CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP024924	Sphingomonas sp. Cra20 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	8	0
NZ_CP024923	Sphingomonas sp. Cra20 chromosome, complete genome	1 crisprs	WYL,csa3,DEDDh,cas3,DinG	0	1	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 38810

Bacillus_phage(100.0%)

integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284604.1\|322_499_+	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_100284605.1\|571_769_+	hypothetical protein	NA	NA	NA	NA
WP_100284606.1\|4131_5691_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_100284607.1\|7045_7246_-	hypothetical protein	NA	NA	NA	NA
WP_158299049.1\|7316_7490_+	hypothetical protein	NA	NA	NA	NA
WP_100284608.1\|7492_8110_+	hypothetical protein	NA	NA	NA	NA
WP_100284609.1\|8113_8989_+	hypothetical protein	NA	NA	NA	NA
WP_100284610.1\|9141_10047_-	hypothetical protein	NA	NA	NA	NA
WP_100284611.1\|10046_11138_-	hypothetical protein	NA	NA	NA	NA
WP_100284613.1\|11645_13343_+	hypothetical protein	NA	NA	NA	NA
WP_100284614.1\|13513_14515_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_100284615.1\|14578_15631_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_100284616.1\|15627_16341_-	hypothetical protein	NA	NA	NA	NA
WP_100284617.1\|16495_16696_+	hypothetical protein	NA	NA	NA	NA
WP_100284618.1\|16702_19528_-	conjugal transfer protein TraG	NA	NA	NA	NA
WP_100284739.1\|19550_20951_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_100284619.1\|21016_21820_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_100284620.1\|22050_22383_-	hypothetical protein	NA	NA	NA	NA
WP_100284621.1\|22423_24256_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_100284622.1\|24252_24996_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_100284623.1\|25006_26023_-	conjugal transfer pilus assembly protein TraU	NA	NA	NA	NA
WP_100284624.1\|26025_26292_-	hypothetical protein	NA	NA	NA	NA
WP_100284625.1\|26291_26948_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_100284626.1\|26944_27481_-	type VI secretion protein	NA	NA	NA	NA
WP_100284627.1\|27461_28139_-	TrbI F-type domain-containing protein	NA	NA	NA	NA
WP_100284628.1\|28131_28491_-	hypothetical protein	NA	NA	NA	NA
WP_100284629.1\|28495_31087_-	type IV secretion system protein TraC	NA	NA	NA	NA
WP_100284740.1\|31088_32063_-	type IV conjugative transfer system lipoprotein TraV	NA	NA	NA	NA
WP_100284630.1\|32074_32959_-	DsbC family protein	NA	NA	NA	NA
WP_100284631.1\|32945_34271_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_100284632.1\|34272_35079_-	type-F conjugative transfer system secretin TraK	NA	NA	NA	NA
WP_100284633.1\|35075_35642_-	conjugal transfer protein TraE	NA	NA	NA	NA
WP_100284634.1\|35643_35934_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_100284635.1\|35992_36313_-	hypothetical protein	NA	NA	NA	NA
WP_100284741.1\|37344_37779_+	hypothetical protein	NA	NA	NA	NA
WP_100284636.1\|37817_38810_-	transglycosylase SLT domain-containing protein	A0A0S2SXN2	Bacillus_phage	3.1e-12	39.8

DBSCAN-SWA_2

43239 : 44229

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284641.1\|43239_44229_+	zinc-dependent alcohol dehydrogenase family protein	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	8.8e-07	26.8

DBSCAN-SWA_3

52421 : 61241

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284649.1\|52421_52973_-	hypothetical protein	S4VXZ7	Pandoravirus	1.9e-11	30.7
WP_100284650.1\|53124_53478_-	hypothetical protein	NA	NA	NA	NA
WP_100284651.1\|53630_54980_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.2e-10	25.4
WP_100284652.1\|54976_55651_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.4e-24	30.9
WP_100284653.1\|55912_56794_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_100284654.1\|57141_57882_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	2.3e-20	34.1
WP_100284655.1\|58031_58994_+	hypothetical protein	NA	NA	NA	NA
WP_100284656.1\|59001_59466_+	cupin domain-containing protein	A0A291AU44	Pandoravirus	1.2e-27	40.9
WP_100284657.1\|59624_61241_-	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	6.4e-31	31.0

DBSCAN-SWA_4

69070 : 69913

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284668.1\|69070_69913_-	alpha/beta hydrolase	A0A249XU20	Mycobacterium_phage	9.5e-10	25.5

DBSCAN-SWA_5

102292 : 103372

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284696.1\|102292_103372_-	DNA polymerase IV	I6RSM4	Salmonella_phage	2.8e-14	29.9

DBSCAN-SWA_6

110402 : 113360

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284747.1\|110402_113360_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	3.0e-10	34.4

DBSCAN-SWA_7

117091 : 125356

Aeromonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284703.1\|117091_118294_-	AAA family ATPase	A0A1I9KF58	Aeromonas_phage	5.4e-43	33.5
WP_100284704.1\|118458_119541_-	replication initiation protein	NA	NA	NA	NA
WP_100284705.1\|120198_121053_+	virulence-associated protein E	A0A2P1JT30	Streptomyces_phage	1.3e-06	31.2
WP_100284706.1\|121132_125356_+	methylase	A0A2I7RSW2	Vibrio_phage	8.1e-09	28.6

DBSCAN-SWA_8

128538 : 129489

Caulobacter_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284708.1\|128538_129489_+	DUF1738 domain-containing protein	K4JTR8	Caulobacter_virus	9.8e-64	47.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP024923

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP024923_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP024923_1

3064684-3064937

Orphan

Consensus_repeat	Method
GCCTCGATCGCCGGTTCGGGCAA	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP024923_1

>merge|NZ_CP024923|1|3064684-3064937|CRISPRCasFinder
GGCGCTGTCTCCGGATCGGGCAATCTCACCATCGCCGATCTTCGCGCCGGCAGTGCCGACCTGTCGGTGGCCGGATCGGGCGATATGAGCGTCGCGGGAAGCGCGTCGAAGCTGTCCGCCTCGATCGCCGGTTCGGGCAACATCGACGCCAGGCGCCTTACCGCCGCGAACGCCGATGTCTCGATCGCCGGTTCGGGCAATGTCTTCGGCACCGTCAAGGGGCCGGCTTCGGTCTCGATCGTCGGATCGGGCGA

>NZ_CP024923|1|1|3064684-3064937|CRISPRCasFinder
GGCGCTGTCTCCGGATCGGGCAA	TCTCACCATCGCCGATCTTCGCGCCGGCAGTGCCGAC
CTGTCGGTGGCCGGATCGGGCGA	TATGAGCGTCGCGGGAAGCGCGTCGAAGCTGTCC
GCCTCGATCGCCGGTTCGGGCAA	CATCGACGCCAGGCGCCTTACCGCCGCGAACGCCGAT
GTCTCGATCGCCGGTTCGGGCAA	TGTCTTCGGCACCGTCAAGGGGCCGGCTTCG
GTCTCGATCGTCGGATCGGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP024923.1\|WP_100282717.1\|3065728_3066391_-\|ligase-associated-DNA-damage-response-endonuclease-PdeM	unknown	unknown	gnl\|CDD\|274996
NZ_CP024923.1\|WP_100282710.1\|3056716_3058390_+\|DUF87-domain-containing-protein	unknown	unknown	gnl\|CDD\|376671
NZ_CP024923.1\|WP_158298886.1\|3065045_3065732_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371327
NZ_CP024923.1\|WP_100282711.1\|3060222_3062697_+\|helicase	unknown	unknown	gnl\|CDD\|350192
NZ_CP024923.1\|WP_100284414.1\|3058482_3059970_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP024923.1\|WP_100282724.1\|3072671_3073703_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP024923.1\|WP_100282720.1\|3069485_3069893_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319910
NZ_CP024923.1\|WP_100282723.1\|3071987_3072536_+\|redoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|224146
NZ_CP024923.1\|WP_100282721.1\|3070053_3070836_-\|histidinol-phosphatase	unknown	unknown	gnl\|CDD\|238819
NZ_CP024923.1\|WP_100282712.1\|3062689_3062998_+\|RNA-binding-protein	unknown	unknown	gnl\|CDD\|224109
NZ_CP024923.1\|WP_100282707.1\|3046531_3052291_-\|alpha-2-macroglobulin	unknown	unknown	gnl\|CDD\|225248
NZ_CP024923.1\|WP_100282709.1\|3054938_3055853_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP024923.1\|WP_029936734.1\|3066507_3066873_-\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
NZ_CP024923.1\|WP_100282714.1\|3063648_3064182_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NZ_CP024923.1\|WP_100282708.1\|3053863_3054889_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP024923.1\|WP_100282719.1\|3067305_3069447_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_CP024923.1\|WP_100282722.1\|3070901_3071960_+\|phospholipase	unknown	unknown	gnl\|CDD\|238302
NZ_CP024923.1\|WP_100282713.1\|3063056_3063395_+\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|378771
NZ_CP024923.1\|WP_100284413.1\|3055912_3056635_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370581
NZ_CP024923.1\|WP_100282718.1\|3066885_3067089_-\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676

Protein	Function_ID	Function_description	E-value
NZ_CP024923.1\|WP_100282717.1\|3065728_3066391_-\|ligase-associated-DNA-damage-response-endonuclease-PdeM	gnl\|CDD\|274996	TIGR04123, hypothetical_protein, metallophosphoesterase, DNA ligase-associated. Members of this protein family are an uncharacterized putative metallophosphoesterase associated with a DNA ligase, a helicase, and a putative exonuclease. It may play a role in DNA repair. Its system is present in about 12 % of prokaryotic reference genomes.	9.51377e-78
NZ_CP024923.1\|WP_100282710.1\|3056716_3058390_+\|DUF87-domain-containing-protein	gnl\|CDD\|376671	pfam01935, DUF87, Domain of unknown function DUF87. The function of this prokaryotic domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.	9.32948e-55
NZ_CP024923.1\|WP_158298886.1\|3065045_3065732_+\|hypothetical-protein	gnl\|CDD\|371327	pfam10988, DUF2807, Putative auto-transporter adhesin, head GIN domain. This bacterial family of proteins shows structural similarity to other pectin lyase families. Although structures from this family align with acetyl-transferases, there is no conservation of catalytic residues found. It is likely that the function is one of cell-adhesion. In Structure 3jx8, it is interesting to note that the sequence of contains several well defined sequence repeats, centred around GSG motifs defining the tight beta turn between the two sheets of the super-helix; there are 8 such repeats in the C-terminal half of the protein, which could be grouped into 4 repeats of two. It seems likely that this family belongs to the superfamily of trimeric auto-transporter adhesins (TAAs), which are important virulence factors in Gram-negative pathogens. In the case of Parabacteroides distasonis, which is a component of the normal distal human gut microbiota, TAA-like complexes probably modulate adherence to the host (information derived from TOPSAN).	2.89703e-26
NZ_CP024923.1\|WP_100282711.1\|3060222_3062697_+\|helicase	gnl\|CDD\|350192	cd18805, SF2_C_suv3, C-terminal helicase domain of ATP-dependent RNA helicase. The SUV3 (suppressor of Var 3) gene encodes a DNA and RNA helicase, which is localized in mitochondria and is a subunit of the degradosome complex involved in regulation of RNA surveillance and turnover. SUV3 exhibits DNA and RNA-dependent ATPase, DNA and RNA-binding and DNA and RNA unwinding activities. SUV3 is a DEAD-like helicase belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.	7.48048e-32
NZ_CP024923.1\|WP_100284414.1\|3058482_3059970_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	2.12027e-46
NZ_CP024923.1\|WP_100282724.1\|3072671_3073703_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	9.42687e-47
NZ_CP024923.1\|WP_100282720.1\|3069485_3069893_+\|VOC-family-protein	gnl\|CDD\|319910	cd07246, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.62932e-42
NZ_CP024923.1\|WP_100282721.1\|3070053_3070836_-\|histidinol-phosphatase	gnl\|CDD\|238819	cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate fructose-1,6-bisphosphate, inositol monophospate, 3'-phosphoadenosine-5'-phosphate, or similar substrates.	4.30528e-111
NZ_CP024923.1\|WP_100282712.1\|3062689_3062998_+\|RNA-binding-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	8.84399e-18
NZ_CP024923.1\|WP_100282707.1\|3046531_3052291_-\|alpha-2-macroglobulin	gnl\|CDD\|225248	COG2373, COG2373, Large extracellular alpha-helical protein [General function prediction only].	3.10363e-90
NZ_CP024923.1\|WP_100282709.1\|3054938_3055853_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.42131e-23
NZ_CP024923.1\|WP_029936734.1\|3066507_3066873_-\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	1.58734e-66
NZ_CP024923.1\|WP_100282714.1\|3063648_3064182_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	6.55569e-63
NZ_CP024923.1\|WP_100282718.1\|3066885_3067089_-\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	1.75825e-21
NZ_CP024923.1\|WP_100282719.1\|3067305_3069447_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	2.0086e-25
NZ_CP024923.1\|WP_100282722.1\|3070901_3071960_+\|phospholipase	gnl\|CDD\|238302	cd00541, OMPLA, The outer membrane phospholipase A (OMPLA) is an integral membrane enzyme that catalyses the hydrolysis of acylester bonds in phospholipids using calcium as a cofactor. The enzyme has a fold of transmembrane beta-barrels and is widespread among Gram-negative bacteria, both in pathogens and nonpathogens. In pathogenic bacteria such as Campylobacter coli and Helicobacter pylori OMPLA is involved in pathogenesis and virulence. In nonpathogenic bacteria the physiological function of OMPLA is less clear. The Escherichia coli enzyme is involved in the secretion of bacteriocins, antibacterial peptides that are produced in order to survive under starvation conditions. The enzyme activity of OMPLA is strictly regulated to prevent uncontrolled breakdown of the surrounding phospholipids. The activity of OMPLA can be induced by membrane perturbation and concurs with dimerization of the enzyme.	2.00635e-45
NZ_CP024923.1\|WP_100282713.1\|3063056_3063395_+\|ferredoxin-family-protein	gnl\|CDD\|378771	pfam11953, DUF3470, Domain of unknown function (DUF3470). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 50 amino acids in length. This domain is found associated with pfam00037. This domain has a single completely conserved residue N that may be functionally important.	2.19423e-18
NZ_CP024923.1\|WP_100284413.1\|3055912_3056635_+\|hypothetical-protein	gnl\|CDD\|370581	pfam09608, Alph_Pro_TM, Putative transmembrane protein (Alph_Pro_TM). This family consists of predicted transmembrane proteins of about 270 amino acids. Members are found, so far, only among the Alphaproteobacteria and only once in each genome.	6.55777e-93
NZ_CP024923.1\|WP_100282723.1\|3071987_3072536_+\|redoxin-domain-containing-protein	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	5.3177e-32

>NZ_CP024923.1|WP_100282714.1|3063648_3064182_+|CarD-family-transcriptional-regulator
MAAKALSFDVGDYVVYPKHGVGRVIELQKQEIAGMQLELYVLRFEKEKMTLRVPTNKAESVGMRKLSSDKTLREALETLKGKPKVKRTMWSRRAQEYEAKINSGDLVSIAEVVRDLFRAEDQPEQSYSERQIFEAAASRLARELAAMEEVDEPTALEKILDILRKAAAIWNKDKVPA
>NZ_CP024923.1|WP_100282713.1|3063056_3063395_+|ferredoxin-family-protein
MTYVVTDACIRCKYMDCVEVCPVDCFYEGENMLVINPSECIDCGVCEPECPAEAILPDTENGLEQWLELNKTYSEEWPNITQKGDVPADADALKGEEGKFEKYFSTSPGTGS
>NZ_CP024923.1|WP_100282712.1|3062689_3062998_+|RNA-binding-protein
MADGETLRLDRFLWFARLAKSRSAAQAIAEKGTLRLDGRRIERSAAAVRVGTIIVFPLYGKVLALRVEALPKRRGPPAEAAQLYTRLETASPRNVDAAESGA
>NZ_CP024923.1|WP_100282711.1|3060222_3062697_+|helicase
MSQFARSPVTAVLGPTNTGKTHLAVERMCGHASGMIGFPLRLLAREVYDRVVRIKGVESVGLVTGEEKILPPKARWLLCTAESMPVEREVAFVGLDEAQIGADPERGHVFTDRLLRARGYAETMILGSDSLKPMLKALVPDAEIIGRPRFSTLSYAGAKKLSRLPRRSAIVAFSAEEVYAVAEALRRLRGGAAVVMGALSPRTRNAQVAMFQAGEVDYLVATDAIGMGLNMDVNHVAFASLSKFDGRRQRRLTIAEMAQIAGRAGRHQRDGTFGALHEEGPSAFTPEEVLALEAHQVPRLEHLFWREGAPDFASIDALIASLEAKPRDEALRAAPQAVDLAVLKHLAEEDWVRARVCAPRMVMRLWAACGLPDFRKLGVDPHARFVGRLFGHLSEANGHVPHQWFADEIARLDNMAGDVETLAGRIAAARSWAYIAHRADWLEDPIHWAERTRAIEEKLSDALHASLTQRFVDKRTTILLRQIGAGASDLPVTIGAQGEVSVEEHPLGKLEGFRFTVQAEARAADKRMLLAAAEKRLAGEFRKRGEALIESSDADLAIANNAVEWRGFAVAMLRPGVNLVRPRITIDRALDVLDPQARSAVQARLETWFATQIERHLPVLAKLDAASRDPAAGSPLRALANALLDSGGLLPRRAAAILVESLDGDARKQLRSIGVTIGTLDLFAPALLKPVAARWRRALMGLADAPAEGTTVLARNAPGADLAYGYRPLGAQAVRVDLVERIARAAHDARQGRKPFAPDPALATSIGLSTETLARLMAQLGFKTAKPRDGEPQRWIWQGLTPVARPRAAPIDNAFAALAGLRDG
>NZ_CP024923.1|WP_100284414.1|3058482_3059970_-|M23-family-metallopeptidase
MFLRNDHGLELGGGAVVTPAFPPVPGTALSTRLKRRVFANVDLAPDLGARIGTLTWYRGVATCVGLCAMTFLMAPGFETPIYGTVAPALIGADLDAARAQAIKPLAMGATMGYHVAATSLVAPLTDTPERPIISLDAKLASGDALLSVLKRSGVGAADAEQVGALVTKAVSFDQIQPGTMLDITLGRRTDKAQARPLQNMAFRARFDLKLEVARNGNSLSLKQIPIAIDHTPLRVQGAIGSSLYRSARAAGAPAKAVESFIRTLATRVPVSHLGSNCKFDIIVKQARAATGEVQLGNLLYAGVSSCDNKVQLMPWESNGKTEWFDGGGKGNKTGMMAMPANGRFSSAFGMRRHPILGYNRMHKGIDIAAPWGTPVYAATDGTVQFAGRSAGYGNFIKLNHGGAFGTGYGHLSRIVVRGGQSVRKGQVIGAVGNTGMSTGPHLHYELYKNGVAVNPRSVAFSSLRQLTGSDLGAFRSKLSQLLSVPVGRGAAKDED
>NZ_CP024923.1|WP_100282710.1|3056716_3058390_+|DUF87-domain-containing-protein
MEGQFGARVFENAAPISSGDAAAPRAAGRPIGAVLEIAGSSSQVMFDPAEVEALGASSDAAIANSGQVGSQVKMRVGSTWLIANVRSLRLDASGDRILAQVDFLGEGDEEKLTGKLYKFRRGVTRYPTPGCAVFPVSTADLKQIYAADDRAHIEIGNVYPTRDIRAALYVDAMLGKHFALLGSTGTGKSTAAALILHRICELSPQGHIVMIDPHGEYGSAFKTTGALYDVSNLQMPYWLMNFEEHCEVFLTTQNSARQVDADILAKCILLAKGKNRLAQEFGKLTVDAPIPYLLSDLTQILQLEMGKMDKATDTAPYLRLRSKIDEIKADPRYTFMFSGMLVADTMANFLARIFRLPGDGKPISIIDVSGVPSEITSVVVAVLSRMVFDFAIWSRGESKRPVLLVCEEAHRYVPNERNADGSSVGRILSRIAKEGRKYGVSLGLITQRPSDLAEGVLSQCGTILAMRLNNERDQAFVKAAMPEGARGFLDSIPALRNRECIAVGEGVATPIRLLFDALEDGKRPASDDPLFSELWRESGGEEQMLERTIKRWRSQGR
>NZ_CP024923.1|WP_100284413.1|3055912_3056635_+|hypothetical-protein
MGQAKPVLVPDVSQRNIEIAYSFTGAELLLFGAILYPRGRAPDPEDGPVDIVVVVRGPTQAVLVREKEKLAGIWLNAESMRYRSAPSFYAVASSRPMRGIVDERTRAIYELGVDSLQLSPASSAVPEVQARFDRGLVALRTRSGLFYEDSHAVEITGGVLYRARIDIPARVPVGRFTAETFLIQNGRVLAAAVRPIDIRKSGFERFVATSAERYSIPYGLVAVALSVLFGWGAGALWRRF
>NZ_CP024923.1|WP_100282709.1|3054938_3055853_+|sulfite-exporter-TauE/SafE-family-protein
MDLYLPIANLSVNALVIVALGLGVGLLSGMFGVGGGFLTTPLLIFYGIPPTVAAASAASQVTGASVSGVFAHFRRGGVDVHMGLVLVAGGVVGSIAGAGLFRLLQVTGVIDTVIAILYVLMLGSIGGLMLHESITAVRVGRGAVPPRARKRRHHPLVAMLPLRWRFYRSGLYISPLAPLLLGFFTGILTVLLGVGGGFILVPAMLYLLGMGTQVVVGTSLFQILFVTAAATMVHATTTKAVDIVLAVLLLIGSVAGAQLGARFAQKAKPEYLRLALALIVIAVALRMLLGLAWRPDEIYSVELL
>NZ_CP024923.1|WP_100282708.1|3053863_3054889_+|hypothetical-protein
MTGQGRPIRFLALVVLGWIGVRIALLWSATGSLPEAIRAFAPIAATPDMPATPTAVGHSAQRAGLPPARLPPGPRRIGGAPLSTRPAAPAPDPERVQMALMGLIQYGVPATIVAAAVTPLPPAAQPENLPALPSHWSASAWLVARPGTGLGAAPGASQLGGSQAGLRVAWLLWPRQRLAGFGRLVTPLRGKGAEASIGLEWQPTRAPVRVVAEQRFGLDGIRGGPGLGVAGGFEGTVGPGFRLETYGQAGAIRRLRTEAYADGAVRVTRTLAEGGGERLALGGGAWAAAQRDATRLDIGPSATLALPLGKQNVRLVLDWRQRVAGTARPGSGFALTLGSDF
>NZ_CP024923.1|WP_100282707.1|3046531_3052291_-|alpha-2-macroglobulin
MKLVARLGILALIAAPLGATLAMGDNSPQVEMATPGVGDGAIERFTARFNQPMVPLGDPRAAGPFTVECPVGGEGRWVDQQTFVHEFASPLPGGVTCTFTLKDKLKSLAGYALTGQTKFTVDSGGPIARAVLPSRYGNEIEEDQTFLVAANLAPDRASVGAHAYCAVDGVGEKIPVDVLPADVPGKLLAGLGTDQWAVQSFLEEAGLPKALPASDADRAKATASVVALKCRRPLPPGRDVALVWSKDIASATGRVAGTDQRFDFTVRKPFAARFECSRVNAQAGCSPVQDAWVRFSAPIPRAQAEAIRITLPDGKALTPVFSDEEKRKAVIADVKFKAPLPAAVTAKLTLPANVTDESGRKLSNAERFPLDVRFDEAPPLVKFAADFGILEAAEGGVLPVTVRNVEGQLGGSQMAVGGQSLKVEGGDGEIAKWLRAIDDAAETKSDDIKRGEETIRINQTGAKPLLTPATGKPFQVSLPGKGKDFEVVGIPLTKPGFYVVELASPRLGNALLGRNAPRYVAAGALVTNMSVHFKWGRDTSLVWVTALDSGKGVGSAEVRITDSCTGQVLAKGTTDASGRLGVPAGLPEPETYSSCENDSGSPLMVSARKADDFSFTLTQWGEGIRPYDFDLPYGYSAAEQVFHTVFDRALVRQGETVHMKHIVRKPIASGFGTSPAFTGTLRLSHRGSDTKYDLPLTIDANGIGETEWTAPQGAKMGDYDIQVVTNEAENEKVVYTSQSFKVDEYKLPTMKASVAGPKEAAVRPSTLPLDLFVGYLSGGGAGNLPVELRVGWFEGLTTPDGYDSYSFGGRALTEGVKPLNGDSETDEESTPLPPTQTLPVTLGGDGTARTSIEVPKSLDQPTNMQIEMDYQDANGEILTASRRIPIYTSAVQLGIKTDGWLMKQDDLRLRFVALDTSGKPLANQAISVELYSREILTARRRLIGGFYAYDNQMRTTKLGATCSATTDAQGLATCQLDPGVSGEVYAVATTKDANGNVARATRSTWLVGDDDWWFGGDNGDRMDVIPEQLEYKAGETAKFQVRMPFREATALVTVEREGVLSSFVVGLSGKDPVIEVPMPAAYAPDVYVSVMAVRGRVSGLSNWGSSLARDWGLPFSQDGGKPTATVDLAKPAYRLGIAKVKVGWEGHRLGVAVKAEKATYAARDTANVDVQVKNPDGSPAREADVAFVAVDEALLQLAPNESWDVLTAMMGDRPISVLTSTAQTQVVGKRHYGKKAVEAGGGGGGDLSGLNRENFQPVLLWKGKVPLDGKGRARVQVPLSDALTSFKLVAIATNGAQYFGTGEANVRTHQDLSIYPGVPQVVRTGDTFGAMFTLRNGSDKPMRVTAEVVLTPAVAQGKPLTVEIPAGGAAPVSWNLTAPNAAGKLSWTVSAKSADGKAVDKVTVAQDVIPAVPVETWAATLARVGEGTSFSIAPPAGALPGFGMVDISLADTLAPPLQGVRDYMSAYPYGCLEQRTSRAIALGDTGMWNGIAGELPAYQDADGLLRYFPGEWAGSEALTAYILSITAEAGLPLPEGPRAKAIDAMKAVLDGRLRREDYGDVRLQRIAAFSALARQGAATGAMLGQLGIAPAEMPTSSLADYLAALGKVPGLANGAQLRADAEKVLRTRLVYEGTRIDLSDKGNMPWWLMSSDDEAAIKAVMVTLGRPGWQDDSAKMMVGVAMRQQRGHWGTTTGNAWGTIAARKFMAAYPAEAIAGVTTASLGSASVSRPWPLLEPQRSFSLPLPTATTPLVMRQAGGAGPWAFVRVKAAVPLTQPLMAGYKMTKQVSVVQGLVPGRHTRGDVIKVTISVEASAERNWVVINDPVPTGATVIGSLGGQSEMLNAQAGTAEGVSPNWIERGQGSWRAYYGWVPRGSFTISYVMRLNASGRFSLPATRVEAMYSPEIRAQLPNAVMTVAER
>NZ_CP024923.1|WP_158298886.1|3065045_3065732_+|hypothetical-protein
MRPLLLAPLLFLVAAAPAQDRRFMISDFERLRVDGPFEVEVVPGAPGATAFGDRVALDQVSVRSNGDTLVVSSGPLSQAGRKGTLPTLRVSSRSLRGVILNGGARVRVAEMRGARVELLQTGTGTLEIASIRTDDLNASLTGTGTMTLAGTAQRARIRNYGAGSIDASGLTAGDASLTSESSGNIRIDVRFTARATALASGGITITGKPECTLRGPGPMACSGTIVRR
>NZ_CP024923.1|WP_100282717.1|3065728_3066391_-|ligase-associated-DNA-damage-response-endonuclease-PdeM
MVPLSFGSHDFEALAEGALYWRARRALLVADLHFEKGSWFASKGQMLPPYDSLATLSQLAALVDRTGAAELWCLGDSFHDSAGCERLPADARALLTGLTARLDWRWITGNHDSLLVDHCGGTILEEAEVDGLVLRHEAVPGEPRPELSGHFHPKLRISVRGRQVARRCFVATATKLILPAFGALTGGLDAHHPEIVRAVGRGAQALVALDDRLLRFPLAA
>NZ_CP024923.1|WP_029936734.1|3066507_3066873_-|50S-ribosomal-protein-L20
MARVKRGVTTRAKHKNILEQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGLTYSQFMHGLKLAGIELDRKVLADIAMHEGEAFSAIVAQAKAALPQAA
>NZ_CP024923.1|WP_100282718.1|3066885_3067089_-|50S-ribosomal-protein-L35
MPKLKTKSGVKKRFKFTATGKIKHGFAGKRHRLISHNAKYIRQNRGTSVLAHADTARVVGWAPYGLK
>NZ_CP024923.1|WP_100282719.1|3067305_3069447_+|AsmA-family-protein
MADRDSSITTPEAAPPIGDSPARPAHAPGTPLASIIAVVTTLLGLIVLAWTVLFVTKGRFLKSTFERIAAAQTHRNVHVAGDFQLYFAPFNVKFLAEGLTVSNPEWAGRGNFFSAKKIDTRISTWSLFAHKYRFNWVGIEDGHVDLQWDKAGERNTWTFSQKKKGDPFELPAIRRALVQGTLVRYVDPRMQIEAAIRVHTVEATDTKVANAVRFDGNGTARGTRFTLNGALLSPNATVSGGENELQLHVEGVRTNIDVSGTLPGATELEGADLHVDARGQNLADIFAVFGIAVPDTRNYRLRAATTKRGDEWRFTGLRGRFGASDLSGKFTVALKEPRLLLTADLATRVLDIIDAGPFIGYSPQASAAGAVVTQAAGTPRILPDAPLRVESLKNFDAKVNWTVRTVRAEKLPISNITLGLDLDNRLLKLSPLNFSLARGTVNSDITINARRQPVFTDYDIRLSPTPMGVLLAGFGVEESGTTGTLKARVQLTGSGNSVHDSLANSNGRIAVILPKGSFWTRNIQLSELDIGTFVQKMFEKKLKEPVQINCGLIGFSVRGGIAAADPILIDTQKNVMLGRGGFSFKNETIDMAFRADSKKFSLFAGQSPVSIGGYFARPSFNVISPELIGRAGAGIGLALVASPLAAVIAFVDVGDAKAADCGPVLAGASAGGQRTDKGKPRDDVGKGTTAKSEDGKRSKGDRQKQRKKFLGIF
>NZ_CP024923.1|WP_100282720.1|3069485_3069893_+|VOC-family-protein
MADEQDPMHGVTAHLTIRDGKGSAAVDFYQAAFGAEEIGRHLAEDGTRIMHSHLKINGGSLMLNDDFPEYTGGVAVPAGVTLHIHTEDADQWWERALAAGATVRMPLDNQFWGDRYGQLDDPFGHHWSIGGPLKA
>NZ_CP024923.1|WP_100282721.1|3070053_3070836_-|histidinol-phosphatase
MPVSSNDIALAERLADAAGAAIRPRFRGSFGLEAKDDLSPVTLADREAEEAMRRLIVAERPMDGIIGEEFGIREGSSGRQWVLDPIDGTRAFIAGRPIFGTLIALLEDGWPVLGIIDQPIIGERWLGVAGRPTLFNGKPAQARACRELKGAILATTSPALFDDDQLHAFEHLDAAVMSTVLGGDCYNYGCVASGWMDVVVEAGLKLHDFAALVPVVEGAGGRMCDWQGDPLHAGSNGEVIAAGDPARVEDILEALACRGH
>NZ_CP024923.1|WP_100282722.1|3070901_3071960_+|phospholipase
MRLFLLAIAVSLATPAAAQLRAVPAQPASEVEALRGVEVFLVNESAAPIVDSGPRQIEVTAVDGTRLVLERVPGPTPVIAPGSFAKARYVPVSVAQAAVPPSAQHPAAIIPAEETVVQSSTGTSAAFVDRFEPHEPIYGVFGTGDAGGKLQVSFAFRPFAEDAPLKLGNLRFAYTQTMFWALREPSGPFRSTNYSPEVYADIPFNESTRVALGWRHDSNGRGMVNSIDVNRIFGRVEKSFDLGGDWHLDVAPQAWFYVGKFGTAPDVKDYLGYTALTAAIRQKDGLKLALTGRGNFDTRRGGAELFVSWPLAPLGGGIGFYLFGQAFTGYGEALDDYRRNDTHARIGIALTR
>NZ_CP024923.1|WP_100282723.1|3071987_3072536_+|redoxin-domain-containing-protein
MRTKLLFAALLLPLSLPVEAALAPGAVAPAFSAGGAMAGKPHSVNLKAALKKGPVVLYFFPAAFTGGCNAEAAAFAAALPDFTKAGATVIGMTAGNVDKLVAFSSEHCAGKFAVAAASPAVIKGYDVLLKKPDGTATTITSRTSYVIAPDGHIVFAHTDMNPGSHIRLTLDAVRKLKAGKRG
>NZ_CP024923.1|WP_100282724.1|3072671_3073703_+|GGDEF-domain-containing-protein
MAGARAVRAAQGSDPSRRLYDRIGDFLVDQRLDADPANYAFAYHLLANPNGPLARAVTTLTDGGVRLTQRDIETLGCEIQPGAVAKGAKEKADGLVARTQMQVEGFQDMVTAMRAETEDFGRDLAASAEAISRSTDASGAPMIDEVARLTTAMLDRVRSAETRLESATQEASDLRRELEEARDNARRDPLTDLPNRRALEEAYKAQSASGSPICVAVCDVDHFKSVNDRFGHAVGDRVLKAIAEALSHTCSGHLVARYGGEEFAVLFAGVDLARARDILDAARVKVATKRYRLRESDAPLGEITFSAGISVALPGDGLSTVFHRADRLLYAAKTAGRNRLHID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP024923_1	1.4\|3064884\|31\|NZ_CP024923\|CRISPRCasFinder	3064884-3064914	31	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	316879-316909	7	0.774
NZ_CP024923_1	1.4\|3064884\|31\|NZ_CP024923\|CRISPRCasFinder	3064884-3064914	31	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	787774-787804	9	0.71

1. spacer 1.4|3064884|31|NZ_CP024923|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 7, identity: 0.774

tgtcttcggcaccgtcaaggggccggcttcg	CRISPR spacer
cccttccggcaccgtcaacggaccggcttcg	Protospacer
. ..*.************ **.*********

2. spacer 1.4|3064884|31|NZ_CP024923|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 9, identity: 0.71

tgtcttcggcaccgtcaaggggccggcttcg	CRISPR spacer
cctcttcggcaccggcaacgggccggagggc	Protospacer
. ************ *** *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3540611 : 3584597

Catovirus(23.08%)

tail,head,portal,tRNA,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100283107.1\|3540611_3542198_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0S9J5	Catovirus	9.0e-54	30.1
WP_100283108.1\|3542131_3543091_-	sterol desaturase family protein	NA	NA	NA	NA
WP_100283109.1\|3543101_3543491_-	hypothetical protein	NA	NA	NA	NA
WP_100283110.1\|3543487_3543916_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_100283111.1\|3543912_3545685_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	6.3e-72	35.1
WP_100283112.1\|3545801_3547253_+	ATP-binding protein	NA	NA	NA	NA
WP_100283113.1\|3547317_3547929_+	hypothetical protein	NA	NA	NA	NA
WP_100283114.1\|3547892_3548858_-	alpha/beta fold hydrolase	A0A249XU20	Mycobacterium_phage	5.4e-09	25.0
WP_100283115.1\|3548938_3549211_+	N-acetyltransferase	NA	NA	NA	NA
WP_100283116.1\|3549212_3551033_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.5e-41	28.5
WP_100283117.1\|3551126_3551366_+	hypothetical protein	NA	NA	NA	NA
WP_100284466.1\|3551374_3552304_-	phytoene/squalene synthase family protein	NA	NA	NA	NA
WP_100283118.1\|3552312_3552894_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	1.7e-13	36.4
WP_100283119.1\|3552890_3554369_-	phytoene desaturase	NA	NA	NA	NA
WP_100283120.1\|3554365_3555523_-	lycopene beta-cyclase CrtY	NA	NA	NA	NA
WP_158298920.1\|3555640_3556255_-	glutathione S-transferase	NA	NA	NA	NA
WP_158298921.1\|3556344_3556923_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_100284467.1\|3556964_3557486_+	DUF2585 domain-containing protein	NA	NA	NA	NA
WP_100283123.1\|3557516_3558293_+	sterol desaturase family protein	NA	NA	NA	NA
WP_100284468.1\|3558246_3558645_+	DUF2141 domain-containing protein	NA	NA	NA	NA
WP_100283124.1\|3558680_3559178_-	calcium-binding protein	NA	NA	NA	NA
WP_100283125.1\|3559188_3560214_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_100284469.1\|3560232_3560892_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	7.4e-26	45.0
WP_100283126.1\|3561000_3561507_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	9.6e-34	49.0
WP_100283127.1\|3561503_3562412_-	farnesyl-diphosphate synthase	NA	NA	NA	NA
WP_100283128.1\|3562416_3562662_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_100283129.1\|3562749_3564129_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_100283130.1\|3564157_3565834_-	AMP-binding protein	A0A1V0SBX8	Catovirus	9.0e-28	23.5
WP_100283131.1\|3565866_3566073_-	hypothetical protein	NA	NA	NA	NA
WP_100283132.1\|3566125_3567808_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.8e-13	35.6
WP_100283133.1\|3567916_3569116_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_100283134.1\|3569105_3570173_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_100283135.1\|3570176_3572324_-	TonB-dependent receptor	NA	NA	NA	NA
WP_100284470.1\|3572408_3572753_-	hypothetical protein	NA	NA	NA	NA
WP_100283136.1\|3572982_3573495_+	hypothetical protein	NA	NA	NA	NA
WP_100283137.1\|3573484_3574819_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	4.7e-64	38.7
WP_100284471.1\|3574993_3575434_-	hypothetical protein	NA	NA	NA	NA
WP_100283138.1\|3575948_3576617_+	spermidine synthase	NA	NA	NA	NA
WP_100283139.1\|3576684_3576954_+	hypothetical protein	NA	NA	NA	NA
WP_100283140.1\|3577174_3578284_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.6e-47	35.9
WP_100283141.1\|3578497_3578806_+	hypothetical protein	K4I011	Acidithiobacillus_phage	7.2e-08	47.4
WP_100283142.1\|3578802_3579174_+\|head,protease	HK97 family phage prohead protease	NA	NA	NA	NA
WP_100283143.1\|3579237_3580638_+	hypothetical protein	NA	NA	NA	NA
WP_100283144.1\|3581941_3582496_+	hypothetical protein	NA	NA	NA	NA
WP_158298922.1\|3582492_3582699_+	hypothetical protein	NA	NA	NA	NA
WP_158298923.1\|3582695_3583097_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_100283145.1\|3583107_3583515_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_100283146.1\|3583511_3583853_+	gene transfer agent family protein	NA	NA	NA	NA
WP_100283147.1\|3583852_3584041_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_100283148.1\|3584033_3584597_+\|tail	tail tape measure protein	D6PEW0	uncultured_phage	3.6e-05	36.6

DBSCAN-SWA_2

4856856 : 4865217

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100284090.1\|4856856_4857717_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.0e-68	49.3
WP_100284091.1\|4858018_4858468_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_100284601.1\|4858550_4858814_+	hypothetical protein	NA	NA	NA	NA
WP_158299032.1\|4859247_4859784_-	hypothetical protein	NA	NA	NA	NA
WP_100284092.1\|4860074_4861421_-	nucleotide sugar dehydrogenase	A7IWZ0	Paramecium_bursaria_Chlorella_virus	4.2e-36	31.0
WP_100284093.1\|4861476_4862487_-	NAD-dependent epimerase/dehydratase family protein	M1IBX1	Acanthocystis_turfacea_Chlorella_virus	2.0e-22	26.8
WP_100284094.1\|4862729_4863533_-	molybdopterin-synthase adenylyltransferase MoeB	A0A1V0SAV8	Catovirus	7.1e-15	30.4
WP_100284095.1\|4863529_4863979_-	dUTP diphosphatase	K4JSC8	Caulobacter_phage	2.9e-34	53.7
WP_100284096.1\|4863996_4865217_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.4e-38	34.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP024924

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP024923

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection