNLPDSLAGAALGEIRNQLDTTWAEHSTAAERFEAFRALEEETRATWLAVCMASSMEASLGGKGLQHSNPFHDHLGQLLDIDVAAWWRPSAGGYFARVRKAGMQRALDAIGGPVLAAKYASSKVAEMADACEKLCDGSAITEPEIREAGIAWLPAAMRFDPNQVEETGADGEDAPHDEESEGGAAGEKNNHPAGEDAESGSEGEEDSNSDAATTSQNA
>NZ_CP022549.1|WP_100095767.1|8324_9305_-|DUF1738-domain-containing-protein
MKTDISATITATIIAKLEAGTKPWVKPWTGQPISRPLRHCGSAYRGINTLILWMAAEERGYISPYWMTYRQAIILKGQVRKGEKSSQAVFYKTLVTKDGTADKESIDDNAGGSGDEGQTRRLLRQYAVFNAEQIDGLPAHFYPIPKPPQKIPESIHRPRLEAIFAKIPAAVRHNGNQAYYNRARDEIVLPAIDQFPNFEAYFAVRAHETAHWTGAKRRLDRTFGKRFGDAAYAMEELIADIAAAILGATLGLPEAQLDNHASYLAHWLKVLKSDKTAILTAASKADEAVNFILGFAQEGPCRIVGREPQLVAACSPSRPKSTVMTC
>NZ_CP022549.1|WP_100095766.1|7831_8314_-|hypothetical-protein
MANYFTHISFKLAVTREEAEQFVSVIASAASIEDGNGPLLTPEIEKAFNTDSQSAEQNFCEIMDDLIFGIECIFNETSSTLTIFDSDGAPNLSALGQCLQCLYPEKLPLGFVYADTCDKARADGFGGGYFVITGDTISQQTLAQMLSNDLTALAETSGVS
>NZ_CP022549.1|WP_100095765.1|7644_7842_-|hypothetical-protein
MSADQRTAGHVATLENAYRVATRVAEATNQDMQVSATGKPERPFIAEPANTGTQRVIARILADRD
>NZ_CP022549.1|WP_123906366.1|7407_7620_-|hypothetical-protein
MRVTTYKKRSCEAIGVPIPVRDLHRCKVSHCNNTGAYSVLVIVAAVDYLIDISQHDLQILADVKANKPSA
>NZ_CP022549.1|WP_100095764.1|6828_7332_-|hypothetical-protein
MADRCSASITIGGKLAAADLPRLLTAISDEGLSTEFDGPKFELKELVSGEPLLLCAHEVSWGTFTELEAFCRTHKLAYTRWTGQCAGVWGCFRTVYRGAAETREGDDAVDEYDVSEDDQILIGEQLARTLGSFRAIADHFARAAFAVPPLVIVASGPEQTEPIAPQA
>NZ_CP022549.1|WP_100095773.1|19025_20090_-|ParB/RepB/Spo0J-family-partition-protein
MAGGKQKDYLADLLADDQPVSADEAASIEPSATPAETSGRLARGGGMALLGRESALARVASGDVRQVTQLRLDPTRVRIWKGNARIQERLNEENVRDLIDTIIAEGGQKVPAIVRRVNDDAVYDYEVIAGTRRHFAISWLRTNSYPDMTFLAQVADLDDEAAFRLADIENRARKDVSEIERARNYASALEQHYDGKQRRMAERLKLSEGWLSKMLKVATLPDIVLAAFANLSALTLNPAYKLSQALADERRHKSIIGAAQRVTEENGQRAQDGQPPLGGTVVLTRLMAAGEADKQRPKLYEGISRHNRPALSVTTASRQGLTIKVHAASGADEDEMVALFREALASHEYKTEVE
>NZ_CP022549.1|WP_100095774.1|20150_21347_-|AAA-family-ATPase
MNSEVNRIAEMAEAGERMIERLRKKAFLPEARKGLAVRYGIAEAAQLLGCSTNRIRMAETDGRLPPPPPTKNGRRPGYSIEDLLNMRQVLDASPARAPLDQPAIIAVQNFKGGVGKSTVTTHLAHYFGVLGYRVLVVDCDSQATTTTLFGFNPHFNITREQTLYPYLSIEPTQTDLLYAVQRTPWPNVDLIPSNLELFDVEYELAASGADGGSVLAARFRKLKSGLLDLAQQYDIVLLDPPPALGTISLAVMQAANALLIPLAATTPDFCSTVQFLSMMEQVTEQIRQAGIDVSYDFVRLICSKFDSNDPSHAMVQQIMEQSFGPALLPVPILESAEISHAALRMMTVYELERPIGTPRTHKRCRANLDQALGQVEQLVRRNWGVTSPASAAEVVNAT
>NZ_CP022549.1|WP_100095775.1|21689_22193_-|helix-turn-helix-transcriptional-regulator
MDYREDRQYLEEQEELSRPQPKIRITPQKFLPLIIEVMARGNIKSSDLVKRTGISKSKISRLLSEQRQIDNAALYLIFDALGIDPMRALLAVGRFGQWEQYFDLDVEIIADLIDVLPSFLSKARSESIRTSISRPGAIVLAERLSEMIAKNDRETEKRQLERPIAGI
>NZ_CP022549.1|WP_123906367.1|22390_22573_+|hypothetical-protein
MSKPWSDSHDQVAVLTNNIANVPTFVAKMEIIVATAAKTDAKIGNIVANLTTIIDSHGKK
>NZ_CP022549.1|WP_100095896.1|22690_23014_+|hypothetical-protein
MNIASQCGPIPLASIVKAVAVTAVVAVAGSGVAIAGADATFNTALTSFTGFLEGSGGKIITVLSLAGGIVGLASGRFSLGQVAIPVGVGVGAGTGVPIVTAAVTATI
>NZ_CP022549.1|WP_100095776.1|23070_23358_+|type-IV-conjugative-transfer-system-protein-TraL
MADKYAIPARLDDPELIGFWTLDEFIAMVLPFIWGVLTQHILIGIILGFGCWWGLRKAKAGRAASWLLHLAYWYLPGGFVGLRATPPSFLRLMAG
>NZ_CP022549.1|WP_100095777.1|23363_23939_+|conjugal-transfer-protein-TraE
MDLAFSHTQSQRVLKQRNMLLVACLVLAALAAILGIAAGSRDREVVLQPVLRTPLTLSSSGVSREYLEAVTRDAAVLTLNRTPQSLDYWMNAILEMVHPSAYGEVKADLLKIMEDQRGSSIAQFFTMESLKVDTEGLSSEVSGVLHTMVGRQEVSAVQKTFHYGWVYNGLSLKLVQFGMVEKVEPKKAVSS
>NZ_CP022549.1|WP_100095778.1|23935_24739_+|type-F-conjugative-transfer-system-secretin-TraK
MNTVFWCCGIACGSILASRIHSISTRSLGLGLIGASSIALSSPALADQTLMASDNARVDCIASSRDLTRISLVGDEIASVSKLQTGNPNEDFSVVNEPVRGDIYVSVPEGFSPKVLSFFATSKKGYVYKFACRLSGEEAQQVFVANPAIAGEQTGDSRIVAAADPQEQAVKLVQAMYTSSIPEGYRMRQPVRASVRVGDLKVRMIAEYRGTEFTGKVIRIENQGSELLVIADDVVAPSNATAVSIAEPNLAPGASTTAYIVQPAGEN
>NZ_CP022549.1|WP_100095779.1|24738_26064_+|conjugal-transfer-protein-TraB
MKFMDRFRKQKITEDTPDVGEDEVSPVGHAMSGNDDVQRKQRLLLGGVALTALVGGAWWVLDSSVSEEELANSGVKEVQVSTNDMVNKNMSEQEWIARSENRFESTDNRLRTVDGQQAQLAAMQEEMAALRGQNSAMSSDGQRVLSAYQTENETLKSQLAAAQSAPPAAGGPNGLYGPSSAALYQQPSGPGAAPLPAPSPREVKTVAFSNGPGGNAVRAERGTTVFSDSPDYLPANSFATARVIVGVDASAGVSSQTDPLPVVLRITGPARSVADKGRVLTTKLQGCLVNGAARGDLSAEKVYVKLQRMTCAQPGGRYAVSDVKGFIAYAGKSGVRGRVVSREGGLVTQAFLAGLAGGFGRGFSANTDSVLQGSNITVNGKRDKLGLGEIAQGGLGEGVSTAADTVSKYLIERAEQYQPVIEMPTGIDVEIVFLDGAYVRN
>NZ_CP022549.1|WP_100095780.1|26081_26930_+|DsbC-family-protein
MAKYNWVIGASLVSVLIAGTAFAATQSANATVEAALKTRLPKTEFAKVDCNVIGSICEVTAGKSIFYVDKQARYLIVGHVFDMETRQDLTSARLLEINPEALLGGASQISDDGSDELGSAQAGTPVARDYPMPKSRIKAGAGRTERVSLASLPSSGAIEWGSGKTKVTVFTDLRCGYCRALTQQLETMDVRVVERPISVLGTRDLSNRVYCAKDRPRALHAAYAGNIPESAKCDTSGLDANERFARENGFTGTPVIVRSDGAVHHGYLPKDRLLAWLKGASS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022549_1	1.1\|18941\|26\|NZ_CP022549\|CRISPRCasFinder	18941-18966	26	NZ_CP022549	Sphingorhabdus sp. YGSMI21 plasmid unnamed, complete sequence	18941-18966	0	1.0

1. spacer 1.1|18941|26|NZ_CP022549|CRISPRCasFinder matches to NZ_CP022549 (Sphingorhabdus sp. YGSMI21 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ctggaccgcgaatccagtggcgaaaa	CRISPR spacer
ctggaccgcgaatccagtggcgaaaa	Protospacer
**************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022548_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022548_1

2034684-2034772

Orphan

Consensus_repeat	Method
TCCCCTCCCGCTTGCGGGAGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022548_1

>merge|NZ_CP022548|1|2034684-2034772|CRISPRCasFinder
TCCCCTCCCGCTTGCGGGAGGGGTCGGGGGTGGGGATATTCTGTGTGTCCGGCTGGCCCACCCCTGGCCCCTCCCGCTTGCGGGAGGGG

>NZ_CP022548|1|1|2034684-2034772|CRISPRCasFinder
TCCCCTCCCGCTTGCGGGAGGGG	TCGGGGGTGGGGATATTCTGTGTGTCCGGCTGGCCCACCCCTG
GCCCCTCCCGCTTGCGGGAGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022548.1\|WP_100093887.1\|2044733_2046128_-\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NZ_CP022548.1\|WP_100093869.1\|2023038_2024586_+\|type-II-secretion-system-ATPase-GspE	unknown	unknown	gnl\|CDD\|131585
NZ_CP022548.1\|WP_100093882.1\|2040524_2041643_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP022548.1\|WP_100095544.1\|2039738_2040407_-\|guanylate-kinase	unknown	unknown	gnl\|CDD\|234719
NZ_CP022548.1\|WP_100093885.1\|2043827_2044442_+\|DUF2585-domain-containing-protein	unknown	unknown	gnl\|CDD\|234871
NZ_CP022548.1\|WP_123906297.1\|2037255_2039286_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224983
NZ_CP022548.1\|WP_164089107.1\|2025822_2026296_+\|type-II-secretion-system-major-pseudopilin-GspG	unknown	unknown	gnl\|CDD\|130771
NZ_CP022548.1\|WP_100093886.1\|2044424_2044718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022548.1\|WP_100093875.1\|2029989_2031456_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|365848
NZ_CP022548.1\|WP_100093874.1\|2029143_2029887_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP022548.1\|WP_100093871.1\|2026308_2027436_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273768
NZ_CP022548.1\|WP_100093877.1\|2032216_2032552_-\|phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226924
NZ_CP022548.1\|WP_100093873.1\|2027897_2029031_-\|acyl-CoA-desaturase	unknown	unknown	gnl\|CDD\|239582
NZ_CP022548.1\|WP_100095542.1\|2024578_2025802_+\|type-II-secretion-system-inner-membrane-protein-GspF	unknown	unknown	gnl\|CDD\|273980
NZ_CP022548.1\|WP_100093880.1\|2036125_2037241_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022548.1\|WP_100093876.1\|2031848_2032220_+\|DUF4345-domain-containing-protein	unknown	unknown	gnl\|CDD\|372978
NZ_CP022548.1\|WP_100093872.1\|2027432_2027906_+\|type-II-secretion-system-protein-M	unknown	unknown	gnl\|CDD\|377391
NZ_CP022548.1\|WP_100093879.1\|2035778_2036129_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022548.1\|WP_100093884.1\|2043217_2043646_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022548.1\|WP_164089109.1\|2041639_2042920_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913

Protein	Function_ID	Function_description	E-value
NZ_CP022548.1\|WP_100093887.1\|2044733_2046128_-\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NZ_CP022548.1\|WP_100093869.1\|2023038_2024586_+\|type-II-secretion-system-ATPase-GspE	gnl\|CDD\|131585	TIGR02533, Type_II_secretion_system_protein_E, type II secretion system protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP022548.1\|WP_100093882.1\|2040524_2041643_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.11281e-35
NZ_CP022548.1\|WP_100093885.1\|2043827_2044442_+\|DUF2585-domain-containing-protein	gnl\|CDD\|234871	PRK00944, PRK00944, hypothetical protein; Provisional.	1.05214e-94
NZ_CP022548.1\|WP_164089107.1\|2025822_2026296_+\|type-II-secretion-system-major-pseudopilin-GspG	gnl\|CDD\|130771	TIGR01710, Type_II_secretion_system_protein_G, type II secretion system protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.48167e-53
NZ_CP022548.1\|WP_100093875.1\|2029989_2031456_+\|cytochrome-P450	gnl\|CDD\|365848	pfam00067, p450, Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.	9.4718e-69
NZ_CP022548.1\|WP_100093874.1\|2029143_2029887_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	1.20105e-07
NZ_CP022548.1\|WP_100093871.1\|2026308_2027436_+\|hypothetical-protein	gnl\|CDD\|273768	TIGR01709, Type_II_secretion_system_protein_L, type II secretion system protein L. This model represents GspL, protein L of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	1.11273e-05
NZ_CP022548.1\|WP_100093877.1\|2032216_2032552_-\|phosphotyrosine-protein-phosphatase	gnl\|CDD\|226924	COG4551, COG4551, Predicted protein tyrosine phosphatase [General function prediction only].	3.16111e-38
NZ_CP022548.1\|WP_100093873.1\|2027897_2029031_-\|acyl-CoA-desaturase	gnl\|CDD\|239582	cd03505, Delta9-FADS-like, The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like CD includes the delta-9 and delta-11 acyl CoA desaturases found in various eukaryotes including vertebrates, insects, higher plants, and fungi. The delta-9 acyl-lipid desaturases are found in a wide range of bacteria. These enzymes play essential roles in fatty acid metabolism and the regulation of cell membrane fluidity. Acyl-CoA desaturases are the enzymes involved in the CoA-bound desaturation of fatty acids. Mammalian stearoyl-CoA delta-9 desaturase is a key enzyme in the biosynthesis of monounsaturated fatty acids, and in yeast, the delta-9 acyl-CoA desaturase (OLE1) reaction accounts for all de nova unsaturated fatty acid production in Saccharomyces cerevisiae. These non-heme, iron-containing, ER membrane-bound enzymes are part of a three-component enzyme system involving cytochrome b5, cytochrome b5 reductase, and the delta-9 fatty acid desaturase. This complex catalyzes the NADH- and oxygen-dependent insertion of a cis double bond between carbons 9 and 10 of the saturated fatty acyl substrates, palmitoyl (16:0)-CoA or stearoyl (18:0)-CoA, yielding the monoenoic products palmitoleic (16:l) or oleic (18:l) acids, respectively. In cyanobacteria, the biosynthesis of unsaturated fatty acids is initiated by delta 9 acyl-lipid desaturase (DesC) which introduces the first double bond at the delta-9 position of a saturated fatty acid that has been esterified to a glycerolipid. This domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain the residues: HXXXXH, HXXHH, and H/QXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within the rat stearoyl CoA delta-9 desaturase. Some eukaryotic (Fungi, Euglenozoa, Mycetozoa, Rhodophyta) desaturase domains have an adjacent C-terminal cytochrome b5-like domain.	1.10818e-52
NZ_CP022548.1\|WP_100095542.1\|2024578_2025802_+\|type-II-secretion-system-inner-membrane-protein-GspF	gnl\|CDD\|273980	TIGR02120, Putative_general_secretion_pathway_protein_F, type II secretion system protein F. This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the"Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. This model was constructed from the broader subfamily model, pfam00482 which includes components of pilin complexes (PilC) as well as other related genes. GspF is nearly always gene clustered with other GSP subunits. Some genes from Xylella and Xanthomonas strains score below the trusted cutoff due to excessive divergence from the family such that a sequence from Deinococcus which does not appear to be GspF scores higher. [Protein fate, Protein and peptide secretion and trafficking].	8.70131e-149
NZ_CP022548.1\|WP_100095544.1\|2039738_2040407_-\|guanylate-kinase	gnl\|CDD\|234719	PRK00300, gmk, guanylate kinase; Provisional.	2.58547e-114
NZ_CP022548.1\|WP_100093876.1\|2031848_2032220_+\|DUF4345-domain-containing-protein	gnl\|CDD\|372978	pfam14248, DUF4345, Domain of unknown function (DUF4345). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 125 and 141 amino acids in length. There is a single completely conserved residue E that may be functionally important.	1.97098e-13
NZ_CP022548.1\|WP_100093872.1\|2027432_2027906_+\|type-II-secretion-system-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	1.75637e-17
NZ_CP022548.1\|WP_123906297.1\|2037255_2039286_-\|hypothetical-protein	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	0.00133123
NZ_CP022548.1\|WP_164089109.1\|2041639_2042920_-\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.02489e-35

>NZ_CP022548.1|WP_100093877.1|2032216_2032552_-|phosphotyrosine-protein-phosphatase
MSGTAANLLFVCSRNRLRSPTAEAVLNSVDRVTAISAGTNNDAETPLSGDLILWADSIYVMETGHRKKITQKFGPLLKDKPVRNLAIPDNYTFMDPDLVAIIKSRFPEYFA
>NZ_CP022548.1|WP_100093876.1|2031848_2032220_+|DUF4345-domain-containing-protein
MAAFRILSFLIGFIPLWFGVNGLLFGAAEHMGGDAFSTAMDNQYRYLSGVYIGVALMIFYSAGEIRKRAKLFRFAMLFFFIGGCARAVSYLTVGPPPTEQFAAMLVELLSPLLLLWQARVLRY
>NZ_CP022548.1|WP_100093875.1|2029989_2031456_+|cytochrome-P450
MEWLADINESSYHRLKFQIRSTPVATIAAKPHGYPFQESANPHWVRRPSEEELAHIPGEKGLPVLGCTLDLLKDPGGFGRRMFEQYGSVYRAFSFGGWSVNMLGADATELILFNKDKIFSSEQGWGPILNNLFPRGLMLMDFERHRADRKALSVAFKPGPMKHHCQVLGEGIAQRVGEWSGTEFNFYPAIKSLSLDTAASAILGIPWGPEADKINKAFVDEVQASVGVARKPIPFTKMWKGVKAREYLLDYFTPQVKERRAKGGEDIFTQICLATHENGELLTEGEVVDHMNFLMMAAHDTITSSATSLIYLLAKHPEWQDKVREECLAVAPAGTTLSMEQLGKLELTEMAFKEALRLIPPVPSMPRRAVKEFTFRNYTIPAGTSVGVSPSFVHKMEKHWPNPDKFDPLRFTPENSVGRHKYAWVPFGGGAHMCLGLHFAYMQIKILMHAMLTQNRVLLQGGPDYEPKWQVFPIPQPKDGLPVRLEHL
>NZ_CP022548.1|WP_100093874.1|2029143_2029887_-|hypothetical-protein
MTNLLTARLLKSAVAAGALLSLGGCMYGGGAYGDGYVNGRGYDCDPYAPFDDYYACDYGYGFANIGYGGGWYDQYYYPGYGIYIFDRGGRRLAMRDNHRRYWARQRAAYGGHHARDRRDRDGRADRRGDRRDSGYDGRDRTRDPDRNSSRRQRDSDDRDNRGTRNDRRNRTGTSGTKAGGTDQAAPSRDRGDRGSRTDRPPASGAEQPQARPQPAPRADSPPRSTRADPIRNSRETSRRGRKPLSDD
>NZ_CP022548.1|WP_100093873.1|2027897_2029031_-|acyl-CoA-desaturase
MATAFSDIQPDEYTPSEQHPQHGVIIGGPAARAKRIEYGILLSSMVLGSLGALYWTIFHATGWVEWSAFLFGFALINMGVGIGYHRYFTHRAFEAGPKMRLAIGIMAQMACQASVLKWAADHRRHHAFADGVGDVHSPYVDGHGKNMSKWKGLGIAHFGWLFDNTTSDMKVYGKGLIDDPQVLWCHKHRWSIAIFSSIVLPALWALAFGGPEHIIGTILIGGFFRNFFFLNFVMGVNSIGHVFGSQRFETKDGSRNNWFMAWMTFGDGWHNNHHQHPRAASSQIAWWEFDLNGQIIYLWEKMGLVWNVQRAPAYIRNEKGEWVQKKPKVATAKFDEPEVMSADDGGILFPADKPCSRRTSSAISNPPSEGPRTSPLM
>NZ_CP022548.1|WP_100093872.1|2027432_2027906_+|type-II-secretion-system-protein-M
MIDNAKNWFAALSQRERILVAIAGLLLAGLVGYYGIARPMFGAMTAAEEGYVEAVERQARIETKVAALSQPVDGQVAKFSGAIDAFVSQSAGETGIAVASVTPQSGNRVNMVVESAKPTALFGWLARIEREGVAIESLSVNPAGAGTVSATLTLRLH
>NZ_CP022548.1|WP_100093871.1|2026308_2027436_+|hypothetical-protein
MNPDLLLIAFPAADDEALHWWHVSGGAVRAAGCDPDPVLASGAYGQDAVQADLSVIALLPSHLTSIKDHDAISGANESQTLAAATLAARAQSLESDKVHIAATIDGEGGAVTASVGRDILSAGLVRLQALDIDPDAILPSGWLLPVAGDDQAVAADFGFDRVMRAGHIIAVDDPALREFLFGDRTVEQITGDAFDEMLAGAGRKTDLNFRSGPFAKKTKRAMDAKQKRRLGWMVAALVIVSLAIPLMQLAKYHWAANAADEAALASAAAIVGDQQDPESAERALDQRLIAENRGNIMFPVPASALFSALQQVPGVSIVRLDYGENGIVSATLSAVRNEDINPALLAIQKAGFLITATPRTDATGSAQADITVRAP
>NZ_CP022548.1|WP_164089107.1|2025822_2026296_+|type-II-secretion-system-major-pseudopilin-GspG
MTTEIEHPDTVSAPEPKTQKKRNGFTLVELMVVIFILGLLTTIVVINVLPSQDRAMVEKARADIATLGQALEMYRLDNLAYPGSSDGLQALVTAPPSLATTARYRKGGYIKKLPDDPWGRPYQYDNPGRQGPGYDLYSLGADGAPGGEDDNADIYAE
>NZ_CP022548.1|WP_100095542.1|2024578_2025802_+|type-II-secretion-system-inner-membrane-protein-GspF
MPEFAYIAIDPKGREKTGRLAAASDDAARAKLVERNFYVVKMEAAQGSIGNQAKASAGLFGPKKLSSKELTLFTRQLSSLAQVSPLEEALRLIGNQNEKPHVQQRIATVHSGVIEGQRLSEAMRREPKSFPPLYRAMIAAGESSGTLPDITERLADLLERQAELRGKLIGTLAYPSVLALVSVIVVALLMIAVVPKVVEQFDDVNQQLPLVTRIVIGISNFLADWWWAIAIVIGAILLIGWRALKEPQLKYRFDAFLLRLPFFGRLLRDLHAARLARTLSTMVASRLPIIEGLRLTTDTIHNSVLRKASEDMVEAIRGGGSLSTALRNTGVFPPMLVYMTSSGEASGQLDDMLARAAGYLEREFDNFSSTALSLLEPIIIVALGGLVALVILAILLPILQLQNLAGL
>NZ_CP022548.1|WP_100093869.1|2023038_2024586_+|type-II-secretion-system-ATPase-GspE
MEIARGTEAVVSEADGGLGALAAVRDLPYAYARDQGVLIQDRSGERLSLALREGADPLALLEVRRYLALPFDVERVDGPAFEKLLSAHYAMDGSAAAMAGDMALAGEGLDDIAGDIPSAEDLLDSADDAPTIRLINGIIAEAARQGASDIHIEPYETGLVVRMRVDGVLTEKLRMPPHVAGVIVNRIKVMARLDIAERRIPQDGRISLTLGGKLLDVRVSTLPNRASERVVMRILDKESAGISLDLLGMSPNTHAILTDALSEPNGIILVTGPTGSGKTTTLYAGLKQLNDGSRNILTVEDPVEYAIEGIGQTQVNAKVGLTFAAGLRAILRQDPDVVMIGEIRDRETAEIAVQASLTGHLVLSTVHTNDAVGAITRMRDMKVEPFLLASTLRAVVAQRLVRKLCEHCRTPIQADGSLASLLGFDNGTVVYRETGCEHCNQTGFQGRIGVFEAIRIDDTLRKLINDGGDEAAITAHAFRNQPHLGAAARALVRDGLTTPEEAIRISRRESDAVDA
>NZ_CP022548.1|WP_100093879.1|2035778_2036129_+|hypothetical-protein
MNNIEILVEPKSKSHVGWFVHLFSWNKQRRDLIAHRLKLKSRTGGKFTLSSEAKLPNGTYGLRLHVIESGNKASITVVEKPPISYPMGAAWPMTVEVPAQFTQDSDTWFFEHGDEA
>NZ_CP022548.1|WP_100093880.1|2036125_2037241_+|hypothetical-protein
MRFVNIFNTVSVLLATVPMISISQDADAQTLRGPYAVEEGPPAPSDRFDTITRGVSTSIDISEKEAKASASIGGVLTADRDTGGSDQKQDAFFWKLGLDAPVGGTTDLLDPKLDVLDNQVSLTGSLTWKRFSSSLSDLTDPRFQAYVRAAIEACEEQKKKDCEAHRRVPASVFVQDHLPEVHRRLSSAIYDPFYAVSVKGSVGVKEFDYILPGAFTDEDDTKISYSLAIAGVIYPSDTVSAWKLEAEYGNAFEAAEEGIVCRTVVTDPAEDCKSAAPSGPTSKETLVVRAEYRRFFMLSDVNKGIGIAPTGSVDFLSGDFGLEFPIFYKVGSKSPVLPGIKLGYTKDASKPNNKDEDFTVAFFIKTSFNLN
>NZ_CP022548.1|WP_123906297.1|2037255_2039286_-|hypothetical-protein
MTELREIDVLIVGGGFSTMPLIRELDASGIGWLMVSPMMPIWQQLEAADALDFDLVSSLQSSVYSFELVEMLREQGEDFSDGFPTAREFYAIHKKYAARYADRIHHGLVDRIDNHADHSIVHLESGEQFRAKHVVVATAFRRKMNANLKQITVDESFAGKSVAVTSTGDSSNLLIAKLVAYGAKVHLVSNGFIILDKMFATFSPFDDGPRFVPLDQLECHNFSEISKWSYRAFIDGGYIHGLIHHRFAQLFDRNSLGVRHPKSIRPHKDIRHFFKAKAPVENGHIAIKYWPIDVYKLYCEETLEQKIADGYLINDLPFFLEHGHVKLWDKAATTIDHEAMTLSEDGESASFDMLIDGDQEIPAVPEIRAHGESGVEVFAYKPREQFMGVTSPGLQNIYTIGFTRPFTGGLNNITEMQCLLVHRMIADPDFRDSIRTNIDQRIADYNATYYTKRPEKKTDHLVWYGTFTDEVAKLLDIRPARADMPGKKGLMRYYMFPNNVFRFREKGRYAVDGVDKLIEHTSKQYHDYKVLALLVIRYPFFELLALATILLAPVPWWVKIPAAIIHNRLPFTSTLVGKFGLPTRESKAIFNYRKAISFPVLAYPLVAAVVWAAAGMDAAFAFSAGLLAYVYAMIHLGTAKGWNRKFFCDMKSKRSPEMVGFFERYRAVFGRVRSNH
>NZ_CP022548.1|WP_100095544.1|2039738_2040407_-|guanylate-kinase
MADNIASQNIDNDHRELNRRGLLFVLSSPSGAGKSTLAKMLLEADDEIAMSVSVTTRPKRPGEEHGKDYYFVSGDQFEEMVADQSFLEYATVFGNRYGTPSVPVNQSLEAGQDVLFDIDWQGTQQLYQRAGQDVVRVFILPPSLGELRNRLESRNTDAPEIIESRMQRAASEISHWDGYDYVLINDDLDACFTKVKQILATERMRRARQTGLIGFVRDLMAE
>NZ_CP022548.1|WP_100093882.1|2040524_2041643_+|AI-2E-family-transporter
MIQGRISTIFYAIGITIMIGWLFYVGQDIILPIVTAIILLQILYAASATVARIPGLGQTPLWLRATLALIAVLAMLFAMTRMLVASLQNLVPSLPVYQRNLENLFAAWFPMPADESIGRPEVSELMASPSAIFDRGTEAVAKAISEFATRFFTEIDIAALAQSVLSSLTSFGGFVFITILYASFLLSEITGFPEKVRRAFGSDSDSTDTLNMITRINHDIGSYLATKTLINIILGVVCWVILLILGVEYAALWAIIIGLLNYIPYIGSFVGVAFPALFAVAQFGTLTVPLIATGLMTTAQVIIGNVVEPKMLSKSVNLSPMVVLVSLAIWSSLWGIPGAILAVPFTTILMIVLARRPGTRPIAALLSSDGNI
>NZ_CP022548.1|WP_164089109.1|2041639_2042920_-|MFS-transporter
MATTAQTGHSPRKFYGWTNVGLFFFIQFAASGFVYFAYSVVFPVMVETMNWNRGSASIAQSVALITLGLSYPLTGYLLSRSGVRRTVTTGLLVMLAGLLLLVFGVTELWHWILVWGVVMGLSFGLTGPICAQTAMISWFSIKRSTTIGIVMTGGALGGAMAQPALAEMMERFDSWRAAWTIAAAMVVIALVATRFIINRPSDIGQFPDNIDPARAVSEEQAHHTRPRTYRTDHAWTMREIIRKPTLYLMMVISVGYLGTFFALLNHGVLHLTDNGLKGLEAAGIFGLLILGSGLARIPAGWLGDQFELRWTIFGSIALMALALAGFWQGQEIWLLSLMGMLFGAGYGSLLVLLPAAIGNYFGERAFPIINSLFAPVVLPFAAAAPAGAGFVFEATGSYDFAFAGAIILLAAGMLAAFCLKPPATPV
>NZ_CP022548.1|WP_100093884.1|2043217_2043646_-|hypothetical-protein
MTIFKFDKHGFLWEPNLHDRWVSRLILNSEQCIEIDFTSSHKSSAVCLSFVDVDDFQSVIRGPRIFTELFVSGNGTGTENDEISIMESLVPKEFGKQIIDSYKKRENSEKQKTFLVLAMMDGYVSFWFTEMFFDDSSPTTLN
>NZ_CP022548.1|WP_100093885.1|2043827_2044442_+|DUF2585-domain-containing-protein
MIKWPLRISKTSALIAFILFAGFALILFGMGRPPICSCGTVKLWQGVVQSSENSQHLADWYSMSHIIHGFVFFGLGHLLRKRLPKLFPLGVILALSILVEGAWEVLENSPVIIDRYREATISYGYEGDSIINSMADIAWMIIGFFLASRLPWKATLAIAVIFELFTGYMIRDNLALNILMLTVPNEAVKDWQAAGTGYWLTGKT
>NZ_CP022548.1|WP_100093886.1|2044424_2044718_-|hypothetical-protein
MSLIRNIFTAAVGYEARKHTRGHGLRNFGLGMLAARLATRSVPGALLVGGALIAKKLYDDKKEAEALPASEAVIDIEGRPVPVDSETTADPALRLPG
>NZ_CP022548.1|WP_100093887.1|2044733_2046128_-|class-II-fumarate-hydratase
MSGTRTETDSLGEIEVPADAYWGAQTQRSIENFPFPRQERMPIRLIHALAAVKQAAARVNGIHGLEPEIAAAIEKAANAVRTGEYDNQFPLTIWQTGSGTQSNMNVNEVIAGVANEAIYGTRGGKYPVHPNDHVNRGQSSNDSFPTAMHVAAARALEVELFPALEQLHDALAEKAQKWKSIVKIGRTHLQDATPLTLGQEFSGYAAQLVAARDRIESVLPRLLQLAQGGTAVGTGLNAPENFGENIAKEISKITGLKFTSAPNKFAELAAHDTMVELSGALNTLAVSLTKIANDIRLLGSGPRSGLGELDLPANEPGSSIMPGKVNPTQCEMLTMVAAQVIGNHQAVTVGGLQGHLELNVFKPLIGANVLRSIEIISIGMSSFSERCVEGLEANEARIKELVDNSLMLVTALAPVIGYDKAAAIAKYAHKTGQTLRASALELGLVDAETYDTHVRPENMVGNHS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022548_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022548_2

2924474-2924587

Orphan

Consensus_repeat	Method
CCGTTCGTCCTGAGCTTGTCGAAGGACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022548_2

>merge|NZ_CP022548|2|2924474-2924587|CRISPRCasFinder
CCGTTCGTCCTGAGCTTGTCGAAGGACCGTCGCGACCGGGAGTCGTGGTTCGACAGGTTCACCATGAACGGAATTCTCGCCGCCCTCCGTTCGTCCTGAGCCTGTCGAAGGACC

>NZ_CP022548|2|2|2924474-2924587|CRISPRCasFinder
CCGTTCGTCCTGAGCTTGTCGAAGGACC	GTCGCGACCGGGAGTCGTGGTTCGACAGGTTCACCATGAACGGAATTCTCGCCGCCCT
CCGTTCGTCCTGAGCCTGTCGAAGGACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022548.1\|WP_100094583.1\|2930740_2931421_-\|spermidine-synthase	unknown	unknown	gnl\|CDD\|223498
NZ_CP022548.1\|WP_100094584.1\|2931421_2932201_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022548.1\|WP_100094572.1\|2917783_2919448_+\|DNA-repair-protein-RecN	unknown	unknown	gnl\|CDD\|223571
NZ_CP022548.1\|WP_100094574.1\|2919931_2922244_+\|DNA-ligase-(NAD(+))-LigA	unknown	unknown	gnl\|CDD\|236137
NZ_CP022548.1\|WP_164089232.1\|2922651_2923509_-\|sterol-desaturase-family-protein	unknown	unknown	gnl\|CDD\|225546
NZ_CP022548.1\|WP_100094576.1\|2923597_2924263_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP022548.1\|WP_100094578.1\|2924618_2925320_-\|TIGR02117-family-protein	unknown	unknown	gnl\|CDD\|378218
NZ_CP022548.1\|WP_100094582.1\|2929365_2930733_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|379065
NZ_CP022548.1\|WP_100094587.1\|2933557_2933947_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	unknown	unknown	gnl\|CDD\|239575
NZ_CP022548.1\|WP_100094580.1\|2926330_2927326_-\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|234786
NZ_CP022548.1\|WP_100094586.1\|2933128_2933542_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|239579
NZ_CP022548.1\|WP_100094573.1\|2919447_2919942_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|170047
NZ_CP022548.1\|WP_100094579.1\|2925349_2926246_+\|phenylalanine-4-monooxygenase	unknown	unknown	gnl\|CDD\|237020
NZ_CP022548.1\|WP_100094570.1\|2914467_2916747_+\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|236995
NZ_CP022548.1\|WP_100095658.1\|2912299_2913010_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP022548.1\|WP_100094571.1\|2916940_2917726_+\|outer-membrane-protein-assembly-factor-BamD	unknown	unknown	gnl\|CDD\|274513
NZ_CP022548.1\|WP_100094581.1\|2927341_2929222_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP022548.1\|WP_100094569.1\|2912991_2913999_+\|tRNA-pseudouridine(55)-synthase-TruB	unknown	unknown	gnl\|CDD\|235442
NZ_CP022548.1\|WP_100094585.1\|2932213_2932927_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP022548.1\|WP_067200048.1\|2914023_2914293_+\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170

Protein	Function_ID	Function_description	E-value
NZ_CP022548.1\|WP_100094583.1\|2930740_2931421_-\|spermidine-synthase	gnl\|CDD\|223498	COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism].	9.26775e-25
NZ_CP022548.1\|WP_100094572.1\|2917783_2919448_+\|DNA-repair-protein-RecN	gnl\|CDD\|223571	COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair].	0
NZ_CP022548.1\|WP_100094574.1\|2919931_2922244_+\|DNA-ligase-(NAD(+))-LigA	gnl\|CDD\|236137	PRK07956, ligA, NAD-dependent DNA ligase LigA; Validated.	0
NZ_CP022548.1\|WP_164089232.1\|2922651_2923509_-\|sterol-desaturase-family-protein	gnl\|CDD\|225546	COG3000, ERG3, Sterol desaturase [Lipid metabolism].	6.24937e-19
NZ_CP022548.1\|WP_100094576.1\|2923597_2924263_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	2.34725e-37
NZ_CP022548.1\|WP_100094578.1\|2924618_2925320_-\|TIGR02117-family-protein	gnl\|CDD\|378218	pfam09601, DUF2459, Protein of unknown function (DUF2459). This conserved hypothetical protein of unknown function is found in several Proteobacteria. Its function is unknown and its genome context is not well-conserved. It is found amid urease genes in at least one species.	1.54065e-50
NZ_CP022548.1\|WP_100094582.1\|2929365_2930733_+\|MgtC/SapB-family-protein	gnl\|CDD\|379065	pfam13194, DUF4010, Domain of unknown function (DUF4010). This is a family of putative membrane proteins found in archaea and bacteria. It is sometimes found C terminal to pfam02308.	2.41018e-40
NZ_CP022548.1\|WP_100094587.1\|2933557_2933947_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	gnl\|CDD\|239575	cd03495, SQR_TypeC_SdhD_like, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E. coli SdhD subunit. One characterized protein is the respiratory Complex II SdhD subunit of the only eukaryotic member, Reclinomonas americana. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. It is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. E. coli SQR is classified as Type C SQRs because it contains two transmembrane subunits and one heme group. The SdhD and SdhC subunits are membrane anchor subunits containing heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	6.21404e-31
NZ_CP022548.1\|WP_100094580.1\|2926330_2927326_-\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|234786	PRK00517, prmA, 50S ribosomal protein L11 methyltransferase.	2.54152e-66
NZ_CP022548.1\|WP_100094586.1\|2933128_2933542_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|239579	cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	6.61978e-33
NZ_CP022548.1\|WP_100094573.1\|2919447_2919942_+\|hypothetical-protein	gnl\|CDD\|170047	PRK09687, PRK09687, putative lyase; Provisional.	4.30249e-21
NZ_CP022548.1\|WP_100094579.1\|2925349_2926246_+\|phenylalanine-4-monooxygenase	gnl\|CDD\|237020	PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed.	2.21731e-150
NZ_CP022548.1\|WP_100094570.1\|2914467_2916747_+\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|236995	PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional.	0
NZ_CP022548.1\|WP_100095658.1\|2912299_2913010_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.08181e-25
NZ_CP022548.1\|WP_100094571.1\|2916940_2917726_+\|outer-membrane-protein-assembly-factor-BamD	gnl\|CDD\|274513	TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). [Protein fate, Protein and peptide secretion and trafficking].	2.651e-99
NZ_CP022548.1\|WP_100094581.1\|2927341_2929222_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP022548.1\|WP_100094569.1\|2912991_2913999_+\|tRNA-pseudouridine(55)-synthase-TruB	gnl\|CDD\|235442	PRK05389, truB, tRNA pseudouridine synthase B; Provisional.	6.69688e-112
NZ_CP022548.1\|WP_100094585.1\|2932213_2932927_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.46421e-49
NZ_CP022548.1\|WP_067200048.1\|2914023_2914293_+\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	4.05208e-52

>NZ_CP022548.1|WP_100094576.1|2923597_2924263_+|Crp/Fnr-family-transcriptional-regulator
MNAPAPVAGTGFVQGLPERIRLDLLARGQERAFARGQIIQQRGDEAKEFWYIESGSVQVGRYGLDGRLTLFALLGAGETFGELAFMGEFPRTVDAIAGSDCRLIRIGKSEFRSLMDADPAVTGLLLKTMALTVQDAFDLVEFSRSLSVPQRLALALSQLCGDQGNGARLTVTQQELADLVGVSRVSLGKALTRLQGGGLIEPGYGFVTIKDGAGLRDLAGG
>NZ_CP022548.1|WP_164089232.1|2922651_2923509_-|sterol-desaturase-family-protein
MMRPELLAITGIFLVFGLLEFFRTRLFSKPDQTRDDALVEIIGSFVLLVITQPGIILAAQFILGNVAPQWQGALAGIPLIAAIALFLVFDDMMQYFWHRLSHSVPFLYNLHRSHHNARYMSVRLVYRNNIFYYLTMPSIWFSGALIYLGLGWVYVGYIIVKMAVIVGAHSDVAWDAPLYKIKWLSPVMWLVERTISTPATHHAHHGRHKSDGVTHYKGNFGNLLFFWDVLFGTAHITRRYPESYGVENLAPATLGQQLAWPIFPENKEGGHGVKELAAVEATAKV
>NZ_CP022548.1|WP_100094574.1|2919931_2922244_+|DNA-ligase-(NAD(+))-LigA
MTTKPISEADAANELMRLARKIAHHNKLYHAEDTPEISDADYDALVRRNNELEEAFPHLVRDDSPNKLVGAAVAASPLSKVKHEQRMMSLDNGFSDEDIAEWLARVRRFLNLDEGAPVAVTAEDKIDGLSCSLRYEKGELVLAATRGDGQVGEDVTANVRMIADIPERLYPREGGDPSPEGAAEARAGDGLLPSQEHSSPPVPDLFEIRGEVYMAKADFAGLNERLMDEGRADAEAKGVDFDPEKIRQFANPRNAAAGSLRQKDASVTAKRPLKFWAHGWGVHSEVPGETALDVMKALESWGVPVSPLVKRFETLDDMLSHYRHIEAERADLPYDIDGVVYKVDRLDWQQRLGFVAKAPRWALAHKFPAEQAQTTLESIDIQVGRTGKLTPVGRLKPVTVGGVVVSNVTLHNRDEVERLGVRPGDRVVIQRAGDVIPQVVENLTRDAKREPYHFPDHCPECGSEAVAEEGEVDVRCTGGLICPAQRFQRLVHFVSRVALDIDGLGEKSIAEFIEAGWLESPADIFRLRDHRAEILAREGWQDKSVDNLLAAVEKNRQPDAARLLFGLGIRHIGTVTAKDLLKNFRTLPKLREVAEAAQESEKYRSSRAQSRDGEGADAGVSTSLDTNGEAASETTGTEAGDAAWADITSIDGVGPTVAQALADFFHEPHNVAVWEDLLNEVSPPDYIVETRDSAVAGKTVVFTGKLETMSRDEAKAQAEALGAKASGSVSAKTDLVVAGPGAGSKAKKAAELGIEVIDEAAWAEIVAAAG
>NZ_CP022548.1|WP_100094573.1|2919447_2919942_+|hypothetical-protein
MTTTQGPRDKKNIILLLQSRDPDDFSETALCEWMDHDDAEVRDWATFTLGVQTEKDSEAIRQALLLRACDSDFDTVSEALLGLARRRDRRAIPILLDRLCSDNVGELDVQAAGILADKLFVAPLQSLLDWWDEDTGLLERALKQCCGESAEDGSLDDWVTANDD
>NZ_CP022548.1|WP_100094572.1|2917783_2919448_+|DNA-repair-protein-RecN
MLQSLSIRDIVLIEALDLEFGSGLTVLTGETGAGKSILLDSLGLALGNRADSGLVRQGTEKAQVTASFEPPAAGSRLAATLAENDIDIEPGEPLIIKRSVKADGGSRAFINDQPCSAALLRAVGGQLIEIHGQHDGRGLINPKGHRALLDIFAGVEGVAVREAFDDWQAAKSALEQAKQEQEAAENDRDYLEHSVAELSKFAPQPGEEQELALERATMMKGEKLTGDLEAIRAAFDGSNGGLASLRSAARRLDMIAEDHALLKEALESLDRAIIDATDAEDKLNAAADALSFDPQRLDDMETRLFDLRGLARKHRVEPDKLSDLLQDLQKRLAAISDGGRTLEDLEVSLAGARKSYIAAAESLRAKRSKAAKALDKAVAGELAPLKLDAARFETLLEEMPEDHWNKSGMDRIEFLISTNPGAPLAPLGKIASGGELSRFILALKVALAEEYGLKTIIFDEVDRGVGGAVASAIGDRLSRLSRGAQLLVVTHSPQVASKGDAHMLINKSRSGTVSRTDVSALDNEGRRQEIARMLSGADVTDEARAQADRLLEGV
>NZ_CP022548.1|WP_100094571.1|2916940_2917726_+|outer-membrane-protein-assembly-factor-BamD
MTKHIFKWAVIGLSATALSGCAMFGGSGGGRGTDTRYVARDVDTLYNAAKSRLDRGEYKIAAALFDEVERQHPYSPWARRAQQMSAFSYYLSGDYSKATESARRFLSIHPGNKDAPYAYYLIALCYYEQIGDVTRDQKITEQALATLGEVARRYPNSRYAADAKLKIDLVNDHLAGKEMEIGRFYQRRGKWLAATIRFRTVIEKYETTTHAPEALMRLTESYLALGVPVEAKKTAAVLGANYPGSKWYERAYELVNKHGAT
>NZ_CP022548.1|WP_100094570.1|2914467_2916747_+|polyribonucleotide-nucleotidyltransferase
MFDVKKVEMEWGGQTLTLETGRIARQADGAVLATLGETVVLCAVTAAKSVREGQDFFPLTVHYQEKFSAAGRIPGGFFKREGRATEKETLTSRLIDRPCRPLFPEGFYNEINVICQVMSYDGVNEPDILAMVAASAALTISGVPFMGPIGAARVGYKEGEYQLNPSMEEVAEGELDLVVAATHGAVMMVESEAQELSEEVMLGAVQFAHEASKQVAGLIIDLAEQAAKEPWKLDAGDDNSEIKEDLRKLVGKDIAAAYKKTDKSERSDALNAVREKAKEKYADADGQTQMTAGKMVKKLEAEIVRGAIIKDGTRIDGRKLDQVRPIEAMVGLLPRTHGSALFTRGETQAIVTTTLGTKDAEQMIDGLDGLSYTNFMLHYNFPPYSVGEVGRFGFTSRRETGHGKLAFRALRPVLPTVEEFPYTIRVLSDITESNGSSSMATVCGGSLAMMDAGVPLARPVSGIAMGLILEGEEFAVLSDILGDEDHLGDMDFKVAGTEKGITSLQMDIKVAGITQEIMKSALEQASGGRAHILGEMSKALSSVRTEMSEHAPRIETLQINKEKIRDVIGTGGKVIREIVAETGAKVDIDDEGLIKVSSSDKSQIDAAIAWIKGIVEEAEVGKVYDGKVVNLVDFGAFVNFMGGKDGLVHVSEIKNERVEKVSDELSEGQEVKVKVLEIDQRGKVRLSMRVVDQETGEELEDTRPPRESKPRGPRRDGGGGRGRDGGGRGRDGGGRGRNNDGPKNEGGGDIPLPSSITED
>NZ_CP022548.1|WP_067200048.1|2914023_2914293_+|30S-ribosomal-protein-S15
MTITAEKKQELIQKFGQTKGDTGSPEVQVAVLTERIVNLTEHFKGHHKDNHSRRGLLMMVNKRRSLLDYLRKKDVERYAKLIKDLGLRK
>NZ_CP022548.1|WP_100094569.1|2912991_2913999_+|tRNA-pseudouridine(55)-synthase-TruB
MGEAGVRPHGWIILDKPLELGSTQAVGAVKRNLREAGLLGKGKNKLKVGHGGTLDPLATGVLPIALGEATKLCGRMLDASKIYEFTIGFGTETETLDVEGAVTETSGHRPTLAEVEAILPQFSGAIEQIPPKYSALKIDGQRAYDLARAGVDVEMKLRGVTIYALGIRGVDSSIRHPELVSGSPEVLKQVQDDEPLTEITLTANVSKGTYIRSLARDIARALGTFGHVTMLRRTKAGPFTLKQAISLDKLNEIGKGADIKEYLLPLEAGLDDIPAFDLDPDQARMLRQGLTLDEQDLIGNPAVNGLFLATENEGSPVALAEIVDGTVKVVRGFNM
>NZ_CP022548.1|WP_100095658.1|2912299_2913010_+|class-I-SAM-dependent-methyltransferase
MTGDINGWARSAEAWIASIGEAGDWTRRTLLDQVMLERVARHSGTALDIGCGEGRFVRMLKEQGWSAVGIDPVERLIAEAGKHDPDGDYKIGFGEDLAFEDESFDLVVSYLSLIDIEDFRVAIREMTRVTKPGGSLLIANLTGYFTAGKWVRGLDGQHKRFVIDNYHQERASREQWLGIDILNWHRPLSAYLQEFLANGLILRHFDEPTPPDQNDPKSDRYSRVPGFVVMEWEKPA
>NZ_CP022548.1|WP_100094578.1|2924618_2925320_-|TIGR02117-family-protein
MATTALKWLKRMVVASGAILCAYLLAALAGSLLPANQHWQSPEDGIELFIETNGLHSGIVMPIWSDVHDWTPLVRPEHLADPSYYGSHILVGWGHEGVYRNTRQWRDLRANDAISAIFGSDDVLVHVYHLKYPQAYPYYRRPLKVSEAEYRKIASAIEARFALDDQYRSQPSPGYGQDDLFYQANGHYSAFYTCNNWTSDILQQAGIRTGRWTPFQGGVMRWVPGNSRVNRSH
>NZ_CP022548.1|WP_100094579.1|2925349_2926246_+|phenylalanine-4-monooxygenase
MLDTPETETHVYDKPPAHANADWTIDQDWQRYSAEDHETWDILFARQQKMLPGRAAQAFLDGIDILKLSRPGIPDFEELNRILMDATGWQVVAVPGLVPDDVFFDHLANRRFVSGNFIRRRDQLDYLQEPDIFHDVFGHVPMLADKRFGDYMAAYGRGGLRALKFGTLKQLARLYWYTVEFGLIQEAEGLRIYGAGIVSSYGESVFALDDPSPNRILFDLERVLRTEYRIDDYQQNYFVIPSLDELLRVTVETDFKPLYDKIAGLPDIRIAEIVEGDVVLTEGTQDYARSQAGEATVV
>NZ_CP022548.1|WP_100094580.1|2926330_2927326_-|50S-ribosomal-protein-L11-methyltransferase
MDSPLSGTWKVSIPCTRAEARTLAADNLFISSSDSTPTIVASEVDAKRPDEWMIDVYCEEMPDPEMVENLLQLSPSAEAAGFQPIVTQLGDEDWVTLSQQGLEPLRAGRFHVHTSSDQPSGNPKLTNICIDAGQAFGTGHHETTMGCLQSLDRLKKTGHRFRNIADVGTGTGLLAFAAHHLWRDAKIIASDIDPVAVTVTGENARLNDIPLGNGRSQIRLVQSNGLDHPALRQRAPFDLIIANILAGPLVALAPQIAAASGAGTVLLLAGLLSRQKAEVVRAYIREGFRLKHSRLENEWPCLTLVKAKKYGWTRKPHRKKSPLASDYFGEC
>NZ_CP022548.1|WP_100094581.1|2927341_2929222_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MLNFNNITVRLGGTVILDGATAALPPGARVGMIGRNGAGKSTLMKVIAGMLEPDDGSVDMPKDARMGYIAQEAPAGQDSPLDTVLAADTERAALLEESETATDPHRIGEIHERMNMIDAHSAPARAAKILIGLGFDEAAQQQPMDSFSGGWRMRVALAALLFSQPELLLLDEPSNHLDLEATMWLENFLTSYQATILVISHERDLLNNVVDHILHLQHGTTTLYPGGYDAFEKQRAERQAQQASAREKQIAQREKLESFVSRWGAKAHSAKQAQSRVKALARMEPIAAAIDDPSLSFHFPSPAELKPPLITLDDAAVGYGDNIILSGLNMRLDPDDRTALLGRNGNGKTTLARLLASQLEPKKGAINKSGKLTVGYFTQYQVEELDTSDTPLEHMTRLMKDAKPGAVRAQLGRFGFSGDKATIKVGKLSGGERARLALAMITRDAPHLLILDEPTNHLDVDAREALVHALNEYSGAVILVSHDRHMLELTADRLVMVDSGKAEEFAGTLKDYTDFVLGKNQPGSSGGKSGSGNRKEERRAAAERRKQQGELRKTVSAAEKEMKVLAEEISAIDRAMFDPASAAAKHADLSMTELMKLRAEHQDRLDKAEARWMEASDRLEQENVNA
>NZ_CP022548.1|WP_100094582.1|2929365_2930733_+|MgtC/SapB-family-protein
MPGRLSLRLDDDDKIRISPRDDALAMLTEFSGEWLIYRDLAIALAAGLLIGVERGWTMRDENKGARVAGIRTFGLIAGLGGLVALISQSLNLVIAAILLTGVVAMLSISHFKTIHEPDGRSITNFVVSLLTLCLGLVAGSGYPALAMAGAAIVTGLLSMRSELHGLMRRLGPTDINVMIRFALIALAVLPFLPDRDFGPYEAFNLQQLWFVVILVTGLSFAGYVANRIFGAAHGTVVTAVIGGAYSSTAVTASLAQRLRGEETAGRTLSAGIALASSVMYIRVLLLTFLLARFAFVPLAMILAPAALVAAIIGLLLLRRSGAARSDESVETRNPIRLLPAFFFALTVAAMSLAARWAEAKYGSSGIAYLVLIVGSFDVDAAIITLGALPEETIMSDLAGFVLAMTVLANMLFKTGVAGFTAGWKKGRAAVAALAASSLVLAIAGLVSFVAFDIRF
>NZ_CP022548.1|WP_100094583.1|2930740_2931421_-|spermidine-synthase
MIAREHLDTAPIPGGDELRLFRRALKGADEYSIMLGRIELMNSRLSGSEEALATLACERLAVKNPRILIGGYGMGFTLRAALSVLPPQAHVEVAELIPAIVQWARGPMADLSQKCLEDSRVTVTIGDVANVIGKAERDYDAILLDVDNGPDGLTHDANDRLYSMAGLATAKKALRSNGILAVWSSEGDNRFTARLKKSGFAVEVKTVSARSNGKGAKHTIWLAANR
>NZ_CP022548.1|WP_100094584.1|2931421_2932201_-|hypothetical-protein
MTEETTKKKPNWLVWLFAAFGLAGVAAVIFIAIMIANIGGGGREERAPLAVADGETKYSMGQVIDLRGNDLSALTIISGDRNAGCGSFSSKSYRENITHNLIFFDRNTRKSRKLLNDNRGKVIAAVFLPDQETGFPLAIGDGMNDATNVAEAAAQAAMEAAGIVGAEERDQFKRRMPLKNYMAIVALQDGETMKNSLLLGRLSDGKQVMTLDGVETVRRFWILSPTEVGMIVQRNGEIFHHIANFESLSITQSTKIEVN
>NZ_CP022548.1|WP_100094585.1|2932213_2932927_-|SDR-family-oxidoreductase
MSNKKTHILVTGASRGIGEAIVDSLGMDNVTVIGQSTAGGDDLIAADFTQDGSAPLLWQQALDRLDGRIDVLVNNAGLFQPNPLAADDWLESWNRTMTINLTASAELCRFAVLHFQQRGEPGRIVNIASRAAYRGDSPDHWHYAASKGGMVAMTKTIARAYAKDGILAFAICPGFTMTGMAEDYLESRGGDKLLADIPLGRVALPEEIASIARYCALDAPPSMTGAVLDANGASYVR
>NZ_CP022548.1|WP_100094586.1|2933128_2933542_+|succinate-dehydrogenase,-cytochrome-b556-subunit
MSGVSGSASNRPLSPHLQVYKWGPHMLVSILHRATGDAMALVGVPLLVWWLYAIAAGPESYDYFLSWFNWGYIGYIVLVGMSFAFFEHMYSGLRHFVLDAGAGYELQTNKMWSVAVPLAAIITTGAMWLYIASKNIL
>NZ_CP022548.1|WP_100094587.1|2933557_2933947_+|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein
MGSGTNIGRVRGLGSAQEGAHHWIVQRVTAVSNLLLVLWLVFSLVRLPQYGHELMVEWMSSPLVAVPMMLMLVSIFWHLRLGLQVLIEDYVPDHGVKFGLIVLLNFFAIGGAALGIFSVAKIAFTGVVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8013 : 64224

Bacillus_phage(16.67%)

transposase,integrase

attL 19735:19750|attR 66948:66963

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100092211.1\|8013_9006_-\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	5.0e-18	26.1
WP_100092212.1\|9002_9935_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_100095342.1\|9931_10870_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VF00	Mycobacterium_phage	2.5e-11	27.7
WP_100092213.1\|10929_11718_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	7.7e-30	35.5
WP_103143265.1\|12086_12284_+	hypothetical protein	NA	NA	NA	NA
WP_103143266.1\|12284_13274_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_100092214.1\|14153_14795_+	hypothetical protein	NA	NA	NA	NA
WP_123906193.1\|14858_16343_+	hypothetical protein	NA	NA	NA	NA
WP_123906194.1\|16547_17144_+	sce7726 family protein	NA	NA	NA	NA
WP_164088925.1\|17100_18186_-	hypothetical protein	A0A0U2S621	Escherichia_phage	5.1e-32	26.5
WP_100092218.1\|18196_19465_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_100092219.1\|19461_19929_-	hypothetical protein	NA	NA	NA	NA
19735:19750	attL	NA	NA	NA	NA
WP_100092220.1\|20008_20806_-	TIGR02391 family protein	NA	NA	NA	NA
WP_100092221.1\|20802_21762_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_100092222.1\|21793_22474_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_100092223.1\|22470_22863_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_100092224.1\|22924_24178_-\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_100092225.1\|24936_25122_-	hypothetical protein	NA	NA	NA	NA
WP_100092227.1\|26925_27378_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_100092228.1\|27494_27920_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.9e-14	33.9
WP_100092229.1\|28097_28985_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_100092230.1\|28981_29404_+	hotdog fold thioesterase	NA	NA	NA	NA
WP_100092231.1\|29413_30871_-	TolC family protein	NA	NA	NA	NA
WP_100092232.1\|30878_32450_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_100092233.1\|32446_33574_-	HlyD family secretion protein	NA	NA	NA	NA
WP_164088927.1\|36706_36880_-	hypothetical protein	NA	NA	NA	NA
WP_100092235.1\|36950_37277_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_100092236.1\|37307_38570_-	cytochrome P450	NA	NA	NA	NA
WP_100092237.1\|38752_39493_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_100092238.1\|39548_40691_+	nitronate monooxygenase	NA	NA	NA	NA
WP_100092239.1\|40786_41491_+	hypothetical protein	NA	NA	NA	NA
WP_100092240.1\|41487_42678_+	transporter	NA	NA	NA	NA
WP_100092241.1\|42674_43151_+	hypothetical protein	NA	NA	NA	NA
WP_100092242.1\|43158_44409_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_100092243.1\|44408_45500_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_100092244.1\|45562_47176_+	acyl-CoA synthetase	NA	NA	NA	NA
WP_100092245.1\|47172_48777_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_100092246.1\|48806_49790_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_100092247.1\|50228_50993_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.1e-44	40.0
WP_123906195.1\|50989_52477_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_100092249.1\|52963_55915_+	TonB-dependent receptor	NA	NA	NA	NA
WP_100092250.1\|58421_61151_-	TonB-dependent receptor	NA	NA	NA	NA
WP_123906195.1\|62736_64224_+\|transposase	IS21 family transposase	NA	NA	NA	NA
66948:66963	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1449445 : 1474624

Wolbachia_phage(50.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100093398.1\|1449445_1450846_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	7.7e-65	33.4
WP_100093399.1\|1451169_1454277_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_164089020.1\|1454281_1455361_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_100092283.1\|1455450_1456491_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_100093402.1\|1456754_1457156_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_100093403.1\|1457152_1458037_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_100093404.1\|1458134_1458608_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_123906267.1\|1458758_1459601_-	hypothetical protein	NA	NA	NA	NA
WP_100093406.1\|1459881_1462260_-	TonB-dependent receptor	NA	NA	NA	NA
WP_100093407.1\|1462154_1463066_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_123906268.1\|1463358_1463832_+	hypothetical protein	NA	NA	NA	NA
WP_100093409.1\|1463904_1464366_-	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_100093410.1\|1464395_1466006_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0SI18	Klosneuvirus	6.6e-52	31.5
WP_089132075.1\|1466016_1466340_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_100093411.1\|1466356_1467622_-	cytochrome P450	NA	NA	NA	NA
WP_164089022.1\|1467780_1468392_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_164089024.1\|1468497_1470741_-	EAL domain-containing protein	G3MA91	Bacillus_virus	4.0e-15	32.3
WP_100093414.1\|1471052_1471361_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164089026.1\|1471382_1472087_+\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	1.4e-19	34.3
WP_100093416.1\|1472280_1472850_+	fasciclin domain-containing protein	NA	NA	NA	NA
WP_100092283.1\|1473583_1474624_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1792506 : 1799652

Geobacillus_phage(25.0%)

portal,capsid,protease,head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100093672.1\|1792506_1793643_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	9.0e-56	37.6
WP_100093673.1\|1793857_1794166_+	hypothetical protein	NA	NA	NA	NA
WP_100095495.1\|1794180_1794624_+\|head,protease	HK97 family phage prohead protease	I6S2W2	Marinomonas_phage	5.5e-17	41.0
WP_100093674.1\|1794676_1795519_+	hypothetical protein	NA	NA	NA	NA
WP_100093675.1\|1795592_1796771_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	6.0e-79	39.2
WP_100095496.1\|1796885_1797419_+	hypothetical protein	NA	NA	NA	NA
WP_100093676.1\|1797418_1797745_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_100093677.1\|1797741_1797963_+	hypothetical protein	NA	NA	NA	NA
WP_100093678.1\|1797959_1798358_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_100093679.1\|1798642_1799050_+\|tail	phage tail protein	I3UM07	Rhodobacter_phage	3.7e-12	34.1
WP_100093680.1\|1799042_1799366_+	gene transfer agent family protein	NA	NA	NA	NA
WP_100093681.1\|1799358_1799652_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022549

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022548

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection