CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024897	Bacillus velezensis strain CN026 chromosome, complete genome	2 crisprs	csa3,DinG,casR,cas3,DEDDh,WYL	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024897_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024897_1

677924-677991

Orphan

Consensus_repeat	Method
GGCTACCCGGGGTACGGTTTTGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024897_1

>merge|NZ_CP024897|1|677924-677991|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGGCCACGGAGGCTTCGGAGGATATCCGGGATACGGTTTCGGCGG

>NZ_CP024897|1|1|677924-677991|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGG	CCACGGAGGCTTCGGA
GGATATCCGGGATACGGTTTCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024897.1\|WP_095061196.1\|665379_667392_+\|SAM-dependent-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223363
NZ_CP024897.1\|WP_017419060.1\|678354_679224_+\|aminoglycoside-6-adenylyltransferase	unknown	unknown	gnl\|CDD\|377357
NZ_CP024897.1\|WP_003155709.1\|676964_677684_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NZ_CP024897.1\|WP_095061192.1\|668735_671726_+\|type-I-restriction-endonuclease-subunit-R	unknown	unknown	gnl\|CDD\|223683
NZ_CP024897.1\|WP_007408934.1\|679589_679853_+\|spore-coat-protein-CotJB	unknown	unknown	gnl\|CDD\|378904
NZ_CP024897.1\|WP_007408938.1\|682614_682977_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP024897.1\|WP_100262122.1\|674797_676666_-\|ribonuclease-YeeF-family-protein	unknown	unknown	gnl\|CDD\|227731
NZ_CP024897.1\|WP_014417142.1\|683137_684004_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP024897.1\|WP_003155696.1\|682203_682530_-\|heme-degrading-oxygenase-HmoA	unknown	unknown	gnl\|CDD\|225209
NZ_CP024897.1\|WP_003155704.1\|679357_679606_+\|spore-coat-associated-protein-CotJA	unknown	unknown	gnl\|CDD\|378536
NZ_CP024897.1\|WP_017419063.1\|681481_682171_+\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP024897.1\|WP_095061184.1\|680525_681059_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235142
NZ_CP024897.1\|WP_095061194.1\|667388_668720_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341148
NZ_CP024897.1\|WP_100261632.1\|671815_672454_+\|DUF1643-domain-containing-protein	unknown	unknown	gnl\|CDD\|377919
NZ_CP024897.1\|WP_003155700.1\|679867_680437_+\|spore-coat-protein-CotJC	unknown	unknown	gnl\|CDD\|252986
NZ_CP024897.1\|WP_100261634.1\|673894_674371_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP024897.1\|WP_014417133.1\|674568_674775_-\|bacteriocin-immunity-protein	unknown	unknown	gnl\|CDD\|319897
NZ_CP024897.1\|WP_017419062.1\|681089_681368_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372929
NZ_CP024897.1\|WP_100261633.1\|673032_673239_-\|bacteriocin-immunity-protein	unknown	unknown	gnl\|CDD\|319897
NZ_CP024897.1\|WP_014417131.1\|673559_673811_-\|DUF600-family-protein	unknown	unknown	gnl\|CDD\|377394

Protein	Function_ID	Function_description	E-value
NZ_CP024897.1\|WP_095061196.1\|665379_667392_+\|SAM-dependent-DNA-methyltransferase	gnl\|CDD\|223363	COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms].	6.85439e-68
NZ_CP024897.1\|WP_017419060.1\|678354_679224_+\|aminoglycoside-6-adenylyltransferase	gnl\|CDD\|377357	pfam04439, Adenyl_transf, Streptomycin adenylyltransferase. Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.	1.1599e-147
NZ_CP024897.1\|WP_003155709.1\|676964_677684_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	5.42044e-137
NZ_CP024897.1\|WP_095061192.1\|668735_671726_+\|type-I-restriction-endonuclease-subunit-R	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	1.00497e-88
NZ_CP024897.1\|WP_007408934.1\|679589_679853_+\|spore-coat-protein-CotJB	gnl\|CDD\|378904	pfam12652, CotJB, CotJB protein. CotJ is a sigma E-controlled operon involved in the spore coat of Bacillus subtilis. This protein has been identified as a spore coat protein.	2.72958e-30
NZ_CP024897.1\|WP_007408938.1\|682614_682977_-\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.20004e-35
NZ_CP024897.1\|WP_100262122.1\|674797_676666_-\|ribonuclease-YeeF-family-protein	gnl\|CDD\|227731	COG5444, COG5444, Uncharacterized conserved protein [Function unknown].	2.88756e-81
NZ_CP024897.1\|WP_014417142.1\|683137_684004_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	6.84253e-36
NZ_CP024897.1\|WP_003155696.1\|682203_682530_-\|heme-degrading-oxygenase-HmoA	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.45762e-20
NZ_CP024897.1\|WP_003155704.1\|679357_679606_+\|spore-coat-associated-protein-CotJA	gnl\|CDD\|378536	pfam11007, CotJA, Spore coat associated protein JA (CotJA). CotJA is part of the CotJ operon which contains CotJA and CotJC. The operon encodes spore coat proteins. Interaction of CotJA with CotJC is required for the assembly of both CotJA and CotJC into the spore coat.	6.06894e-07
NZ_CP024897.1\|WP_017419063.1\|681481_682171_+\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	3.31508e-65
NZ_CP024897.1\|WP_095061184.1\|680525_681059_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|235142	PRK03624, PRK03624, putative acetyltransferase; Provisional.	5.38086e-07
NZ_CP024897.1\|WP_095061194.1\|667388_668720_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341148	cd17259, RMtype1_S_StySKI-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to TRD2-CR2's of StySKI, S.EcoAI, S.EcoJA17PI, and S.EcoJA23PI. Salmonella kaduna CDC-388 S subunit (StySKI) recognizes 5'... CGATNNNNNNNGTTA ... 3' while Escherichia coli Type-1 restriction enzyme EcoAI specificity protein (S.EcoAI), Escherichia coli UCD_JA17_pb S subunit (S.EcoJA17PI) and Escherichia coli UCD_JA23_pb S subunit (S.EcoJA23PI) recognize 5'... GAGNNNNNNNGTCA ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	1.60823e-54
NZ_CP024897.1\|WP_100261632.1\|671815_672454_+\|DUF1643-domain-containing-protein	gnl\|CDD\|377919	pfam07799, DUF1643, Protein of unknown function (DUF1643). The members of this family are all sequences found within hypothetical proteins expressed by various bacterial species. The region concerned is approximately 150 residues long.	2.64721e-09
NZ_CP024897.1\|WP_003155700.1\|679867_680437_+\|spore-coat-protein-CotJC	gnl\|CDD\|252986	pfam05067, Mn_catalase, Manganese containing catalase. Catalases are important antioxidant metalloenzymes that catalyze disproportionation of hydrogen peroxide, forming dioxygen and water. Two families of catalases are known, one having a heme cofactor, and this family that is a structurally distinct family containing non-heme manganese.	9.22523e-95
NZ_CP024897.1\|WP_100261634.1\|673894_674371_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	4.36944e-53
NZ_CP024897.1\|WP_014417133.1\|674568_674775_-\|bacteriocin-immunity-protein	gnl\|CDD\|319897	cd16363, Col_Im_like, inhibitory immunity (Im) protein of colicin (Col) deoxyribonuclease (DNase) and pyocins. This family contains inhibitory immunity (Im) proteins that bind to colicin endonucleases (DNases) or pyocins with very high affinity and specificity; this is critical for the neutralization of endogenous DNase catalytic activity and for protection against exogenous DNase bacteriocins. The DNase colicin family (ColE2, ColE7, ColE8 and ColE9) in E. coli, and pyocin family (S1, S2, S3 and AP41) in P. aeruginosa, are potent bacteriocins where the immunity proteins (Ims) protect the colicin/pyocin producing (i.e. colicinogenic) bacteria by binding and inactivating colicin nucleases. The binding affinities between cognate and non-cognate nucleases by Im proteins can vary up to 10 orders of magnitude.	2.45049e-08
NZ_CP024897.1\|WP_017419062.1\|681089_681368_+\|hypothetical-protein	gnl\|CDD\|372929	pfam14150, YesK, YesK-like protein. The YesK-like protein family includes the B. subtilis YesK protein, which is functionally uncharacterized. Its expression is regulated by the sporulation-specific sigma factor sigma-E. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length.	4.43053e-10
NZ_CP024897.1\|WP_100261633.1\|673032_673239_-\|bacteriocin-immunity-protein	gnl\|CDD\|319897	cd16363, Col_Im_like, inhibitory immunity (Im) protein of colicin (Col) deoxyribonuclease (DNase) and pyocins. This family contains inhibitory immunity (Im) proteins that bind to colicin endonucleases (DNases) or pyocins with very high affinity and specificity; this is critical for the neutralization of endogenous DNase catalytic activity and for protection against exogenous DNase bacteriocins. The DNase colicin family (ColE2, ColE7, ColE8 and ColE9) in E. coli, and pyocin family (S1, S2, S3 and AP41) in P. aeruginosa, are potent bacteriocins where the immunity proteins (Ims) protect the colicin/pyocin producing (i.e. colicinogenic) bacteria by binding and inactivating colicin nucleases. The binding affinities between cognate and non-cognate nucleases by Im proteins can vary up to 10 orders of magnitude.	2.07408e-07
NZ_CP024897.1\|WP_014417131.1\|673559_673811_-\|DUF600-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	1.28679e-16

>NZ_CP024897.1|WP_003155709.1|676964_677684_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKNIIERAIEKAKGGAEENFDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGKNGGNMGVSGSVAYMFDATAVIGVEGKTADEALELLMEADVDVRDILEEDDSVIVYAEPDQFHAVQEAFKNAGVEEFTVAELTMLAQNEVELPEDAKAQFEKLIDVLEDLEDVQQVYHNVDLGE
>NZ_CP024897.1|WP_100262122.1|674797_676666_-|ribonuclease-YeeF-family-protein
MKVFEANSLLAAAKQRAGEYKKLRGQMVNLKKAFQGMADLGDNDFSGRGANNIKAFFKDHAGVTDSWLDLIDMKIAFLTSLPGKVEDAGLSNSHVEESFLEHELTHALSKSKAIMEEQKKDMRSILGEIEDIISLDLFSTESTDQKLSSADKKRSKTIHKLGKLDHDLTKEYAETEANEQFLQADFQQLQNATGKGKSATPLHYNAKAYRESDIHKKKGEIARHSDAYLTIKNEEAKEREIKDLKKKLADGVTDPDEYLEIAKKIGYENLEPAQVQYVMQLEQAKQLEEVGETAWDIVKGIGVGLYDVGKDTITGVKDLAVGAWDFYHLSDEQKVAKTISGVLNTPSYAKIIWTNLADSWNDKMVNGDAYSRSHYITYAIGSIVGLKGSGSAVKVSSKLAKTGAAKVDNVLEAGEKAAAKHVKTGIEKGKDYINSVSRNKYEPALAGIAQDIENTHNVKNTPLLKKIIEETKESSILFTKRNIPGVATGKAIPSRGLQLQERLMYNNGKLGVIPQEVRKQLLGKEFKSFDEFRKEFWKSIANTEYANEFNKNNIARMKNGNSPIAPKKEHYGKHKSYILHHKQPIDKGGDVYNLDNLIITSPKMHQEILDPAYHFGKKGSKN
>NZ_CP024897.1|WP_014417133.1|674568_674775_-|bacteriocin-immunity-protein
MNKMSKEELVSLVKKIMNPELEDEVIGKYIDLLEENVPHPAPSDLIFWSDEEYTAEQIVEIALNYKEE
>NZ_CP024897.1|WP_100261634.1|673894_674371_-|antitoxin-YezG-family-protein
METQKMDLLCQKIVEQINEMIPAEWERVILYAEILDDSSEVFFYFNTPHSEDFIYSHNIPEHYHVSEEIYEELLFDLQDLFEELRDEFKENNQDIWTNLTLNLGISGEFSIDYNYEDVIQSPYTISQRQTIWTYKNVGIYPKSKPLKSFLEQYLNSQN
>NZ_CP024897.1|WP_014417131.1|673559_673811_-|DUF600-family-protein
MENELNALYRSIAETVNEMIPEPWEKFLFYAQVSETGGGTYFFYNSQNEPNHFKYSLEIPFEFDIDENEFDQYEMELFKLSEK
>NZ_CP024897.1|WP_100261633.1|673032_673239_-|bacteriocin-immunity-protein
MDNLTKEELISLVKEIMNPPLDDEKVSEYLALLEKNVPHLAPSDLIFWSNENYTAEQVVRIVLNYKDK
>NZ_CP024897.1|WP_100261632.1|671815_672454_+|DUF1643-domain-containing-protein
MTHYYDPNKVDISSITIDDRQYIIPGVNLRYSLSIPFKNRMEGIIVTVILMNPSEADSNISDRTVNKLIDFFYCYTHEKIQVKKLYAGNVIPIYAPNPADTSAKLKSIHGANLLNHVQKNNINTVSSMINDSDIVVLAWGKPNVKTVHNLYYYSQVYKIIEVISNTDKDIFVFNMGNTNTILTEHGDPRHAGRSATLIDLIKIDINELLGLV
>NZ_CP024897.1|WP_095061192.1|668735_671726_+|type-I-restriction-endonuclease-subunit-R
MAIDTTETGFETNIELALIANGYKKRVLEGEASSSFKQHAIDVEELFAFLEDTQEKRMRTLEISYGPTYKEQVLKRIKDQLHKQGLIECLRKGIKDRGVTLQLAYNQPPTDMNKTLNEQYGKNRFNVSRQVFYSDKHNNSLDMVLFLNGLPLVVMELKNPLTNQTVEDAMKQLKNDRDPREQLFKFNERVAVYFAVDPDEVFMTTKLDKSKTYFLPFNKGNNGGKGNPLTYGDNYRTHYLWEDILAPDSLLDIIYRFIFIKKDDIKDSNGETIGERQMLIFPRFHQLDVVRKLEADVAQKLVGQNYLIQHSAGSGKTNSISWLAHRLAKLHNEQNESIFSSVIVITDRRVLDKQLQDAVYQLEHKAGMVEPVDKNSEQLARAINSETRIIITTLQKFPFILEKVAGLKRKKYAVIIDEAHSSQGGKASTALTNVLSDKTLEAAYEEDRIAEENLVDVDEKIVEAILKSGKQDNVSFFAFTATPKPKTLEKFGTVGIDGKPEAFHQYTMRQAIEEGFILDVLENYTTYKTFWKIAKTVEDDPEVSKKQATKKLAQYVSLHPHSIAQKTEIIIEHYRNFVQRKIGGRAKAMVVTASRLHAVRYKIAFDKYIHEKGYNDLKTVVAYSGTVKDGGIDYTEPDMNSFSEKELPDKFNSDEFKVLLVAEKYQTGFDEPLLHTMYVDKPLSGIKAVQTLSRLNRTCPGKEDTFVLDFVNEPEVMKASFQPYYESTSLSEITDPNILYDMQADIEPHQVFKEDEVQRVNELEVTDGVKKSTKAQTELNAILDKGVERYKKLSEEEQFDFKQAATKFIRTYSFVLQVVTFIDLSLHKQYIYLTYLLRKLPRTTGDKDVYLADDIALEYYRNQKVFEGSIELEKTGGIELDPQKHGAGGVAEDEKVRLSSVLEKLNERFGTQFTETDFLSREQVKEDMLNDDDLRQKAKNNTKENFKFAFEKTFMNFVIDRMSSNQEFFMRILENDEFKAYIMEDMMNEVYGEVNG
>NZ_CP024897.1|WP_095061194.1|667388_668720_+|restriction-endonuclease-subunit-S
MSRELKDSGVEWIGKIPANWSVEKIKYTTYVKGRIGWQGLKSDEFTDEGPYLVTGKDFIGKNVNWESCHHISRERYHEAPPIQLKENDLLITKDGTIGKTAIVRDMPDKAILNSGIFVTRSAKYEVDFMYWMLNSQVFDKYIKFFETGSTIKHLYQETFENFSYPLPTRLEQKKISLFLNRKIKLVDEVIKNKGNMMTLLEKQCQSIITEAVTKGLNPNVKMKDSGVEWIGEIPEHWEVSKFKYLGKLVNGYPFPSNEFSSSGVRVMKINNIQNMRLDWNDESFIDESYFIKLKEFRIQKNDLVFALTRPIISTGIKAAIVDIDEPILLNQRNAYFRSGKKICSSWLYYLMLNKNFVQEFESLIDRTGQQPNISSIDIENIKLPIPPVLEQEVIINHLNHEGFKVEKTVTNLKNQIKKLKEYRQSLIYEAVTGKIDVRDMELY
>NZ_CP024897.1|WP_095061196.1|665379_667392_+|SAM-dependent-DNA-methyltransferase
MINFQDKVSFIWSIAEILRGPYKPEDYGKIILPLAVLRRFDCVLESTKEEVLEKAEQYATINDEAREPILNRVSKQNFHNTSKYDFNKLLTDSDNIADNLRDYINGFSKVARDIMEHFDFDRQIDKLDQNNLLYLTIKRFSEIDLHPEAVSNIEMGYVFEELIRRFNENAEAGDHYTPREVIRLMTHLLFLHDDASILTKPGLTQTLYDCAAGTGGMGSVAQEYLLSQNPTAHLEFFGQEINPESYAICKADLLIKGEDARNIRLGNTLSKDQFAHDSFDYLISNPPYGVDWKSYEKPIKEEHEKQGFDGRFGPGTPRTKDGQLLFLMHLISKMKPVTVENPQGSRLAIIMNGSPLFTGDAASGESEIRKYVLENDLVEGIVALPNDLFYNTGIATYIWILTNNKAPLYKGKVRLVNAVDFSKKMKKSMGSKRNEITEEQINEIVRLYGDAQPNEYVKIFENEDFGYSKITVERPLRLNFQVNEERLARVVEQKGFANLATSKKKGDAGHFEIEEGKKLQTQILYVLRTLESDTVYKNRDEFTKVLKDALKQAGITIGASVLKAILAGLSEKDETADVCMKNKTDIEPDTDLRDTENVPLKENILDYFAREVLPHVPDAWIDETKTKIGYEIPFTRQFYKYKELRNSAEIMDEIRVLEAEIAEQLKKVIG
>NZ_CP024897.1|WP_017419060.1|678354_679224_+|aminoglycoside-6-adenylyltransferase
MRSEDEMMKLILDIAMKDERIRLVTLEGSRTNKNVPRDRFQDYDISYFVTDMDSFTSDDSWLDQFGERMMMQKPEDMELFPPELGDWFSYLMLFKDHHKIDLTLIPLSQTEDYFTQSDGLAEIVLDKDDRINHKIIASDEQYHIKKPTPREFDDCCNEFWMVSTYVIKGLMRKEILFALDHMNDILRPNVLRMIAWNIGIENQFSLSVGKNYKYIQHYMNAKDWEILLNTYVGNTYESVWKALFDCQGLFRAYSKSVAVLLRYEYPEYDQQITEYTLKHYQRFQSDFSL
>NZ_CP024897.1|WP_003155704.1|679357_679606_+|spore-coat-associated-protein-CotJA
MKENQPFTPVKSYKPFHSRFDPCPPIGRKYYRTPPHLYMRFQPYHLEQFSPMEALRKGTLWKDLYDFYDNPYRGGIEYGEKD
>NZ_CP024897.1|WP_007408934.1|679589_679853_+|spore-coat-protein-CotJB
MAKKIDDEYYRLLEQIQAADFVLVELTLYLDTHPHDRLALQQFHEYSRYSRQLRKRFEPEYGPLLQFGVSQVGAQWDWGRGPWPWQV
>NZ_CP024897.1|WP_003155700.1|679867_680437_+|spore-coat-protein-CotJC
MWVYEKKLQYPVKVSTCNPMLAKFLIEQYGGADGELAAALRYLNQRYTIPDKVIGLLTDIGTEEFAHLEMIATMIYKLTKDATPEQLRDAGLSDHYVNHDSALFYHNAAGVPFTASYIQAKGDPIADLYEDIAAEEKARATYQWIIDISDDPDLNDSLRFLREREIVHSMRFREAVEILKEERDKKKIF
>NZ_CP024897.1|WP_095061184.1|680525_681059_+|GNAT-family-N-acetyltransferase
MTPFTITEEKAGAFRVTPARKDDEKEVMDLLVQAAEWLRDKGSNQWSGLLQGEDTHNMREAIAKGYVFLFRQNEELAGVVMLLPEASGWDRRLWGDEGHEESVYLHRLAIKRQFAGAGLGRTIMTWAETGVSCPGKTKIRLDCVSENKALQSFYSGMGYESKGLAPGYHLFEKKMSK
>NZ_CP024897.1|WP_017419062.1|681089_681368_+|hypothetical-protein
MGFFYLICLAAFCLNFAVSAVLRKKWPKKMWPECLLAVLGLTAFGTVVYSIFGVGGWEGMGLGLAAMFAGSGAAAGYAAEVCLRVVRSNQKQ
>NZ_CP024897.1|WP_017419063.1|681481_682171_+|DUF421-domain-containing-protein
MGHLLTVAWELVCGLGILFVILKLLGKTQFSQITPFDFISALILGELVGNAVYDKNVRIIEIIFASLLWGVLIYLIELITQKVKSTRKLLEGEPSIIIHKGKLKYDVLKKNKLDINQLQSLLRQANCFSIQEAEYAILETNGMVSVLPKFQYDTTKNGDMQIKPKQVSLPVTLIIDGEVLYENLKEAGLEEKQLNQELKKLNIKKTEDVLYAEWKPDKPLFVLPYEEKK
>NZ_CP024897.1|WP_003155696.1|682203_682530_-|heme-degrading-oxygenase-HmoA
MFVQIRKMTVKEGHADKVIERFSSEGVIEKQEGLIDVTVLEKKVRRGDEEVVVLIRWESEDHWKQWEKSEDHIAAHKANQGKPKPDYMLGTDVGMYHVRAVKTGVHEK
>NZ_CP024897.1|WP_007408938.1|682614_682977_-|VOC-family-protein
MIKKIATVAVYTDDQQKAKTFWTEKAGFETVAEHPMGPGAFWLEVAPKGAATHLVIYPKSMMKGAEHMKASIVFECEDVFAAYEQMKKNGITFLDEPKQMEWGSFVQFKDEDGHVFLLKS
>NZ_CP024897.1|WP_014417142.1|683137_684004_+|STAS-domain-containing-protein
MNKDQLLHDYIITHSAELTEKWLKLRRKLRGRFYSADQLSEEMKRLLIEQHTFTNTVIASAFLEDPAVFQHNKEKWAAQVAKSRVEQDAEVHEVVEAIGNSRTVFWEAVTRFMDEHQDIVTNEDARRWNHLVNSSFDQLMTDFTEQFQTLMIARLSSQQELISELSCPVILIADTIGTLPLIGSIDTRRARVILETVPENCVAKRITNLVIDLSGVPIVDTMVAQQLYMLSKTLFLLGIRTVFSGIRPDVAQTSIQLGLDFSEYQTYGSLEQALASMGVTCVIEEAKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP024897_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024897_2

893913-894042

Orphan

Consensus_repeat	Method
TGCTGCTGTCCGCCGGAATCCCCGCCGAACGCCTGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP024897_2

>merge|NZ_CP024897|2|893913-894042|CRISPRCasFinder
TGCTGCTGTCCGCCGGAATCCCCGCCGAACGCCTGTTTGATCAGCTCGGCAGGCTGCAATGAGCCGTTTTGTGAATGCCGGGCTTTGTCCGTGTGCTGCTGTCCGCCGGATTCCCCGCCGAACGCCTGTT

>NZ_CP024897|2|2|893913-894042|CRISPRCasFinder
TGCTGCTGTCCGCCGGAATCCCCGCCGAACGCCTGTT	TGATCAGCTCGGCAGGCTGCAATGAGCCGTTTTGTGAATGCCGGGCTTTGTCCGTG
TGCTGCTGTCCGCCGGATTCCCCGCCGAACGCCTGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024897.1\|WP_014417270.1\|885809_886577_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024897.1\|WP_003155347.1\|901513_902203_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319859
NZ_CP024897.1\|WP_014417278.1\|895012_895915_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024897.1\|WP_007408449.1\|900962_901385_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341390
NZ_CP024897.1\|WP_012117151.1\|887663_888581_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP024897.1\|WP_007408448.1\|900436_900832_+\|DUF5365-family-protein	unknown	unknown	gnl\|CDD\|375131
NZ_CP024897.1\|WP_007610275.1\|895915_896581_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|227864
NZ_CP024897.1\|WP_014720915.1\|898825_899422_+\|class-D-sortase	unknown	unknown	gnl\|CDD\|320677
NZ_CP024897.1\|WP_100261664.1\|892272_893664_+\|L-cystine-transporter	unknown	unknown	gnl\|CDD\|224736
NZ_CP024897.1\|WP_003155362.1\|894352_894892_+\|YhcN/YlaJ-family-sporulation-lipoprotein	unknown	unknown	gnl\|CDD\|131944
NZ_CP024897.1\|WP_014417271.1\|886579_886957_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639
NZ_CP024897.1\|WP_007408451.1\|902195_903734_+\|bifunctional-GNAT-family-N-acetyltransferase/carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143598
NZ_CP024897.1\|WP_053285079.1\|890194_891025_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP024897.1\|WP_072177646.1\|891041_892121_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP024897.1\|WP_014417273.1\|888573_889521_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224196
NZ_CP024897.1\|WP_014720910.1\|886946_887663_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP024897.1\|WP_014417281.1\|899418_900327_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|161659
NZ_CP024897.1\|WP_029973223.1\|896774_898829_+\|5'-nucleotidase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|236505
NZ_CP024897.1\|WP_014417269.1\|885318_885690_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024897.1\|WP_003155376.1\|889611_889812_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197

Protein	Function_ID	Function_description	E-value
NZ_CP024897.1\|WP_003155347.1\|901513_902203_+\|HAD-family-hydrolase	gnl\|CDD\|319859	cd16423, HAD_BPGM-like, uncharacterized subfamily of beta-phosphoglucomutase-like family, similar to uncharacterized Bacillus subtilis YhcW. This subfamily includes the uncharacterized Bacillus subtilis YhcW. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate, and Escherichia coli 6-phosphogluconate phosphatase YieH. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.63554e-70
NZ_CP024897.1\|WP_007408449.1\|900962_901385_+\|CBS-domain-containing-protein	gnl\|CDD\|341390	cd04622, CBS_pair_HRP1_like, CBS pair domain found in Hypoxic Response Protein 1 (HRP1) -like proteinds. Mycobacterium tuberculosis adapts to cellular stresses by upregulation of the dormancy survival regulon. Hypoxic response protein 1 (HRP1) is encoded by one of the most strongly upregulated genes in the dormancy survival regulon. HRP1 is a 'CBS-domain-only protein; however unlike other CBS containing proteins it does not appear to bind AMP. The biological function of the protein remains unclear, but is thought to contribute to the modulation of the host immune response. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	2.41554e-57
NZ_CP024897.1\|WP_012117151.1\|887663_888581_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.32797e-98
NZ_CP024897.1\|WP_007408448.1\|900436_900832_+\|DUF5365-family-protein	gnl\|CDD\|375131	pfam17326, DUF5365, Family of unknown function (DUF5365). This is a family of unknown function found in Bacillaceae.	1.5508e-44
NZ_CP024897.1\|WP_007610275.1\|895915_896581_-\|spore-coat-protein	gnl\|CDD\|227864	COG5577, COG5577, Spore coat protein [Cell envelope biogenesis, outer membrane].	1.52001e-34
NZ_CP024897.1\|WP_014720915.1\|898825_899422_+\|class-D-sortase	gnl\|CDD\|320677	cd05828, Sortase_D_1, Sortase domain found in subfamily 1 of the class D family of sortases. Class D sortases are cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). The prototypical subfamily 1 of class D sortase from Bacillus anthracis (named Ba-SrtC) covalently attaches proteins bearing a noncanonical LPNTA sorting signal, such as the BasH and BasI proteins, to the peptidoglycan of the cell wall that facilitate sporulation. BasH is exclusively anchored to the forespore cell wall envelope, while BasI is attached to the diaminopimelic acid moiety of the peptidoglycan of predivisional cells. Ba-SrtC lacks the N-terminal signal peptide and membrane anchor. The family also includes many class D sortase homologs from Gram-negative bacteria, but the functions of these enzymes are unknown.	1.2227e-55
NZ_CP024897.1\|WP_100261664.1\|892272_893664_+\|L-cystine-transporter	gnl\|CDD\|224736	COG1823, COG1823, Predicted Na+/dicarboxylate symporter [General function prediction only].	0
NZ_CP024897.1\|WP_003155362.1\|894352_894892_+\|YhcN/YlaJ-family-sporulation-lipoprotein	gnl\|CDD\|131944	TIGR02898, Uncharacterized_lipoprotein_YlaJ, sporulation lipoprotein, YhcN/YlaJ family. YhcN and YlaJ are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic 40-residue C-terminal domain that is not included in the seed alignment for this model. A portion of the low-complexity region between the lipoprotein signal sequence and the main conserved region of the protein family was also excised from the seed alignment. [Cellular processes, Sporulation and germination].	9.31894e-47
NZ_CP024897.1\|WP_014417271.1\|886579_886957_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	3.08796e-43
NZ_CP024897.1\|WP_007408451.1\|902195_903734_+\|bifunctional-GNAT-family-N-acetyltransferase/carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143598	cd07574, nitrilase_Rim1_like, Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases). Some members of this subgroup are implicated in post-translational modification, as they contain an N-terminal GCN5-related N-acetyltransferase (GNAT) protein RimI family domain. The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 12. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	1.68191e-167
NZ_CP024897.1\|WP_053285079.1\|890194_891025_+\|hypothetical-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.46322e-79
NZ_CP024897.1\|WP_003155376.1\|889611_889812_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.70654e-31
NZ_CP024897.1\|WP_014417273.1\|888573_889521_+\|ABC-transporter-permease	gnl\|CDD\|224196	COG1277, NosY, ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only].	8.22186e-17
NZ_CP024897.1\|WP_014720910.1\|886946_887663_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	6.29504e-58
NZ_CP024897.1\|WP_029973223.1\|896774_898829_+\|5'-nucleotidase-C-terminal-domain-containing-protein	gnl\|CDD\|236505	PRK09419, PRK09419, multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.	9.00904e-120
NZ_CP024897.1\|WP_072177646.1\|891041_892121_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.30728e-55
NZ_CP024897.1\|WP_014417281.1\|899418_900327_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|161659	TIGR00005, Ribosomal_large_subunit_pseudouridine_synthase_D, pseudouridine synthase, RluA family. In E. coli, RluD (SfhB) modifies uridine to pseudouridine at 23S RNA U1911, 1915, and 1917, RluC modifies 955, 2504 and 2580, and RluA modifies U746 and tRNA U32. An additional homolog from E. coli outside this family, TruC (SP\|Q46918), modifies uracil-65 in transfer RNAs to pseudouridine. [Protein synthesis, tRNA and rRNA base modification].	3.64501e-103

>NZ_CP024897.1|WP_100261664.1|892272_893664_+|L-cystine-transporter
MENLFVVLHVFIMLLLIAGLFVMQKKHVSFSKRVFTALGLGIVFGFALQLIYGPASHIVTQTADWFNIAGGGYVKLLQMIVMPLVFISILGAFTKLKLTHNIGKISGLIIGILIATTAIAAAVGIVSALSFDLKAVHIDQGSTELSRGQELQQKSEDMTAKTLPQQIVELLPGNPFLDFTGARPTSTIGVVIFAAFLGIAFLGVKRKQPEHAATFSGIVDAVYAIIMRVVTLILRLTPYGVLAIMTKTIATSDIDSIAKLGMFVIASYAALIVMFIIHLLLITFSGLNPITYVKKAFPVMVFAFTSRSSAGALPLNIKTQKSMGVPEGIANFAGSFGLSIGQNGCAGIYPAMLAMMIAPTVGQNPFEPGFIVSVIAIVAISSFGVAGVGGGATFAALLVLSALNMPVALAGLLISIEPLIDMGRTALNVSGSMTAGLLTSKMTKETDTAVYNDSSIVIEAEEA
>NZ_CP024897.1|WP_072177646.1|891041_892121_-|GGDEF-domain-containing-protein
MLKELFLNLTILITFNYLFTLLFKESLSYKEDRLMFQLLKGTVCGLLGVFLIAFGFSYSDSIIDLRNIPIIIAALYGGWVSTAAAFAIIVAGRILINFNASAIFSIAAVGVIAILSAAVLRGKKPDHKMAFVMLLFSNVIFTLTLLFLMPEQPAGALFYYWLISVLGGMLSLYIIKHEADARLLFKQYKFQANYDFLTGIFNKRKFEEVSRVLYDRASQSPSSQLALIYLDIDHFKQINDQYGHYEGDQVLKELGARLRFLLSSSDPSARIGGEEFAVLMPNCTYTKGLHLAEEIRHTIDANPILLTSGDTIPVTVSLGIAHYPTNTSDPRTLPLIADRMLYKAKTSGRNQVCSTEKKE
>NZ_CP024897.1|WP_053285079.1|890194_891025_+|hypothetical-protein
MNLRLINSLFLFILIMLLTSCHYPDGNRTITIGINESDQSIWEFVAKKAGEEGLQLSLVTFSDYAEADLALAGGDLDANAFQSVSYFQSLPPHVKKKLAPLGTTYAVSLGVYSKQHKRLKDIPDGAVIAVPDEAAAFGRALFLMQEAGLMTLKKGFTGTGSTDMIKDNPKHLTLKTETKKNAYQTAKHADAAVLSQSEAKRAGFHAEKDALIRSAQMKEAYIHLVAVRAEDKDDERMQKLLSLYQSDDTAAFIEKEYRGSLIPVFLTGGFLTEKKE
>NZ_CP024897.1|WP_003155376.1|889611_889812_-|cold-shock-protein
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQSVSFEIVEGNRGPQAANVTKA
>NZ_CP024897.1|WP_014417273.1|888573_889521_+|ABC-transporter-permease
MFKLIYNEWIKIFSRVGTWAMIVILGVSMIGFALLSNHFTSNEANPNWKQELQAENKEMKQQMKETGNQTLIDNLKQNVAINQYRMDHNIPEDTGYTVWSYVADSSMMTVLTGLFTIIIAAGIVANEFNWGTIKLLAIRPLSRFQILLSKYMTVLLFGLLMLVILFAGSALLGLVFFGTGGDTAADVHLVYKDGHVFEQNIIAFLAKTYVYESVSAFMLATMAFMLSAVFRNSSLAVGFSIFLLVMGNTATVFLAAKFEWTKYILFANTDLSQYMNGTPLVEGMTMTFSVVMLVIYFVIFLALAFGVFLKRDIAT
>NZ_CP024897.1|WP_012117151.1|887663_888581_+|ABC-transporter-ATP-binding-protein
METVLELQQVKKTIKGRTIIHDLSFSVRAGEVFGFLGPNGAGKTTTIRMMVGLMKLSQGDIVICGESITKNYAKAVRHVGAIVENPELYKFLSGYKNLQQYARMVKGVTKEKIDEVIELVGLQDRIHDKVKTYSLGMRQRLGLAQSLLHNPKVLILDEPTNGLDPAGIREIRDHLKKLTREKGMAVIVSSHLLSEMELMCDRIGILQKGELVDIQKVRDEGKEDKDTYFFHIEQREEALAVLSQFDCVKKTNGIEIKLSKQEVPDVISLLVRENIRLYEVKIMTKSLEDRFLEITGGTKEEVQYV
>NZ_CP024897.1|WP_014720910.1|886946_887663_+|ABC-transporter-ATP-binding-protein
MNLDFERVTKKYGRRLAVSDVSFSLSPGKIYGILGPNGSGKSTTLKMLAGLAFPTSGAVRIGDCAVSRNMLFRTAYLTEHDMFSARTTVGDMLTFYHSQFPDFQLEKAHNLLTEMNLSAKQKIKELSKGSRGRLKIVLALSRKASVILLDEPFSGLDPAVRESIVNSLVSYIDFGSQIVVIATHEIGEIETLLDEVMVFIKGKIAERREVEEIREQEGMSVLQWYRSVMQAHEIEGGF
>NZ_CP024897.1|WP_014417271.1|886579_886957_+|GntR-family-transcriptional-regulator
MENEFQSSKPIYLQIADRVYYRLIRSELSPGDKLPSVREMAVQMKVNPNTIQRTYSEMERLGIVETRRGQGTFIAERSDLKAELKDRLTKDVFKRFIQEMAELGLSPEEMLDGIKRYAGEANDES
>NZ_CP024897.1|WP_014417270.1|885809_886577_+|hypothetical-protein
MTSFLGLLKKDAKVSWIWLAVWLCGMICWALAAHVIAARQKEPLVIFGFFAAMGFFQFLVAPLFMYYHLHKEGKNQLWLYNPNGGFYLLASKLTASLLYQLIGQLVLTGYGIWMYRMLSAKGALEHTIPLAGTLTGLNAYLLISSAYLSVIVAVFWTVFHSLKHVPVLRWVICIVLAFVWTYIDDKIITPFTSSQHDLWPVKVYANFHFHYTKLTGWTMELKAVHISLFSFLAVIVLTALCLALASMLLNRKVEV
>NZ_CP024897.1|WP_014417269.1|885318_885690_+|hypothetical-protein
MAIIIAVIAAVIVIALLITFNVRSTSAGQDVKEEKREAIGTTAEQPEKHDPAEERSAEHAPVVVKSESPREKKNTMGDDVYRQALQKFKTSETDRETNDPDSGGKMQDSSYRDALLSLKNKKK
>NZ_CP024897.1|WP_003155362.1|894352_894892_+|YhcN/YlaJ-family-sporulation-lipoprotein
MIKKQAVISALLLPMLITAGCSMGNQGEGKRNDNRTQNVNYRNTPNDGATNMNTVNRHNQNTDHNDNRNLRVADKAADKVTDLKEVKNATVIVAGNSAYVAVVLTNGQKGAIANHLKNKITDKVKSADKHVRTVYVSANPDFVERMQGYGKRIQNGHPVSGLFDEFGQMVQRVFPNPNK
>NZ_CP024897.1|WP_014417278.1|895012_895915_+|hypothetical-protein
MRDGMGKRAAFTLILCGVLVILAVSSAVSVSMMYVLSGQNSRSVPTKEQVTEHMNKEIYKHTAIYYTADEKPLLDLTKLTLDHAKRINQIIVGYKGAAPLELIFFSDEAEMEQYSGLKNVVGFYSEQEQMMGLLPEEKKQLLKKDELAVFMYKQLIIHEYTHYAFHQKTRQLGTDTSVFPLWFHEGLSEWVAHYDVVIDPIAFSVVPFDQLTTDRKWQKSRMEYETDVYLQSFYMIKDLTETFGEGIILTIINKTAETQDFEKGFEAATKESLKQFEHDFIKAYEKKKTALESQVSNAVF
>NZ_CP024897.1|WP_007610275.1|895915_896581_-|spore-coat-protein
MEQQQNQQQPPVNQGIPGSPQVNHGGHELFDMHEVLAGTVGVLDQFMMLRQFIQDQQLADILDRQYQFILGLYNLTAECFKTGQKPSQETSTYMMKEQNQAVYGIKPTQPKKPNQSLNDVKDLGISGHMLGLIKAQASLLTMSSLEMTNPVTRRVLSAQIQQYVEMAFEIFLYQNKHGYYQVPQLNAQDMQTMLNSFAPAQGQPQMPPIKGQMGQQQQNLH
>NZ_CP024897.1|WP_029973223.1|896774_898829_+|5'-nucleotidase-C-terminal-domain-containing-protein
MKKKRGMRLSCCLLTVCFMMFSVKDAEAIGQAGSLNEAGTDKAYKERQTEDSGRVPLRIISMNDLHGKIDQQYELDLNGDGKPDGTFGRMDYAAAYIKKAKAEKEHAFVVHAGDMIGGSSPVSALFQDEPTVELMEDIGFDVGTVGNHEFDEGTDELKRIINGGDHPDGKGTSGYDGQNFPLVCANCKLKSGESFLPPYEIKYVSGIPVAFIGVVTRSAAGMVIPDGIKNITFTDEVKAVNDAAADLKKKGIKAIAVLAHMSAEQNGSAITGESAKLASGTDSEIDVIFAAHNHKVVNGEINGKLIVQAFEYGKAIGIADLELDKESKDIVKKSAEIQYIDQSKIKPDPAAAGILSKYEEKVKPIISETVGEAAHDITGGYSNDGDTALGNLIADGMKAKMKSDFALMNGGGIRDGIKKGPITWGDLYNVQPFGNVLTKLEIKGKDLREIINAQISPVYGPDYSISGFSYTWNPETGQAVDMKMADGTDIQPEKGYTVTVNQFMATAAGAKYGPIGKLGKNPVTGPEDLEATADYVKSFSAPISYQTDGRIRTASAAKTPDDTGNQPGSGETPGGTRPDKGEKPQAEKPAKKPDAAEQPDQTKKPERPVVKETASDTVQSIPESRPASAANSEQSTKQTESGTQKGRPLPDTSAGSHQTALAGLVITGAGVYWLFRKKRGIRTR
>NZ_CP024897.1|WP_014720915.1|898825_899422_+|class-D-sortase
MNKLKHIPLLVIIAGIIITCYGSWKIIDSHMKTNQSLEEAKQATEPVLEKNETKSAVLTQRKKEFHPETGEASGILEIPEIDAELPIVEGTDADDLAKGVGHYKDSYYPGDHGQIVLSGHRDTVFRRTGELKKGDRLNVILSYGTFSYKLSRTKIVSRDDTSVITLQHKREELILTTCYPFSYIGNAPKRYIIYADPV
>NZ_CP024897.1|WP_014417281.1|899418_900327_-|RluA-family-pseudouridine-synthase
MKQNDRGLELLITEKHAGQWLFSVLKSEFQASKPVITEWMNQESIQVNRTSPKNNIILKTGDRLFIDLQEKTGSSVTPEYGEPDILFEDNHMLIANKPAGMPTHPNEEGQTGTLSNLIAYHFQINGEQAKVRHVHRLDRDTSGAVVFAKHRLAHAILDRQLETKTLKRTYIAAAEGKITPKKGTVDSPIGRDRSHSVRRRVSPGGQAAVTHYKVKGYHPGAQLTLAELELETGRTHQIRVHMASIGHPLAGDDLYGGSRTLFHRQALHAKKVSVVHPISGEEIVAEAPMPADLAHFTETYFS
>NZ_CP024897.1|WP_007408448.1|900436_900832_+|DUF5365-family-protein
MARKVIDVRIVNAATDGQESAIQELSSELFQNVFPLYFSELEIQRFKKRGVLSLQNQRYQGTLKEAFQIMACLQTVHIMLSKPHPVYDVKERALFDKNCALLNECGMNFPFTYDDFETGAGSEACGHRRLI
>NZ_CP024897.1|WP_007408449.1|900962_901385_+|CBS-domain-containing-protein
MSSIKQSMTTHVATVSPNQTIQEAAALMHQHNVGAIPVVDGGELKGMLTDRDIALRTTAQGRDGQTPVSHVMSSAVVSGNPEMSLEEASHLMAQHQIRRLPIVDQNHLVGIVALGDLAVDQRSNESAGAALSNISSQNTQ
>NZ_CP024897.1|WP_003155347.1|901513_902203_+|HAD-family-hydrolase
MIKALIFDFDGLILDTETHEYEVLQEMFEEHGSTLPLSVWGKVIGTAAGFKPFAYLEEQLGRKLDHDELTAIRRGRFEQRMKTETARPGVEAYLAAAKELGLKVGLASSSDFKWVSGHLKELGLFDEFEVIQTADDVEEVKPNPELYLKAAEHLGVEPSECLAFEDSVNGSIAAKRAGMKCVIVPNKVTSALLFEEYDHRLESMAEMELELLLQRLNDQNEPAGGSSIV
>NZ_CP024897.1|WP_007408451.1|902195_903734_+|bifunctional-GNAT-family-N-acetyltransferase/carbon-nitrogen-hydrolase-family-protein
MSEKLDLTRFEKKMVIRNMEEKDINKIIELQKDCFPGMEPWEPEHLISHLAHFPEGQFCAEYEGEIIGSCSSLIINFDEYDDRHTWQDITDDGYITNHNPDGLNLYGIEVMVHPEYRRMKIGHRLYEARKDLARRLNLKSIIIGGRIPNYHKYAEEMTARAYVEQVTRHQIYDPVLSFQLMNGFTLMRINPNYLPDDTASIKYATLMQWNNVDYLPQSKRYYKSAFPVRICVIQYEMKKIYSFEEFANQVEYYVDVASDARSDFAVFPEIFTTQLMSFLEERSPSLAIQRITEYTEDYISLFTDLAVKYNVNIIGGSHFVEEEGKIYNIAYLFRRDGTIEKQYKLHITPNERKWWGISAGDRVRVFDTDCGKIAIQICYDIEFPELARIAADQGAKIIFTPFCTEDRQGYLRVRYCSQARAVENQIYTVISGTVGNLPQTENMDIQYAQSAIFAPSDFEFARDGIVGETNPNIEMVVIGDVDLEILRRQRENGTVRQLKDRRKDIYRITHLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

627757 : 637648

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029973748.1\|627757_629050_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	27.3
WP_007609852.1\|629125_629845_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	1.3e-47	44.7
WP_017419024.1\|629844_630099_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	2.1e-05	34.6
WP_021495182.1\|630095_630779_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_029973747.1\|630762_632991_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.2e-158	40.7
WP_014417105.1\|632966_634397_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.2e-54	32.7
WP_029973746.1\|634488_635529_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.8e-64	41.4
WP_029973745.1\|635525_636113_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.7e-27	38.8
WP_014417107.1\|636109_637648_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.3e-77	50.5

DBSCAN-SWA_2

1188586 : 1220918

Bacillus_phage(33.33%)

plate,terminase,capsid,portal,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087920760.1\|1188586_1189723_+	S9 family peptidase	A0A1P8CWN8	Bacillus_phage	1.3e-94	47.9
WP_003154881.1\|1189712_1189847_+	PhrA family phosphatase inhibitor	NA	NA	NA	NA
WP_017417599.1\|1189989_1190943_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.4e-62	69.3
WP_017417600.1\|1190980_1191358_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.1e-15	38.5
WP_100261718.1\|1191467_1192070_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	1.0e-42	48.3
WP_021494033.1\|1192140_1192977_+	manganese catalase family protein	NA	NA	NA	NA
WP_021494032.1\|1192998_1193589_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.0e-39	51.7
WP_003154871.1\|1193737_1194076_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	8.4e-18	45.8
WP_014417518.1\|1194266_1194446_+	hypothetical protein	NA	NA	NA	NA
WP_053285037.1\|1194435_1195263_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.3e-19	50.0
WP_053285036.1\|1195162_1195963_+	ATP-binding protein	A6XMI1	Bacillus_virus	8.0e-59	45.3
WP_162838272.1\|1195962_1196130_+	hypothetical protein	NA	NA	NA	NA
WP_015239676.1\|1196227_1196569_+	hypothetical protein	NA	NA	NA	NA
WP_007610788.1\|1196558_1196762_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	7.0e-12	47.0
WP_007407279.1\|1196868_1197381_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	3.8e-22	44.6
WP_022553491.1\|1197493_1198291_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	2.3e-58	49.4
WP_007407277.1\|1198287_1199586_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	2.1e-149	58.9
WP_089072483.1\|1199634_1201026_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.4e-138	55.8
WP_021494027.1\|1201045_1201891_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.5e-55	58.1
WP_007407274.1\|1201917_1202853_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	3.3e-104	62.8
WP_021494026.1\|1202869_1203253_+	DUF3199 family protein	NA	NA	NA	NA
WP_022553487.1\|1203249_1203606_+	DUF3599 family protein	NA	NA	NA	NA
WP_072177410.1\|1203602_1204106_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_029973074.1\|1204102_1204549_+	hypothetical protein	NA	NA	NA	NA
WP_007610809.1\|1204545_1204755_+	hypothetical protein	NA	NA	NA	NA
WP_100261719.1\|1204754_1206152_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7RTT5	Clostridium_phage	3.4e-81	40.2
WP_003154837.1\|1206153_1206597_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003154836.1\|1206671_1207118_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	35.8
WP_015239684.1\|1207159_1207312_+	hypothetical protein	NA	NA	NA	NA
WP_100261720.1\|1207299_1212102_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	3.1e-41	46.6
WP_022553482.1\|1212094_1212754_+	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	1.8e-08	45.3
WP_053285029.1\|1212767_1213745_+	hypothetical protein	A0A1L6BY20	Clostridium_phage	2.9e-34	30.6
WP_022553480.1\|1213744_1214011_+	DUF2577 family protein	S6C459	Thermus_phage	3.4e-06	37.5
WP_020955689.1\|1214114_1214540_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	2.5e-11	35.9
WP_095271611.1\|1214532_1215579_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-69	43.8
WP_100261721.1\|1215562_1216141_+	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	3.1e-12	29.3
WP_100261722.1\|1216137_1216410_+	hypothetical protein	NA	NA	NA	NA
WP_100261723.1\|1216412_1218035_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	3.1e-41	39.7
WP_007610833.1\|1218418_1218616_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	7.3e-14	61.8
WP_100261724.1\|1218672_1219434_+\|portal	phage portal protein	NA	NA	NA	NA
WP_100261725.1\|1219485_1219749_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	6.1e-24	64.3
WP_003154813.1\|1219762_1220026_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-23	65.5
WP_007407257.1\|1220039_1220918_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	3.7e-81	60.5

DBSCAN-SWA_3

1773319 : 1779533

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014417834.1\|1773319_1773712_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	5.0e-30	59.1
WP_007611605.1\|1773671_1775774_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	85.7
WP_012117608.1\|1775791_1776781_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	83.0
WP_100261799.1\|1776829_1777450_+	hypothetical protein	A0A127AYS1	Bacillus_phage	3.2e-47	48.4
WP_022553310.1\|1777499_1778258_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.4e-52	50.0
WP_015417523.1\|1778564_1779533_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	8.0e-53	40.9

DBSCAN-SWA_4

2117015 : 2167041

Bacillus_phage(42.11%)

plate,terminase,protease,coat,capsid,portal,integrase,tail,head,holin

attL 2133716:2133734|attR 2172626:2172644

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025852552.1\|2117015_2118506_-	glycosyltransferase	A0A1V0SGA9	Hokovirus	7.3e-05	30.0
WP_032859136.1\|2118890_2119487_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_025852558.1\|2119695_2120223_+	hypothetical protein	NA	NA	NA	NA
WP_025852559.1\|2120417_2121578_-	N-acetylmuramoyl-L-alanine amidase	A0A1P8CWN6	Bacillus_phage	1.7e-70	66.7
WP_025852561.1\|2121623_2122046_-\|holin	phage holin family protein	D6R405	Bacillus_phage	2.3e-57	86.5
WP_025852563.1\|2122095_2122281_-	XkdX family protein	Q9ZXD9	Bacillus_phage	2.0e-21	73.8
WP_025852565.1\|2122280_2122643_-	hypothetical protein	Q9ZXE0	Bacillus_phage	3.9e-29	56.3
WP_025852566.1\|2122639_2124463_-\|plate	phage baseplate upper protein	D6R402	Bacillus_phage	3.4e-81	37.9
WP_100261852.1\|2124477_2127042_-	peptidase G2	D6R401	Bacillus_phage	0.0e+00	79.8
WP_100261853.1\|2127095_2128799_-\|tail	phage tail protein	D6R400	Bacillus_phage	1.3e-180	57.6
WP_100261854.1\|2128813_2129653_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	3.4e-92	57.9
WP_100261855.1\|2129646_2134134_-\|tail	phage tail tape measure protein	A0A1Q1PVX7	Staphylococcus_phage	2.3e-62	32.3
2133716:2133734	attL	NA	NA	NA	NA
WP_014418189.1\|2134330_2134708_-	hypothetical protein	NA	NA	NA	NA
WP_100261856.1\|2134769_2135378_-\|tail	phage tail protein	A0A2H4J8F3	uncultured_Caudovirales_phage	4.9e-24	35.5
WP_032859666.1\|2135392_2135776_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_038458888.1\|2135772_2136171_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_100261857.1\|2136171_2136486_-\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	1.5e-13	38.2
WP_014418194.1\|2136475_2136778_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	3.6e-12	45.2
WP_100261858.1\|2136795_2137221_-	collagen-like protein	D6R3Z0	Bacillus_phage	6.0e-13	56.0
WP_047935864.1\|2137243_2138536_-\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	3.1e-92	48.1
WP_014418197.1\|2138574_2139201_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	2.5e-84	77.7
WP_014418198.1\|2139163_2140444_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	2.1e-154	62.8
WP_014418199.1\|2140448_2140619_-	hypothetical protein	Q9ZXF9	Bacillus_phage	7.9e-09	61.8
WP_038458898.1\|2140632_2142342_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	1.7e-207	63.1
WP_100261859.1\|2142338_2142854_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	9.2e-32	42.3
WP_100261860.1\|2143079_2143445_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	3.0e-29	54.2
WP_100261861.1\|2143734_2144208_-	hypothetical protein	NA	NA	NA	NA
WP_100261862.1\|2144340_2144553_-	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	5.8e-09	45.5
WP_162839616.1\|2144815_2144965_-	hypothetical protein	NA	NA	NA	NA
WP_043021764.1\|2145103_2145316_-	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	4.3e-12	52.9
WP_172952967.1\|2145614_2145752_-	hypothetical protein	NA	NA	NA	NA
WP_100261864.1\|2145855_2146371_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.4e-27	43.2
WP_046341357.1\|2146595_2147036_-	hypothetical protein	NA	NA	NA	NA
WP_046341358.1\|2147084_2147321_-	hypothetical protein	NA	NA	NA	NA
WP_100261866.1\|2147554_2147908_+	hypothetical protein	NA	NA	NA	NA
WP_046341360.1\|2148046_2148304_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	39.3
WP_025852610.1\|2148339_2148543_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	2.8e-21	70.3
WP_162918043.1\|2148625_2148790_-	hypothetical protein	A0A2H4J4N7	uncultured_Caudovirales_phage	6.7e-13	66.0
WP_046341362.1\|2148841_2149270_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	3.0e-44	65.7
WP_079891877.1\|2149505_2150417_-	ATP-binding protein	A6XMI1	Bacillus_virus	2.1e-55	51.2
WP_025852615.1\|2150337_2151039_-	DnaD domain protein	NA	NA	NA	NA
WP_081364445.1\|2151236_2151974_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A290GJV0	Caldibacillus_phage	1.3e-42	40.9
WP_025852621.1\|2151993_2152914_-	hypothetical protein	A0A0A7S0A9	Clostridium_phage	4.5e-90	64.0
WP_025852623.1\|2152910_2153099_-	hypothetical protein	NA	NA	NA	NA
WP_088056596.1\|2153201_2153399_-	hypothetical protein	NA	NA	NA	NA
WP_014418217.1\|2153395_2153653_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	1.1e-09	39.8
WP_014418218.1\|2153649_2154222_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	4.7e-61	56.9
WP_100261867.1\|2154279_2155008_-	Rha family transcriptional regulator	A0A2H4J4N4	uncultured_Caudovirales_phage	2.7e-90	68.5
WP_032863594.1\|2155004_2155319_-	hypothetical protein	A0A2H4JDL0	uncultured_Caudovirales_phage	1.9e-11	49.3
WP_025852635.1\|2155331_2155550_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_100261868.1\|2155702_2156080_+	helix-turn-helix domain-containing protein	A8ASM2	Listeria_phage	8.5e-11	54.1
WP_100261869.1\|2156442_2157639_+\|integrase	site-specific integrase	S6C485	Thermus_phage	1.5e-80	44.2
WP_100261870.1\|2157682_2158987_-	purine permease	NA	NA	NA	NA
WP_014418223.1\|2158983_2159568_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_014418224.1\|2159900_2161403_-	carboxypeptidase M32	NA	NA	NA	NA
WP_014721409.1\|2161514_2163434_-	ATP-dependent DNA helicase	A0A2P1N0K5	Streptomyces_phage	1.8e-11	21.8
WP_100261871.1\|2163537_2163729_-	hypothetical protein	NA	NA	NA	NA
WP_003153548.1\|2163895_2164048_+	YpzG family protein	NA	NA	NA	NA
WP_072177169.1\|2164088_2165255_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_003153541.1\|2165788_2166088_-	cell division regulator GpsB	NA	NA	NA	NA
WP_072177168.1\|2166167_2166716_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_003153539.1\|2166804_2167041_-\|coat	spore coat protein	NA	NA	NA	NA
2172626:2172644	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2258622 : 2264875

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007409428.1\|2258622_2259216_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	36.6
WP_007409427.1\|2259205_2259961_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.9e-10	25.7
WP_003153376.1\|2260168_2260258_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_021494254.1\|2260345_2260867_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003153373.1\|2260932_2261307_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003153372.1\|2261423_2261888_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-43	59.3
WP_014418281.1\|2261920_2263117_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.7
WP_021494255.1\|2263131_2263779_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.6e-39	44.3
WP_014418282.1\|2263759_2264875_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.4e-55	36.6

DBSCAN-SWA_6

2635391 : 2695203

uncultured_Mediterranean_phage(25.0%)

tRNA,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007408194.1\|2635391_2635835_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003152716.1\|2635847_2638052_-	GTP diphosphokinase	A0A2I2L310	Orpheovirus	1.5e-09	34.8
WP_003152714.1\|2638209_2638722_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.5e-29	47.2
WP_100261918.1\|2638727_2641088_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	3.1e-90	34.8
WP_014418528.1\|2641143_2641470_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_014418529.1\|2641533_2642031_-	cation:proton antiporter regulatory subunit	NA	NA	NA	NA
WP_022552888.1\|2642162_2644382_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.2e-27	32.5
WP_014418531.1\|2644418_2644715_-	post-transcriptional regulator	NA	NA	NA	NA
WP_021494386.1\|2644830_2646387_+	stage V sporulation protein B	NA	NA	NA	NA
WP_095061077.1\|2646394_2647051_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003152697.1\|2647217_2647604_+	TIGR04086 family membrane protein	NA	NA	NA	NA
WP_007408187.1\|2647655_2647916_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.9e-06	46.9
WP_014305500.1\|2647946_2649092_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	8.1e-89	44.8
WP_100261919.1\|2649119_2650148_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003152687.1\|2650173_2650374_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_007408185.1\|2650366_2651371_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	4.0e-07	30.0
WP_021494387.1\|2651381_2651987_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_012118093.1\|2652121_2652631_-	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_100261920.1\|2652763_2653003_-	hypothetical protein	NA	NA	NA	NA
WP_100261921.1\|2653015_2653609_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_100261922.1\|2653756_2654947_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_100261923.1\|2655073_2656177_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_100261924.1\|2656178_2657027_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_022552882.1\|2657008_2658574_-	L-aspartate oxidase	NA	NA	NA	NA
WP_022552881.1\|2658680_2659832_+	IscS subfamily cysteine desulfurase	A0A141ZJV0	Faustovirus	3.9e-30	29.9
WP_100261925.1\|2659828_2660371_+	transcription repressor NadR	NA	NA	NA	NA
WP_003152668.1\|2660397_2661255_-	prephenate dehydratase	NA	NA	NA	NA
WP_007408173.1\|2661268_2661712_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_007408172.1\|2661765_2663052_-	GTPase ObgE	NA	NA	NA	NA
WP_014418543.1\|2663083_2663662_-	Spo0B domain-containing protein	NA	NA	NA	NA
WP_003152662.1\|2663979_2664264_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_012118103.1\|2664276_2664618_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003152660.1\|2664620_2664929_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_017418245.1\|2665074_2665941_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_017418246.1\|2665933_2666737_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003152655.1\|2666864_2667668_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_003152653.1\|2667670_2668351_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_003152650.1\|2668404_2668923_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_007408166.1\|2668919_2669783_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003152647.1\|2669813_2670827_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_007408165.1\|2670918_2671614_-	DNA repair protein RadC	NA	NA	NA	NA
WP_012118105.1\|2671645_2672215_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_100261926.1\|2672355_2673357_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_022552879.1\|2673483_2674236_-	prepilin peptidase	NA	NA	NA	NA
WP_017418285.1\|2674376_2675669_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_100261927.1\|2675727_2678370_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	9.8e-162	42.5
WP_003152639.1\|2678822_2679014_+	hypothetical protein	NA	NA	NA	NA
WP_029973368.1\|2679028_2680051_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_100261928.1\|2680084_2681926_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_021494394.1\|2682058_2683348_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_029973366.1\|2683376_2684351_-	porphobilinogen synthase	NA	NA	NA	NA
WP_014418554.1\|2684356_2685136_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_012118114.1\|2685125_2686067_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_007408154.1\|2686101_2686932_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_003152628.1\|2686939_2688307_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_017418292.1\|2688500_2688992_+	hypothetical protein	NA	NA	NA	NA
WP_003152626.1\|2689024_2689612_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_100261929.1\|2689608_2691933_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.1e-184	44.3
WP_014418557.1\|2692131_2693790_-\|protease	ATP-dependent protease LonB	A0A167RA83	Powai_lake_megavirus	1.9e-14	32.7
WP_007408149.1\|2693940_2695203_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.2e-147	65.3

DBSCAN-SWA_7

3663069 : 3670810

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014419157.1\|3663069_3664005_-	sensor histidine kinase	W8CYF6	Bacillus_phage	9.8e-24	28.9
WP_014419158.1\|3664006_3664705_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-35	35.8
WP_029972894.1\|3664896_3665763_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_029972896.1\|3665783_3666488_-	ABC transporter permease	NA	NA	NA	NA
WP_025649399.1\|3666553_3667480_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-43	45.9
WP_003150986.1\|3667801_3668257_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	NA	NA	NA	NA
WP_100262072.1\|3668253_3669102_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.4e-37	37.3
WP_021494763.1\|3669122_3670070_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.3e-68	42.9
WP_003150981.1\|3670072_3670810_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	5.0e-47	42.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024897

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection