CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP025030	Achromobacter spanius strain DSM 23806 chromosome, complete genome	10 crisprs	PD-DExK,DEDDh,WYL,csa3,DinG	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025030_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_1

398355-398461

Orphan

Consensus_repeat	Method
GCCGATCGCGCGAAACCCATCAAGCAGCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_1

>merge|NZ_CP025030|1|398355-398461|CRISPRCasFinder
GCCGATCGCGCGAAACCCATCAAGCAGCGCCCGTAGGATGGGTGCAGCGCGGCAGGCCCGATGCAAGAACCCCACCGCCGATCGCGCGAAACCCATCAAGCAGCGCC

>NZ_CP025030|1|1|398355-398461|CRISPRCasFinder
GCCGATCGCGCGAAACCCATCAAGCAGCGCC	CGTAGGATGGGTGCAGCGCGGCAGGCCCGATGCAAGAACCCCACC
GCCGATCGCGCGAAACCCATCAAGCAGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100853018.1\|389402_390923_+\|acyl--CoA-ligase	unknown	unknown	gnl\|CDD\|223395
NZ_CP025030.1\|WP_050447482.1\|387793_388198_+\|Zn-ribbon-domain-containing-OB-fold-protein	unknown	unknown	gnl\|CDD\|224462
NZ_CP025030.1\|WP_100853020.1\|391975_392932_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|224981
NZ_CP025030.1\|WP_050447588.1\|406069_406876_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|307807
NZ_CP025030.1\|WP_006217551.1\|406951_407347_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|272886
NZ_CP025030.1\|WP_100853023.1\|395302_396217_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187611
NZ_CP025030.1\|WP_006217557.1\|401529_402441_+\|glycine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|236473
NZ_CP025030.1\|WP_100853027.1\|400483_401251_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181325
NZ_CP025030.1\|WP_100853021.1\|392999_393995_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP025030.1\|WP_100853030.1\|405120_405843_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP025030.1\|WP_100853033.1\|410443_411673_+\|spore-maturation-protein	unknown	unknown	gnl\|CDD\|225336
NZ_CP025030.1\|WP_100853028.1\|402441_404580_+\|glycine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234925
NZ_CP025030.1\|WP_100853024.1\|396224_397085_+\|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|178455
NZ_CP025030.1\|WP_100853029.1\|404576_405116_+\|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase	unknown	unknown	gnl\|CDD\|236354
NZ_CP025030.1\|WP_100853022.1\|394251_395151_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113
NZ_CP025030.1\|WP_100853017.1\|388194_389367_+\|thiolase	unknown	unknown	gnl\|CDD\|180434
NZ_CP025030.1\|WP_100853019.1\|390981_391956_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP025030.1\|WP_100853025.1\|397081_398314_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP025030.1\|WP_100853032.1\|407362_407896_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|237227
NZ_CP025030.1\|WP_006217560.1\|398633_400157_-\|fumarate-hydratase	unknown	unknown	gnl\|CDD\|224862

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100853018.1\|389402_390923_+\|acyl--CoA-ligase	gnl\|CDD\|223395	COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	2.98267e-130
NZ_CP025030.1\|WP_050447482.1\|387793_388198_+\|Zn-ribbon-domain-containing-OB-fold-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	1.30931e-23
NZ_CP025030.1\|WP_100853020.1\|391975_392932_+\|nitronate-monooxygenase	gnl\|CDD\|224981	COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only].	3.00709e-78
NZ_CP025030.1\|WP_050447588.1\|406069_406876_+\|M48-family-metallopeptidase	gnl\|CDD\|307807	pfam01863, DUF45, Protein of unknown function DUF45. This protein has no known function. Members are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C-terminus being the most conserved region, containing three conserved histidines. This motif is similar to that found in Zinc proteases, suggesting that this family may also be proteases.	2.74128e-71
NZ_CP025030.1\|WP_006217551.1\|406951_407347_+\|lactoylglutathione-lyase	gnl\|CDD\|272886	TIGR00068, Lactoylglutathione_lyase, lactoylglutathione lyase. Lactoylglutathione lyase is also known as aldoketomutase and glyoxalase I. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice. [Central intermediary metabolism, Amino sugars, Energy metabolism, Other].	2.6648e-78
NZ_CP025030.1\|WP_100853023.1\|395302_396217_+\|SDR-family-oxidoreductase	gnl\|CDD\|187611	cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs. Beta oxidation of fatty acids in eukaryotes occurs by a four-reaction cycle, that may take place in mitochondria or in peroxisomes. (3R)-hydroxyacyl-CoA dehydrogenase is part of rat peroxisomal multifunctional MFE-2, it is a member of the NAD-dependent SDRs, but contains an additional small C-terminal domain that completes the active site pocket and participates in dimerization. The atypical, additional C-terminal extension allows for more extensive dimerization contact than other SDRs. MFE-2 catalyzes the second and third reactions of the peroxisomal beta oxidation cycle. Proteins in this subgroup have a typical catalytic triad, but have a His in place of the usual upstream Asn. This subgroup also contains members identified as 17-beta-hydroxysteroid dehydrogenases, including human peroxisomal 17-beta-hydroxysteroid dehydrogenase type 4 (17beta-HSD type 4, aka MFE-2, encoded by HSD17B4 gene) which is involved in fatty acid beta-oxidation and steroid metabolism. This subgroup also includes two SDR domains of the Neurospora crassa and Saccharomyces cerevisiae multifunctional beta-oxidation protein (MFP, aka Fox2). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.16944e-101
NZ_CP025030.1\|WP_006217557.1\|401529_402441_+\|glycine--tRNA-ligase-subunit-alpha	gnl\|CDD\|236473	PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated.	0
NZ_CP025030.1\|WP_100853027.1\|400483_401251_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181325	PRK08252, PRK08252, crotonase/enoyl-CoA hydratase family protein.	8.17705e-156
NZ_CP025030.1\|WP_100853021.1\|392999_393995_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.23348e-141
NZ_CP025030.1\|WP_100853030.1\|405120_405843_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	4.35485e-48
NZ_CP025030.1\|WP_100853033.1\|410443_411673_+\|spore-maturation-protein	gnl\|CDD\|225336	COG2715, SpmA, Uncharacterized membrane protein, required for spore maturation in B.subtilis. [General function prediction only].	1.77693e-74
NZ_CP025030.1\|WP_100853028.1\|402441_404580_+\|glycine--tRNA-ligase-subunit-beta	gnl\|CDD\|234925	PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.	0
NZ_CP025030.1\|WP_100853024.1\|396224_397085_+\|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase	gnl\|CDD\|178455	PLN02864, PLN02864, enoyl-CoA hydratase.	1.35343e-65
NZ_CP025030.1\|WP_100853029.1\|404576_405116_+\|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase	gnl\|CDD\|236354	PRK08942, PRK08942, D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.	1.00111e-107
NZ_CP025030.1\|WP_100853022.1\|394251_395151_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.98056e-73
NZ_CP025030.1\|WP_100853017.1\|388194_389367_+\|thiolase	gnl\|CDD\|180434	PRK06158, PRK06158, thiolase; Provisional.	0
NZ_CP025030.1\|WP_100853019.1\|390981_391956_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	3.60687e-123
NZ_CP025030.1\|WP_100853025.1\|397081_398314_+\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	1.22069e-166
NZ_CP025030.1\|WP_100853032.1\|407362_407896_+\|peptide-deformylase	gnl\|CDD\|237227	PRK12846, PRK12846, peptide deformylase; Reviewed.	2.75046e-94
NZ_CP025030.1\|WP_006217560.1\|398633_400157_-\|fumarate-hydratase	gnl\|CDD\|224862	COG1951, TtdA, Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain [Energy production and conversion].	2.93606e-138

>NZ_CP025030.1|WP_100853025.1|397081_398314_+|CoA-transferase
MTRPPALDGIRVLDLSRILAGPWCTQNLADLGADVIKIERPGVGDDTRAWGPPYLKDANGQDTSESAYYLSTNRNKRSVEADMATPAGAALIRELAAVSDILVENFKVGGLKKYGLDYDSLKAINPRLIYCSVTGFGQDGPFAQRPGYDFMIQGMGGLMSITGERDDLPGGGPQKAGVAVTDIVTGMYATVAILAALQERHRSGLGQHLDIALLDSHVALLANQNSNYFNSGVAPTRAGNAHQNVVPYQVFAASDGHLIVATGNESQYRAYCRAIGVPELGDDPRFATNRLRVTNREELIGILTAIMQEGRRDDWIAKLEAVGVPCGPINNIAQAFAHPQAEARQLRRDLPHPLGGTAPVTASPLRFSDSPVVYRRAPPLLGEHTEEVLREVLNKSPAAIAELKKSADGR
>NZ_CP025030.1|WP_100853024.1|396224_397085_+|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase
MPLDYATVKDWRFDEVRQRYDQKDTMLYALGIGLGQDPEDTRQLRYVYEEGLQAFPTMGVVLAYPGFWVRDPRTGIDWVKVVHGEQRLTVHAPLPASGMVVSRTRNTHVIDKGADKGAIVINERTLHGEDGACLATLRQSTFCRGDGGFGQGDASPEPLPATPDGEPDLRCELRIAPNAALLYRLNADPNPLHVDPEVARQAGYPRPILHGLCSYGVAAHAIVKSCCDYDASRLTSLNTRFSAPVYPGETLQCDIWRQANGQIQFLARSRERNVVVMSHGTATVQP
>NZ_CP025030.1|WP_100853023.1|395302_396217_+|SDR-family-oxidoreductase
MSGIVSGKVVVVTGAGGGIGRSIALAMAEAGAKVVVNDIGVSLTGEGGAEGPAQEVVREIVAAGGQAVANTDSVAAYDSASRVVQTAIDAFGRIDAVINNAGNLRDRVFHKMSEEEWRQVIDVHLNGSFFMSRAAAPYFREQESGAFVHMTSTSGLIGNFGQANYAAAKLGIVALSKSIALDMARYNVRSNCIAPFAWSRMTSSIPAETDEEKARVEKLKKMEAGKVAPMAVFLASDAASEVTAQIFAVRANEIMLISQPRPLRTVHHSEGWTPERIADIAVPAMRKHFYALERSPDVIDWDPI
>NZ_CP025030.1|WP_100853022.1|394251_395151_-|LysR-family-transcriptional-regulator
MRHDLTDLRLFLNVGETLNLTRAAERTFLSLPAASARVKHMEEAFKARLLVRLATGVALTPAGEVLLKHANAVFRQLECLNADLQPYASGLKGRLRLLANTTATNSFLADALSTFLAENPDVDVELEEKISGDIVIAIRAGAGDLGLVAGNIDVEGLDVTPLFRDELTVVTSLDHPLAASKSAHFVDLVDAYQFVGIHPDSAIQTFLEDIASGLGKRICQRVHVGSFEAVCRMVEAGAGIAVVPRACAARYSRPDALHVLKLEDPWALRDRLLCRQRGRDLPSFAECFIEHVQRAARGQ
>NZ_CP025030.1|WP_100853021.1|392999_393995_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MIDPQRRRVLAGLGATCASAVLPTLFSSVARAATWPGHAVTFIVPFPAGGPVDTTARFTTQPLGQMWSVPTVVDNKSGAGGIVGAQFAAKAAPDGYNFFFASIHHAVLPSLRNNLTYDITTDFVPVGMAAVFPIVLVVNASMPVNTVSELIAYAKQHPGKLSFGSSGTGGGTHLAGELFNAMAGTRIQHVPYRGSAPAMQDLLGGQVQVMFADGPSAVPHLSGGKVRALGVGNPTRSSMLPNVPTIAESGLPGYEAYSWSGVMAPKGTPPDIVKRMNADMVKVLSDPATAKGMIAAGAEPKPGTPEQFGEFVRNEIVKWRDLIKTANIKLE
>NZ_CP025030.1|WP_100853020.1|391975_392932_+|nitronate-monooxygenase
MHPPLALRAQTRLPIIGAPMFLVSGPELVVAQCAAGIIGTFPSLNARPQEQLQDWLTRIEDGLAARRRAHPTAKVAPYGVNLIIHPSNPRWQGDLAICAERRVPLIITSLHAPEAVVQAVHPYGGLVYHDVTNVRHAKRALEAGVDGLILVAAGAGGHAGQINPIALINEIRAFYDGPLALSGCISHGKDVLAAEVLGCDFAYMGTRFIATQESLAGDSYREMVLQAQAADVTYTPYFSGVPANYLSASILAAGLDPVALSRNGEAPPANMDKNSRPKAWKDIWSAGQGVGAAQEILSIATLVDQLEAEYRGARAALR
>NZ_CP025030.1|WP_100853019.1|390981_391956_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKLKTLFAVAAATAAFAMASSASAQAYPDRPIRLLVGYAPGGPVDTTARVFAKYLGDKLGQTVVVENRAGASGMIASDATAKASPDGYLLGFAASPTLTMSPLVQRSKLFDPRSDFSLIGLVVDYANVLLIGPQIPAKNVGDLVNYARSHPDAVSFGSAGIGASNHLSAELLKKQADAPMLHVPYRGNSPAMMDVVSGKVTFMFDITSTAIPFIKSGKARALAVTSKTRNPELPDVPTMIEAGMKDYEVVGWYALVGPKKLPDAVSARLTRALQDVSQDPAFRKAMTEGGYAINTGDSKALQARIDREYALWSDVIQSANIQAN
>NZ_CP025030.1|WP_100853018.1|389402_390923_+|acyl--CoA-ligase
MSHAEPLTRIHELLARQARQQPDAVVLYEEGGGALTYAQLWQRVQAVAEWLRDQGVQPGHRVLMVGENCTAMIAALFGCGVAGAWPVGVNARLSAREVDNIRQHAQPELLLYTTGVSGAAADHAAAAGAVDADPAVWGPGVQAARTATPTLAESGALASEVATVIYTSGTTGAPKGVLVPHRGLLHFARVSAASRRLTPHDIGYAALPMSHIFGIATVLMATLHAGASLVLRSRFDAEDAFKALAHPGVSILQGVPTMFSRMMAVAPPRADLRAPALRYLYTGGAALDPTLKRDAERYFGVAMHHGYGITEYAGSMFITRIDEPRDDCSAGYAVDGVELRLGSPDADAPKPGERGDILIRGPGVMLGYYRSPEQTQQALLPGGWLNTGDIGYVDDSGALFIAGRSKDLIIRSGFNVYPIEVESVINAFPGVRLSAVVGRNTADQNEEVIAFVEPLPGAKVDTELLMLHLRAQLAPYKRPARIIPIDTIPTTVSGKILKQPLKERLA
>NZ_CP025030.1|WP_100853017.1|388194_389367_+|thiolase
MTLNDLRGAVAVAGVGHAGLGQANGFTEMEILVQAAQRAVADAGLTLRDIDGICTASVAAPMWAMPVIEHLGIRPTFIDSTMLGGSSFVAHLLPAMHALASGQCNAVLVCYGSTQRTSTLSRAEVGRVRKQFDPQPYETPYDPLSPLSSYALAAARHMHQYGTRREHLAQVALAANQWAQLNPEAQLREPTTLDQILSARMVSDPLSVRDCCLVTDGAGAFVLVRADRARDLPRPPVYVLGNATAVWNRQISSMHDLTVTAAAQSGKQAFEMAGVSPRDIDVVELYDAFTINTLLFLEDLGFCAKGEAKDFIADGAIAPGGRLPVNTNGGGLCCVHPGMYGVFIMIEAVRQLRGECGARQVADAQLALVHGNGGTLSSQSTAILGTQATL
>NZ_CP025030.1|WP_050447482.1|387793_388198_+|Zn-ribbon-domain-containing-OB-fold-protein
MTVSDPKESVSQGVEAQYRQALDQGRFLIQHCGGCDRAVFYPRMVCPHCGADKLAFAPADGRGTVYSTTVVRRKPEAGGDYNVALIDLQEGVRLMSRVEGVAPADVRIGMAVRARVIQQDGHGLVVFDPTQEAA
>NZ_CP025030.1|WP_006217560.1|398633_400157_-|fumarate-hydratase
MSVIIKEEDFIQSIADGIQFISYYHPVDYIRHLARAYEREESPAARDAMAQILTNSRMCAEGKRPLCQDTGIVNVFLKIGMSVRFDTKRTLQELCDEGVRRGYLNPDNPLRASVLDDPLFARKNTRDNTPCILHVELVQGDKVDVQIASKGGGSENKSKFAMLNPSDSLVDWVLKTVPTMGAGWCPPGMLGIGVGGTAEKAMLMAKQSLMEDIDMYELLARGPQNKLEELRIELYEKVNALGIGAQGLGGLTTVLDVKISTFPTHAASKPVAMIPNCAATRHAHFELDGTGPARLDPPSLSEWPEVHWAPDYNKSKQVDLNTLTKEEVASWKPGQTLLLSGKMLTGRDAAHKRIQDMLAKGEPLPVDFTNRVIYYVGPVDPVGDEVVGPAGPTTATRMDKFTDMMLEKTGLISMIGKSERGPVAIEAIKKHGSAYLMAVGGAAYLVSKAIRGAKVLGFADLGMEAIYEFDVKDMPVTVAVDAKGTSVHTTGPKEWQAKIGKIPVAVA
>NZ_CP025030.1|WP_100853027.1|400483_401251_-|crotonase/enoyl-CoA-hydratase-family-protein
MSDLITVEVTDGIQIITINRPEAKNAINLETAQAMAAALDQLDSRDDIRIGILTGGGGTFSSGMDLKAFAKSGQRPYVEGRGFAGLNERPPKKPLIAAVEGYALAGGCEMALASDLIVAASNAKFGLPEVKRGLVAGAGGMLRLPRRLPYHIAMEVILTGEMLTAERAYSFGLVNRLTEPGGALTGALELARAIVENGPLAVQTAKSIVSQAVDWEQEGMFDRQRPLIAHIFSSADAKEGATAFAEKRKPVWQGK
>NZ_CP025030.1|WP_006217557.1|401529_402441_+|glycine--tRNA-ligase-subunit-alpha
MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPPDILDLYIGSLKALGIDPTQHDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVQSVYDLVWTEGANGNRVLYRDVFHQNEVEQSTYNFEHSSADMLFAHFNDYEAEAKRLMDVPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYFDSRERLGFPMLRRNQAAGEAA
>NZ_CP025030.1|WP_100853028.1|402441_404580_+|glycine--tRNA-ligase-subunit-beta
MTTNIRPLLVELLTEELPPKALQKLGQAFAEGVRATLERHGLLAEGCAVTAYSTPRRLAVHLSAVLAQAPDQPYAEKLMPAKIGLTEDGRATPALQKKLAAKGLENIDLATLDRESDGKQDYLVARGTAPGSSLAAGLQEGIDTALNSLPIPKVMRYQLADGVTTVKFVRPAHGLVALFGADVVPVSALGMQAGRDTLGHRFMCAGPVSFTDADSYAATLAEKGRVVASFEGRRDDIQRQLLDHAGRLSATLGDDPEVAALLDEVTALVEHPTVYVGQFEEQFLQVPQECLILTMRLNQKYFPLFDPATGRLTHRFLIVSNMHTDKPVNIVEGNQRVVRPRLADAQFFFETDRKTPLASRVEQLGSIVYHNKLGTQLERVERVRAIARGVAEQLGGDVSAADRAAMLAKADLGSNMVGEFPELQGIMGAYYAAGDGEPASVVEALRTQYRNRYDAPVTQDTLTAATLFIAERVETLVGIWAIGLAPTGERDPFGLRRAALGLISAFEQLAAGGWLKVSQDGPLSLNGLLELAAGTFPAGKIPADTLAEVRAFIYERYRNQLINDFDRNAVEAVIALTPPLHQVAERVRAAAAFAQLPEAASLAAANKRIGNLLKKAEGEIGAVNEAALVEPAERALAATVAKLRPQAEAQLAAGDFAGSLSTLAQAREPVDAFFADVMVMAEDPAVRANRLALLSQLHGLMNQVADISRLAQ
>NZ_CP025030.1|WP_100853029.1|404576_405116_+|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase
MKLIILDRDGVINQDSDAFVKNPDEWIALPGSLQAIARLTQADWKVVVATNQSGLARGLFDMDTLTAIHTKMRRELAAVGGAVDAVFLCPHGPDDNCTCRKPRPGLFEQIGHRYDINLAGVPAVGDSLRDLQASSAVGCAPWLVQTGNGKKTLAKGGLPENTRVCEDLSAVADILLQDN
>NZ_CP025030.1|WP_100853030.1|405120_405843_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MARLRSLLYFLFLAITVIPYAFLCILWTPLPLHWRYKLTVGWPRLAIWGAKVFCGIRWQVKGWENLPEGPAVILSKHQSAWETLFFPAHMPREVCFVYKKELHMVPFFGWGLALLRMIAIDRSKGRDAFDQVVKQGQTRMDEGRWPLLFPEGTRVAPGKTARFKMGGALLASRTGAVVIPVAHNAGECWRRNAFVKYPGMVTLSIGPAIESKGLSPDELNLKVQEWIEGEMRRLNPERYA
>NZ_CP025030.1|WP_050447588.1|406069_406876_+|M48-family-metallopeptidase
MTLSPNASSRVPTPCPDPLPPGARWREVPTEQQPIGFVLLRSRRRSIGFVITDDGLRVTAPSWVTLTQIDDAVREKARWILTKLREWHARKQQLAIAHTRWQAGGELPYLGKRIVLGVGGDSRQSRLSGDADAPQDGDTLLLALPSAADQSRIRDAAQAWLQQRAGAWFGARLAHFLQISGLKIRRWRLSSAATRWGSCTSDGNIMLNWRLIHFAPGIIDYVIAHELAHLREMNHSQDFWREVGQILPDFEDAKNILRRHDPASLPQF
>NZ_CP025030.1|WP_006217551.1|406951_407347_+|lactoylglutathione-lyase
MRMLHTMLRVGNLDKSIDFYTNVLGMRVLRRNDYPDGKFTLAFVGYQDESEGAVIELTHNWDTDKYDLGNGYGHIALEVDNAYEACDKVKERGGKVTREAGPMKHGKTVIAFVEDPDGYKIEFIQKKGRQD
>NZ_CP025030.1|WP_100853032.1|407362_407896_+|peptide-deformylase
MIHPILKMGDPRLLRVAPPVERFDTPELHALIDDMFETMAAAQGVGLAAPQIGVDLQVVIFGFERNERYPDAPPVPQTILCNPVITPLSDEMQDGWEGCLSVPGLRGLVPRYRHVRYSGRDPYGQLIEREAEGFHARVVQHECDHLIGRLYPSRIQDFSKFGFTEILFPGMDPNADD
>NZ_CP025030.1|WP_100853033.1|410443_411673_+|spore-maturation-protein
MLNKLWLGFFLTAAAAALYRWLAIGDPDVFRLMVASLFDMARVSVEVMVLLFGTLTLWLGFLRIAERAGLVEKLAHLLGPLFARLMPEVPRNHPAIGLITLNFAANGLGLDNAATPIGLRAMRELQSLNPTPETASNAQILFLVLNASSLTLLPVTLFMFRAQQGAADPTLVFLPILLATSASTLAGFLAVAACQRLRLTDPIVMLWLGGAALVLGGFMALLASMSAAAIASLSSLMGNLALFGILLAFLVVGAWKKVPVYEAFIDGAKEGFDIAKSLLPYLVAMLCAVGVLRASGALDFLLDGIRWMTLQAGWDTRFVDALPTALVKPFSGSAARAMMLETMTHYGVDSFPALLAAVMQGSTETTFYVLAVYFGSVGILRARHAVGCALIADAAGVMAAIGVCYWFFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_2

704649-704750

Orphan

Consensus_repeat	Method
CGTAGGATGGGTGAAGCGCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_2

>merge|NZ_CP025030|2|704649-704750|CRISPRCasFinder
CGTAGGATGGGTGAAGCGCGGCAGGGCCGCAAAAAGAACCCCACCCACGACCGCGCGCAACCCATCAAACAGCCACACCCGTAGGATGGGTGAAGCGCGCCA

>NZ_CP025030|2|2|704649-704750|CRISPRCasFinder
CGTAGGATGGGTGAAGCGCGGCA	GGGCCGCAAAAAGAACCCCACCCACGACCGCGCGCAACCCATCAAACAGCCACACC
CGTAGGATGGGTGAAGCGCGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_167401082.1\|698619_699477_+\|TonB-family-protein	unknown	unknown	gnl\|CDD\|367555
NZ_CP025030.1\|WP_100853228.1\|691836_694335_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|223715
NZ_CP025030.1\|WP_100857484.1\|714078_714480_-\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NZ_CP025030.1\|WP_100853242.1\|709102_709777_-\|RraA-family-protein	unknown	unknown	gnl\|CDD\|180465
NZ_CP025030.1\|WP_100853237.1\|704808_705534_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP025030.1\|WP_100853235.1\|701159_702338_+\|LPS-export-ABC-transporter-permease-LptG	unknown	unknown	gnl\|CDD\|275201
NZ_CP025030.1\|WP_100853229.1\|694441_695539_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224753
NZ_CP025030.1\|WP_100853234.1\|700342_701068_+\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	unknown	unknown	gnl\|CDD\|234603
NZ_CP025030.1\|WP_100853238.1\|705530_706247_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP025030.1\|WP_100853241.1\|707888_709106_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|180403
NZ_CP025030.1\|WP_100853230.1\|695600_697379_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP025030.1\|WP_100853233.1\|699473_700337_+\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
NZ_CP025030.1\|WP_100853231.1\|697371_698460_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP025030.1\|WP_100853245.1\|711663_712989_-\|dihydroorotase	unknown	unknown	gnl\|CDD\|181059
NZ_CP025030.1\|WP_100853236.1\|702334_703168_+\|symmetrical-bis(5'-nucleosyl)-tetraphosphatase	unknown	unknown	gnl\|CDD\|234673
NZ_CP025030.1\|WP_100853240.1\|706978_707806_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270407
NZ_CP025030.1\|WP_100853239.1\|706248_706950_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP025030.1\|WP_100853243.1\|709992_710883_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP025030.1\|WP_100853244.1\|710926_711667_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP025030.1\|WP_100857483.1\|703271_704543_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_167401082.1\|698619_699477_+\|TonB-family-protein	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	3.43479e-11
NZ_CP025030.1\|WP_100853228.1\|691836_694335_+\|extracellular-solute-binding-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	4.92103e-46
NZ_CP025030.1\|WP_100857484.1\|714078_714480_-\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	2.33938e-55
NZ_CP025030.1\|WP_100853242.1\|709102_709777_-\|RraA-family-protein	gnl\|CDD\|180465	PRK06201, PRK06201, hypothetical protein; Validated.	6.49522e-88
NZ_CP025030.1\|WP_100853237.1\|704808_705534_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.96419e-156
NZ_CP025030.1\|WP_100853235.1\|701159_702338_+\|LPS-export-ABC-transporter-permease-LptG	gnl\|CDD\|275201	TIGR04408, LptG_lptG, LPS export ABC transporter permease LptG. Members of this family are LptG, one of homologous, two tandem-encoded permease genes of an export ATP transporter for lipopolysaccharide (LPS) assembly in most Gram-negative bacteria. The other permease subunit is LptF (TIGR04407). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	2.39452e-89
NZ_CP025030.1\|WP_100853229.1\|694441_695539_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|224753	COG1840, AfuA, ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism].	3.56277e-48
NZ_CP025030.1\|WP_100853234.1\|700342_701068_+\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	gnl\|CDD\|234603	PRK00056, mtgA, monofunctional biosynthetic peptidoglycan transglycosylase; Provisional.	7.3868e-120
NZ_CP025030.1\|WP_100853238.1\|705530_706247_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	3.60328e-74
NZ_CP025030.1\|WP_100853241.1\|707888_709106_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|180403	PRK06107, PRK06107, aspartate transaminase.	0
NZ_CP025030.1\|WP_100853230.1\|695600_697379_+\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	1.1911e-101
NZ_CP025030.1\|WP_100853233.1\|699473_700337_+\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	1.19904e-114
NZ_CP025030.1\|WP_100853231.1\|697371_698460_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	2.42863e-137
NZ_CP025030.1\|WP_100853245.1\|711663_712989_-\|dihydroorotase	gnl\|CDD\|181059	PRK07627, PRK07627, dihydroorotase; Provisional.	0
NZ_CP025030.1\|WP_100853236.1\|702334_703168_+\|symmetrical-bis(5'-nucleosyl)-tetraphosphatase	gnl\|CDD\|234673	PRK00166, apaH, symmetrical bis(5'-nucleosyl)-tetraphosphatase.	4.3639e-153
NZ_CP025030.1\|WP_100853240.1\|706978_707806_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270407	cd13689, PBP2_BsGlnH, Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.1713e-99
NZ_CP025030.1\|WP_100853239.1\|706248_706950_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.69024e-70
NZ_CP025030.1\|WP_100853243.1\|709992_710883_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.02261e-37
NZ_CP025030.1\|WP_100853244.1\|710926_711667_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	6.78696e-39
NZ_CP025030.1\|WP_100857483.1\|703271_704543_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.66662e-136

>NZ_CP025030.1|WP_100857483.1|703271_704543_-|IS256-family-transposase
MPMKKRRTAAAQAAARGPLPEVPAELLDHLVKGPMTPSEVQDLFLSFQKAVIERTMAAEMNLHLGYRPGEDKPEGQANERNGASGKTVLTEHGPVRVELPRDRDGSFAPILIPKHERRFTGFDDRIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMTETIAWQNRPLEAMYPVVFFDALRVKIRDDGGVSNKAVYLALGVQADGQRDVLGLWVEQTEGAKFWLKVFNDLKTRGCQDILIAVVDGLKGLADAIGAAFPRTTVQTCIVHLIRNSLDYAGWKDRKAVAAALRPIYAAASEQAAEQALQTFADGPWGIKYPTIVQAWQRAWENVTPFFVFPPDIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRATFDWKAAMNQFAILFGERFTAVRG
>NZ_CP025030.1|WP_100853236.1|702334_703168_+|symmetrical-bis(5'-nucleosyl)-tetraphosphatase
MNGSIWMIGDVQGCCSPLDRLLAHPDLVGDPRSRFWFAGDLVNRGPQSLDTLRRIIDLGDRATSVLGNHDLHLLAAAAGVRKPSKSDTLDEILRAPDATALINWLRFRPLAHFEQGHLLVHAGTLAKWDVAKTLALAGEVQDALRGPNWQKALQKMYGNEPATWKEDHKGGKRMRVIINALTRIRLCTPNGHMEFATKVAPGAWPPGLVPWFDVPNRATRDITTVFGHWSTLGLLQRPDVICLDTGCVWGGSLTALRLQDRKLVQVKCSQFQDPLSE
>NZ_CP025030.1|WP_100853235.1|701159_702338_+|LPS-export-ABC-transporter-permease-LptG
MRTARRYLAREIYRSCAVVLMALLGLFTFFALVDDLDNVGDKFSMMALLYMQALAIPTRLYDLLPIGLLIGAILALAGLAQRNELVILRVSGVSGMRLLRMLWVVTIPLMIGAALLSEYVTPWAEIKSGEANLMFRGKAGGDRLKSGYWFKEPTANGGMRIINIAELKGDGQVAGITLYEFKKDQTLTALSTAPTGLFAHGDLVLKDVSETRLDDDAADALADARQPKNPPASVVKLPERTVDTTLSAERLLARVLTPERMSIVTLLDYVEYLRDNQLQYGRQVVALWRKLAYPFTLLVMITIAAPIGLMQTRRGGVGAKVFIGILLGVGFFMLNQLALNVGMLGKWPPWFTALGPNLGAMALALGAMSYMEYRHTITRIVQQRWPWSKSPA
>NZ_CP025030.1|WP_100853234.1|700342_701068_+|monofunctional-biosynthetic-peptidoglycan-transglycosylase
MATRKQGRSWFRITTGVLMALVCAVLLYQFWLFSQVVWYNYRDPGSSAIMREERSRLREGNPAFQLKYEWVPYDKISRNLKRAVVASEDSRFTEHDGIEWDAIRKAWEYNQRQEEAGRSKMRGGSTITQQLAKNLFLSSSRSYIRKGQELVLTYMIEHVMSKERILELYLNVAEWGVGVFGAQAAAQHYFNTSAANLSASQSARLAAMLPNPRFYDTRRNSNYLNSRVGVLTRRMRMVDIP
>NZ_CP025030.1|WP_100853233.1|699473_700337_+|shikimate-dehydrogenase
MTEASPLARYAVIGNPIAHSRSPQIHALFSQQTGKPLSYERLLAPVDGFAEAVAGFVAEGGLGLNVTVPFKLDAYALAAGNLSTRARLAGAVNTLSWRDGAWHGCNTDGVGLVSDLLRLGVHLSDAAVLLVGAGGAARGVLQPLAQAGCARIHIVNRTAAKALELADAWRASGVSPQTQVTAGGLADAARPGGWNVVINATASGLQDAAPALPGGLYAGGAAAYDMMYGAKPTAFMKQAEADGAALTADGLGMLVGQAAESFFIWHGVRPDPAPVLAALREALAAGH
>NZ_CP025030.1|WP_167401082.1|698619_699477_+|TonB-family-protein
MRWLGAPAQHYLRIGIAISLLVHAGALAWRFGAPALTRPPVTSLEVVLLNARSETPPEAPRAQAQNQMSGGGNAEHGMTTTPLPQTGDSAETIVLEAMRKRQVQLEAEQTRLMTQLRSADKAGAERQAVNPWPDGADLGQDAEDQASVIQNAQVAALAERVQQYSNEPRKQFVAPSAEASRYAAYLDAWRARIEAIGTQHYPDEARGRIYGSLRITVSVRADGSIADVEIDQPSPHAVLNQAARRIVQLAAPFPPFPPDIARDTDVLVITRTWHFVNDTLETKAP
>NZ_CP025030.1|WP_100853231.1|697371_698460_+|ABC-transporter-ATP-binding-protein
MIELSVEDLHLDYGDNPVLKGVSMQLRQGEVVSLLGPSGSGKTTLLRAVAGLEGPKRGRITIGERVVYDGGARKEIPAEERNLGLVFQSYALWPHKTVFENVAYPLKLRKVPSAEVRDRVQAVLDQLGLGKLGQRHPHALSGGQQQRVAIGRALVYSPPVILLDEPLSNLDAKLREEARAFLRELIMRLGLSALMVTHDQSEAMAISDRILLLNNGKIEQQGTPQEMYGSPSTLFTAEFMGSNNRLEGKVIELRDGRARIEGHGWALWGKAGEGVAAGQDGTAVIRVEQVRLADDPDGNHLDMPLLTSMYLGDRWEYLFRTPDADSLNTLALRAYGPEGRDPGPSRLALPADKVWVFPRKSA
>NZ_CP025030.1|WP_100853230.1|695600_697379_+|iron-ABC-transporter-permease
MQSLRRKWQSLPRGVVVLITALAIYVPLSFIIIQSFLSAPFFAPSKVFSLDAFRFIFADPDFYKALKSGFILAFGLAIIAIPLGGMLAFLMIRTDLPGRRWIEPLILVPVFVSPMVLGFGYVVAAGPVGFFSIWAQNILGFVPWNVYSLTSIVIIAGLTHVPHAYLYISSALRSMGSDVEEAARVTGASPLRVMVSVSLPMVRPAMLYATVLLFFLGLEVFGLVLVLGDPEGNLVLATYLYKLTNKLGIPSYHLMAAVAVVLICMTIPLVMLQRRLMRTANRFVTVKGKASRARPLPLGKWRWLAGAVVAFWLLVTIVVPLMGVLLRAFVSNWGMGVSLFDVLSLEAFRTVFAQPNLIRAIVNSVAIGVFGGALAVMCYMFVGLAMHRKPDNVTRFMDYSVLVPRAVPGLLAGLAFLWVFLFVPMWLDNALDVDQNGWLSALPFAEWLREHFIEWLRAMRSTIFSVWLAYTVVWMAYGLRLISSTLLQVGPELEEAARSAGARRGQVTRHVTVPLAKYGLIGSWLLMFLIFEREYSTGVYLLSPGTETIGSMLVSLWASGAIDIVAALSFINIVLVVIGLGIALRFGVKLHD
>NZ_CP025030.1|WP_100853229.1|694441_695539_+|ABC-transporter-substrate-binding-protein
MLAKSQLAAACAAAFAIATGSAFAQAAPAGYPADYQKILDGAKKEGKVVIYSTTDTKAAGPIIKGFEALYPGVKVEYNDMNSTELYNRYISEQAAGGSSGDVVWSSSMDSALKLASDYALQYKSPEAGKLPAWAVWKDSAYGTTYEPAVFIYNKRLIAANEVPTTHGALAKLIASQPDKFKNKVTTYDIEKSAVGFMLAVQDKANDPKYFDTLKDIAKGGLVVQSSTGTMMERVSSGENLIGYNILGSYAETRAKADPSLGVAYPTDYALVLSRVAFISKKAKHRNAAKLWMDYLLSQKGQEIMANQADLASVRDDIDGDNDVDGMTKKLGASLKPIPVNETLLDYLEQTKRLQFIKDWRAAAGK
>NZ_CP025030.1|WP_100853228.1|691836_694335_+|extracellular-solute-binding-protein
MSIPESASIRRRVFTLGAALLACALIGLVFFLRGYAHRAAEQAFDRLLAASALTIAGSVQIDDEGVTVEPPVSSLAMLSSGERVFYEARTSNGRLITGYGDLAPNLPLALAATPVFAYVTYHNEPVRVATVGRLVSASQHAGWVTVRVAETLGSRDALADEILGRGVLPLLIMSLVALGLLWFGVQRAFAPLAVLERELRTRAPEDLTPVTTPVPREVRRLVEALNAFMQRLSVIMDTLHTLVADATHQVRTPLASLRAQAEVALDETDPKRLRERITRIHLNATHASQLINQLLMDATITHRLGKGPPGPVGVAETINETRRRIGPLEARRLRIDIAPEVRRARVSGDRVALREMLRNLVDNALRYAPDGTVDIQATPVAGFRVALTVSDRGPGISDDEKEAVQQRFTRGRAGESQPGSGLGLAIVRSVATAHGGSLWLQDRPGGGLSARVILPLLPQPAGRGLMTWLGAACTALLLLAGAPDHAQAAELHEIVTRYPAPQPTSRTLVIAGPTDTPVVAPLIQGFQSQRPDVTVVYREISSRDLYEATIDGRLTQVDVLMSSASDLQIRLANDGYAQSYASPYAAKLPSWAVWRHEVYGFTFEPAVIVYNPKRFSEATVPRSRQDILRLLEREQASLQGRVGTYDIATSSVGYLLAEQDELVSSNFWGLANAMGQVGVRLSPTSAQILDAIEHDELDLAYNILGSYALSREATGSKIGVVFPQDYVLVLARSVLISRRAPSPDLARALVDWLLSPAGQQVASSHAALGSIMEDTPGRWTSEAVLARSQGIVQPVVLSPALLVGLDQRRHSRFVQNWVRLVTDTPKRPGDYP
>NZ_CP025030.1|WP_100853237.1|704808_705534_-|amino-acid-ABC-transporter-ATP-binding-protein
MIRFSQVQKWYGDYQALADVTEEVKQGEVVVVCGPSGSGKSTLIRTVNRLEPIQKGVIEVNGQDIYGPKVHLDQLRSHIGFVFQQFNLFPHLSVLENLMLAPLQLKRAKRAEARERAMQLLERVGLSHKAEAYPAQLSGGQQQRVAIARALAMNPPVMLFDEPTSALDPEMVGEVLQVMKGLARDGMTMVCVTHEMGFAREVADRVWFMDAGRIVETGTPEGFFNRPGTVRAQKFLAEIRH
>NZ_CP025030.1|WP_100853238.1|705530_706247_-|amino-acid-ABC-transporter-permease
MWDILKDNWLLLLIGQYPHGPIGGLVATLGLAAISLTLALPCGVLLALGRISPYRIFYWPSSAVVYLVRGLPLLMFIFWAYFFVPIIIGRPVAGTTTMVVALVCYESAYLAEIIRAGIQALPPGQQEASRALGLSYMQTMRRVILPQALYNMLPSMLSQFVSTVKETSLAYVISVQELTYAANQINSVLLTKPFEVFGLLAMTYFILNFGLSSLVHLTERRIGRRRAGLGAVSKVVPT
>NZ_CP025030.1|WP_100853239.1|706248_706950_-|amino-acid-ABC-transporter-permease
MHYVFDFSAIFQGEYPDWLLRGLITTLALAGLAWILAFCLGSLLAVIRLTGSPVANAVIAVYVAFHRNVPMLVHILFWYFGVPALLPQGLSDWLNSHGSEFIMSCIAIGLVMSAYICEDLRSAVRGIPPGQVEASRALGLSFLRTMRCVVLPQAFRIAIPPLLNQTLLLLKNTSLAMAIGVTELTAAGREIENYTFRTFEAYAVVTVIYLLLSFLIMGGGAILQRRYRPLGAR
>NZ_CP025030.1|WP_100853240.1|706978_707806_-|ABC-transporter-substrate-binding-protein
MKTTIASFVAAVGLAATLAPAAHADTVQDIKARGKFICGTMGTAEPFSFQDPKTRAVVGYEVDMCQAVADSLGVPLELKLIAVEARIPELIAGRVDLVAANLGWSPDRAKQIDYSHQHFVSLQKILARESEKDLKAPADLAGKRVSAVRGSSSEQGARKNIPNVDTVTFKDPSGAFLALQQGKVSGFVASEMMLVKLQQQAAGSAVPVKILQPALFVEPWGMGVRKGDTAMLNQVNKVLDGMEASGQATKLFDKWFGAGTQFNMKRDFRIEAIKG
>NZ_CP025030.1|WP_100853241.1|707888_709106_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MSAADTAFLAERARAIKPSPSMAAKTRVDQLRAEGRDIVDFTVGEPDLPTPAHIVQAGIDALNSGDIRYTASAGAKPLLEAVRAKFQRENGLDYGLDELIVGVGAKQLIFTALAATVQAGDEVIIPAPYWVSYPDMVLVNDGTPVVLACPEADGFKLTPQALEQAITPRTKWVLLNTPSNPTGAMYSADELRALGEVLARHPHVWLMTDEIYEHLAYGDARHASPAAVVPALAGRTLTINGVSKAYAMTGWRLGYAGGPKPLIKAMATLISQSTSCVSAISQSAARVALTADQRCVSDAATVFHARRDRIVALLNAVPGIRCPQPQGAFYVYPSVEGLLGKRTPAGRVLESDLDVVMYLLDEAGVAVLDGAAYGLSPYLRLSFATSMENIEEGCRRIDSACAALR
>NZ_CP025030.1|WP_100853242.1|709102_709777_-|RraA-family-protein
MANILTGARQLPASPVAPAAILEALAGIVTPHLSDNLARREGISGLHRYNGSGKLVGTALTVKTRPGDNLMIYKAMMQIQPGHVLVVDAGGDLSNAVLGEIMKRYLQVHGCAGVVVDGAIRDVAAFEADNFPCYARGHIHRGPYKDGPGEVNVPVSIGGQVVNPGDIIVGDEDGLVCFAASDAESLIAAAHAHAAKEERIMAEIAKGDKTQSWMQAAFAAKGLA
>NZ_CP025030.1|WP_100853243.1|709992_710883_+|LysR-family-transcriptional-regulator
MLTFKQIEALYWTVRLGTFSASAQKLHTTQSAITKRIQELEADFNVALFDRSGHRAELTARGHEVYALAEDMLGHRDRLLVRLKGQHTLTGTFRFGITEITAMTWLPALIRLLRAHYPRITLEPHIDLGADLLKRLQAGQLDMAFLHGEFAEPNLQVVALQRLEFAWMGSPDLIDASRVYTPADIARLPLLRQSRESGLNMIYDGWLRPHTPDSNIFTINSLIAMAGLTAAGFGVSCLPRDYFADMVSKKQLVIARTSTAPPQSVYSAMFRRDADVAFCESVAELAESCCEFSGGV
>NZ_CP025030.1|WP_100853244.1|710926_711667_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MKLLRFVLRLALVLPLIVYGLLCVGLVYPFIRPRSRAWLNRSWSRALMAACGVRVVFRGDPRMTGPVLLVANHVSWIDIFVLNSARPTSFVAKSEIRKWPVIGWLVAGAGTLFIERGQRHAVHAMGEAMQARFKLGDAVGLFPEGTTTEGFDMLPFHASLFEPARSAAVEIQPVALRFLRDGKRDGFAAFVGEESLVANLWRVLGATGLSVEVVFLPVLAARHPDGTLPTRLELSHQARDAILGAL
>NZ_CP025030.1|WP_100853245.1|711663_712989_-|dihydroorotase
MRLHIANGRLIDPANGVDGPHDLYLADGRVVAVVPAGAAPDGFQADRVLDATGLAVLPGLVDLSARVAQPGRATGLAFAPAELRAALAGGVTRLVMPPDAASDDALDEPGKVDTLMRQMETGQPRIHPLGAMTVGLAGETLTEMGLLAQAGCLAYAQGEHGIADTRVLWGAMRYASGLGYTLWLRPQDPWLAQGAVAASGAYAERLGLEGLPPQAETVALNTIFELQRATGARVHLTRLSSAPGLALLRAARREGLAVTADVSAHNLLLTDVDIGFFDTHFHLQPPLRGQRDRDAIQAALAEGLVQALCSDHTPVDKHGKAVPFPVSTPGATALELLLPLTLKWARDHRVPLADALARVTSGPGAVLSGISSGTSNPAALAGQLGVGAPADACLVDLDAEWLVTPMALQSRSPHTPFAGMMLPGRVRATVVGGQLAWETSV
>NZ_CP025030.1|WP_100857484.1|714078_714480_-|Holliday-junction-resolvase-RuvX
MPEETLLGFDFGEKKIGIAIGNTLTRQARPLEIIFSEIRDARFGRIAALLQEWQPHRVVVGLALDADGGEQPATARCRRFANQLHGRFGIAVELVDERGSSMEAQRLLGTHAADDAMAAAVILQRYLDSLPAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_3

1106085-1106307

Orphan

Consensus_repeat	Method
GCTTTTTTCCTTGGGGCGGCCCGTCGGAAAAAAATGCCCCCACGCTGCGCACCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_3

>merge|NZ_CP025030|3|1106085-1106307|CRISPRCasFinder
GCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAATGCCCCCACGCCGCGCACCCTACGGGTGCTTGCTGCCCCCCGAGGGGGCTGCTTTTTTCCTTGGGGCGGCCCGTCGGAAAAAAATGCCCCCACGCTGCGCACCCTACGGGTGCTTGCTGCCCCCCGAGGGGGCCGCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAATGCCCCCACGCTGCGCACCCT

>NZ_CP025030|3|3|1106085-1106307|CRISPRCasFinder
GCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAATGCCCCCACGCCGCGCACCCT	ACGGGTGCTTGCTGCCCCCCGAGGGGGCTGCTTTTTTCCTTGGGGCGGCCCGTCGGAAAAAAATGCCCCCACGCTGCGCACCCTACGGGTGCTTGCTGCCCCCCGAGGGGGCC
GCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAATGCCCCCACGCTGCGCACCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100853503.1\|1106996_1107920_-\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|119401
NZ_CP025030.1\|WP_100853493.1\|1096230_1097289_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP025030.1\|WP_100853501.1\|1104077_1104971_-\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
NZ_CP025030.1\|WP_100853510.1\|1116808_1117645_+\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP025030.1\|WP_100853499.1\|1103196_1103424_+\|DUF3717-domain-containing-protein	unknown	unknown	gnl\|CDD\|378869
NZ_CP025030.1\|WP_100853507.1\|1109898_1111506_-\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238833
NZ_CP025030.1\|WP_100853508.1\|1111609_1112767_-\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|259979
NZ_CP025030.1\|WP_100853498.1\|1102369_1103053_-\|glycine-zipper-2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|183072
NZ_CP025030.1\|WP_100853495.1\|1098710_1100081_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP025030.1\|WP_100853494.1\|1097285_1098608_-\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223936
NZ_CP025030.1\|WP_100853511.1\|1117949_1118834_-\|RNA-polymerase-sigma-factor-RpoH	unknown	unknown	gnl\|CDD\|235838
NZ_CP025030.1\|WP_100857515.1\|1106331_1106907_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP025030.1\|WP_100853509.1\|1113067_1113874_+\|DUF4743-domain-containing-protein	unknown	unknown	gnl\|CDD\|239648
NZ_CP025030.1\|WP_100853497.1\|1101520_1102330_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|237030
NZ_CP025030.1\|WP_100853505.1\|1108594_1109470_-\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|238834
NZ_CP025030.1\|WP_100853502.1\|1104984_1106019_-\|COX15/CtaA-family-protein	unknown	unknown	gnl\|CDD\|367131
NZ_CP025030.1\|WP_006392373.1\|1107956_1108157_+\|twin-transmembrane-helix-small-protein	unknown	unknown	gnl\|CDD\|378564
NZ_CP025030.1\|WP_100853506.1\|1109508_1109733_-\|DUF2970-domain-containing-protein	unknown	unknown	gnl\|CDD\|378581
NZ_CP025030.1\|WP_100853500.1\|1103445_1104060_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|376869
NZ_CP025030.1\|WP_100853496.1\|1100080_1101454_-\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	unknown	unknown	gnl\|CDD\|224128

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100853503.1\|1106996_1107920_-\|SURF1-family-protein	gnl\|CDD\|119401	cd06662, SURF1, SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring complex of the respiratory chain, is an assemblage of nuclear and mitochondrially-encoded subunits. Its assembly is mediated by nuclear encoded assembly factors, one of which is Surf1/Shy1. Mutations in human Surf1 are a major cause of Leigh syndrome, a severe neurodegenerative disorder.	3.52905e-38
NZ_CP025030.1\|WP_100853493.1\|1096230_1097289_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.0453e-39
NZ_CP025030.1\|WP_100853501.1\|1104077_1104971_-\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	6.19616e-142
NZ_CP025030.1\|WP_100853510.1\|1116808_1117645_+\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.97266e-69
NZ_CP025030.1\|WP_100853499.1\|1103196_1103424_+\|DUF3717-domain-containing-protein	gnl\|CDD\|378869	pfam12512, DUF3717, Protein of unknown function (DUF3717). This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important.	1.10367e-22
NZ_CP025030.1\|WP_100853507.1\|1109898_1111506_-\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238833	cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.	0
NZ_CP025030.1\|WP_100853508.1\|1111609_1112767_-\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|259979	cd13912, CcO_II_C, C-terminal domain of Cytochrome c Oxidase subunit II. Cytochrome c Oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit II contains a copper-copper binuclear site called CuA, which is believed to be involved in electron transfer from cytochrome c to the binuclear center (active site) in subunit I.	4.49229e-67
NZ_CP025030.1\|WP_100853498.1\|1102369_1103053_-\|glycine-zipper-2TM-domain-containing-protein	gnl\|CDD\|183072	PRK11280, PRK11280, hypothetical protein; Provisional.	1.38016e-15
NZ_CP025030.1\|WP_100853495.1\|1098710_1100081_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.90363e-48
NZ_CP025030.1\|WP_100853494.1\|1097285_1098608_-\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0
NZ_CP025030.1\|WP_100853511.1\|1117949_1118834_-\|RNA-polymerase-sigma-factor-RpoH	gnl\|CDD\|235838	PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed.	5.39218e-167
NZ_CP025030.1\|WP_100857515.1\|1106331_1106907_-\|hypothetical-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	0.00017883
NZ_CP025030.1\|WP_100853509.1\|1113067_1113874_+\|DUF4743-domain-containing-protein	gnl\|CDD\|239648	cd03676, Nudix_hydrolase_3, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belong to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.42407e-66
NZ_CP025030.1\|WP_100853497.1\|1101520_1102330_-\|transcriptional-regulator	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	1.17468e-06
NZ_CP025030.1\|WP_100853505.1\|1108594_1109470_-\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|238834	cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. CcO catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit III contains bound phospholipids in several crystal structures and is proposed to contain a "lipid pool." These phospholipids are believed to intrinsic constituents similar to cofactors of the enzyme.	9.13174e-94
NZ_CP025030.1\|WP_100853502.1\|1104984_1106019_-\|COX15/CtaA-family-protein	gnl\|CDD\|367131	pfam02628, COX15-CtaA, Cytochrome oxidase assembly protein. This is a family of integral membrane proteins. CtaA is required for cytochrome aa3 oxidase assembly in Bacillus subtilis. COX15 is required for cytochrome c oxidase assembly in yeast.	5.04895e-81
NZ_CP025030.1\|WP_006392373.1\|1107956_1108157_+\|twin-transmembrane-helix-small-protein	gnl\|CDD\|378564	pfam11137, DUF2909, Protein of unknown function (DUF2909). This is a family of proteins conserved in Proteobacteria of unknown function.	2.05336e-17
NZ_CP025030.1\|WP_100853506.1\|1109508_1109733_-\|DUF2970-domain-containing-protein	gnl\|CDD\|378581	pfam11174, DUF2970, Protein of unknown function (DUF2970). This short family is conserved in Proteobacteria. The function is not known.	4.10658e-21
NZ_CP025030.1\|WP_100853500.1\|1103445_1104060_-\|SCO-family-protein	gnl\|CDD\|376869	pfam02630, SCO1-SenC, SCO1/SenC. This family is involved in biogenesis of respiratory and photosynthetic systems. SCO1 is required for a post-translational step in the accumulation of subunits COXI and COXII of cytochrome c oxidase. SenC is required for optimal cytochrome c oxidase activity and maximal induction of genes encoding the light-harvesting and reaction centre complexes of R. capsulatus.	3.68042e-66
NZ_CP025030.1\|WP_100853496.1\|1100080_1101454_-\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	gnl\|CDD\|224128	COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane].	0

>NZ_CP025030.1|WP_100853502.1|1104984_1106019_-|COX15/CtaA-family-protein
MERIKARYRKLVFFTWFLTLDLIMFGAFVRLTDSGLGCPDWPGCYGSVTPLGAQGDIHQASQAMPFGPVTMSKAWIEMIHRYVGTILGMLIIGIVYMAWRYRRELGRSPALAVTTLVAVCVQGAFGAWTVTHKLMPAVVTAHLVFGLSVLALMTWLSARERPHLAIAAAAARWKPWVAVGFGLLLVQVTLGGWVSTNYAALACMDFPMCHGQWLPDMDFHGGYSVIRGLGELPSGEMISQPALTAIHWVHRNFAFVVFLYLGTLAWRLRAEPGLRGPATLMLALLAAQLFTGLTTIFFQWPLLIAVLHNGGAAGLTLAAVVLMVRLSTAGSAPTGGCGPNSVRV
>NZ_CP025030.1|WP_100853501.1|1104077_1104971_-|protoheme-IX-farnesyltransferase
MTSLAAPPSGLLRQYFVLTKPRVTQLAVFCAVIGMFLAVPGVPDMRRVLFGTIGIWLLAAAAFAINCLIEQEVDARMLRTARRATARGTISAFQVLSLSGLLGGAGMFVLYTLVNPLTMWLTFATFVGYAVIYTVILKPRTPQNIVIGGLSGAMPPALGWAAVADSVPAEAWVLVLIIFIWTPPHFWALALYRNHDYAKAGLPMLPVTHGNQFTRLHILLYSVALVATTLLPYAIRMSGALYLLSALVLGGMFVSYAWRLYRAYSDELARSMFRFSILYLALLFGALLVDHWVALLR
>NZ_CP025030.1|WP_100853500.1|1103445_1104060_-|SCO-family-protein
MSVFSASRRLGLRLAAAAAVTVLTATLAACGESAPTFKGSDISGTQLGRGMELTDTNGKSRQLSDFAGKVVVVFFGFTQCPDVCPTSLAELTEVMKKLGPDADRVQVLLITVDPERDTQEVLKQYVTAFDPRFLGLTGTPDQIKKAAASFKAYYAKAPTKDGNYTMDHTAAFYLLDGKGESRVLANNTLGVDALTHDIKALLKD
>NZ_CP025030.1|WP_100853499.1|1103196_1103424_+|DUF3717-domain-containing-protein
MDSISLPQLEQAINYWRNVSPSVGDESRLCPEAAALATPYALMIITHRHDIAVAELNEKAQAALAGWAAAGTQAR
>NZ_CP025030.1|WP_100853498.1|1102369_1103053_-|glycine-zipper-2TM-domain-containing-protein
MNTSTRIQNSRSGLHPLVAAAAIAVIVMCAVGVAAVMGWLPSPSANPHADTPVVEAGPEGANLAPAPGSQPVPQQAQQAQQAQQAAPQTQQARPASASAPRAAAPAPAKQACQSCGVVETIRQVQVPVKDNSDHLVGTIGGGVVGGVVGNQFGGGSGKTALTVLGAVGGALAGREVERNIRQQQTVTHYELTVRMNDGSARQFRSAQPFAFASGDHVRVENNQLLPG
>NZ_CP025030.1|WP_100853497.1|1101520_1102330_-|transcriptional-regulator
MSDQFTNPFVLPGMGQNSDLSGNPLLASMEMMRQAWAGLTGPGGLASSLPMAPPMNLEDLDRRIAELRSVENWLRMNLSMLSSTIQGMEVQRSTISTLRAFVDSAASMDMNAVRDSGAASPLEVVLGLKPAPKSAAKPASSESARDAKPQEPSAGTLSESDAGKASAADSAGPGMTEQMGAAAQSASKAWWDLLQQQFNQIAAATAASMPTNPAEPGESATPKPKDSKPAAKTEAKASKPATRKPAARKTAAKSAPRASKNNGPADGKP
>NZ_CP025030.1|WP_100853496.1|1100080_1101454_-|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU
MLNVVILAAGLGKRMQSNLPKVLHTLAGKPMLAHVLDSARQLKPARIIVVVGHGADRVKEAFEGQPDLHFVLQQPQQGTGHAVQQAVPLLLEGDGKDDVTLVLYGDVPLVQPDTLQRLLDARATGAAVLTEVLDDSTGYGRIVRDDKGNVCRIVEHKDASEAEHAIKEVNTGILTAPTAKLKDWLTRIDNKNAQGEYYLTDVVGLAVVDKVPVGAAQPGAGWETLGVNSRVQQAELERRWQGEQARRQLEAGVTLADPARFDVRGTLTCGRDVFIDVGCVFEGKVTLADGVRVGPHCVLRDVTVGAGTQIEAYSHLQQAEVGQDARVGPYARLRPGAELGDRSHVGNFVEIKKSVLGADSKANHLAYIGDADIGQRVNVGAGTITCNYDGVNKHRTVIEDDAFIGSDTQLVAPVRVGRGATLGAGTTLTRDAPADKLTVSRAKQITVEGWQRPAKKS
>NZ_CP025030.1|WP_100853495.1|1098710_1100081_-|MFS-transporter
MAESESAKNALPDGLPAPRRYWAAATVMTGISLSVLDTTIANVALPTISVDLNASPAQAVWIVNAYNLAVVMTLLPLSALAERIGFRRMFTFGLILFTLASLGCALAGTLWQLTAARVFQGVGAATLMCMFGGLVRNIYPLHMLGRGISINATTVAVMSVLGPTIGSAILSVAPWPWIFAVNLPICVLAMFGLRHLPEVPRNDVKLDWVSVVLCMATLGVFISGVDMMGQDLLRGIGLVAIASVAGWVLVRRASKQPAPLVPVDLLRIRPLAFAVGASACTFAAQMASYVSLPFYFQQVLGRPYLEVGLLMGAWPVGTAIIAPLAGRLSDRYSAATLSGVGAATMVAGMLWLTLLPASVSNWPIVAGMFVAGVGFGFFQTPNNRAMLSAAPRARSGAAGGLQATTRVFGQSFGTALVAIAFSISLAHGPGLALVLGTICAALAVVVNTVRFNKLRT
>NZ_CP025030.1|WP_100853494.1|1097285_1098608_-|UDP-glucose/GDP-mannose-dehydrogenase-family-protein
MKITVVGTGYVGLVSGACLADMGNDVMCLDVDAAKIALLRQGGIPIYEPGLEDLVRRNVQAGRLHFTDDVAQSVAFGDVQFIAVGTPPGEDGSADLKYVLAAAQNIARHMTSRKLIVDKSTVPVGTADKVRAVVQKELAARGVDIPFSVASNPEFLKEGAAINDFMSPDRVVVGADDDYTVGVMRRIYEPFQRTHDRLMVMDVRSAELTKYAANAMLATRISFMNEMANLAEALGADIEQVRRGIGADPRIGYHFLYPGAGYGGSCFPKDVQALVNTAAENSLPMRVIEAAEAANHAQKFRLSEKLVARYGNDLRGRKIALWGLSFKPNTDDMREAPSLTVIAELTRRGADVRAYDPVAMHEAARVLVGQPGISFATDMYDALDGADALLIATEWKVFRAPDFDRVKALLKAPVIIDGRNLYTPADVRALGFEYSGIGRA
>NZ_CP025030.1|WP_100853493.1|1096230_1097289_-|glycosyltransferase-family-4-protein
MKILQLNFEKGWRGGERQTLYCMRAFRKAGHDVEVMCREGAPLAERARQEGFVAHTCRNVPGQLAFLAGAGRYDIIHAQTANTITWAVLTKWLHRRPVVFSRRTSFVVKPGDEWKTGFKWRHANLFVAISEMAAGEPRRLGIEPVIIRSAVEPHTINADNVAKLVQEFDLAGKKVMATSAALIRDKDPVTLVRAVGELAKTRRDFIFLHFGAGGDREQQAKDEARRLGIEDVYRFAGFRKGVEDFYSILDVFVMSSEEEALGSSVLDAFLQHVPVVSTDAGGLKESLADGRGVLVAVGDHQAMAAGMARCLDDAAFRKDVTERAYEYVKSEHDVQKMGNRYLAQFERLLGRV
>NZ_CP025030.1|WP_100857515.1|1106331_1106907_-|hypothetical-protein
MVLVFLCSLAPIVAAFVVYMNPQWWPAESTNYGTLVSPQRPMPAANDLKLTTLDGKPFDLQSLKGKWLLVAADGAECPESCARKLYITRNTHASQGKNVDRLARVWFITDDAPVPQKVLEAYQGTVMLRVNPDQLAHYLLARDSAAGQPGLQDPIWVIDPLGNLMMQYPAQADGVKVRKDISKLVYNSRIG
>NZ_CP025030.1|WP_100853503.1|1106996_1107920_-|SURF1-family-protein
MARPHSTRYTVTALLLLGIAVVILVSLGQWQLRRSDERRAILDAIEAGRKQAPVMLTPATSSDDLTPWRVAQATGVWQPQFSVLLDNRNHEGRPGYWLATPLLLDGSSRQAVLVLRGWLPRVMPGQGAPALPATPQGPQTITGEMADRVPRLFELWSLGGQDQSALPAALPASGGKVPQVQNLPLDAYARATGLNLLPVVLTQTGPTSKSGQTNETGQNSQNSPDVQNSQSAQSSQNAQHSQNSPYNQADGDGLVRDWPQPSVDFQKNTSYAVQWFAFGLIAAIAWLVVLGGAIKRMRQRAGQGPRA
>NZ_CP025030.1|WP_006392373.1|1107956_1108157_+|twin-transmembrane-helix-small-protein
MRVFVVLAFIGILASLASALVYLMRDKGSTNRTVNALTVRIGLSVALFLFVLFAHHMGWIESTGLR
>NZ_CP025030.1|WP_100853505.1|1108594_1109470_-|cytochrome-c-oxidase-subunit-3
MSASHSVQGKEAPYYFVPADSGHPVRTAVALLFMGLGAAAWINGVGWAKWSVLAGFIGLIVVLYYWFGDAIQESEAGLNSKRIDGSYRWGMSWFIFSEVMFFAAFFGALWYTRTITTPWLGDIDHRLMLWPDFKAAWPNFGPAGVVEEFQTVGPFWLPTINTALLLSSGVTLTIAHHALRENHRGKTMFWLAATVILGFIFVACQAAEYHHAYTELNLKFNSGAYGSLFYMLTGFHGFHVILGATMLTVILVRLMRGHFTADHHFGFEGAAWYWHFVDVVWLGLYLFVYWF
>NZ_CP025030.1|WP_100853506.1|1109508_1109733_-|DUF2970-domain-containing-protein
MSDDLHETSRRKLSFLQTMKAVAWGFFGVRKGAGHQEDIAKLNPVHVIVAGLLAAAIFVTVLVLIVRWAVSSLT
>NZ_CP025030.1|WP_100853507.1|1109898_1111506_-|cytochrome-c-oxidase-subunit-I
MSSVTVDHVSPGHGHGHDDHHHAMPSGWRRWLFATNHKDIGTMYLIFSFAMLLEGGTLALLLRTELFEPGLQFFRPELFNQFTTMHGIIMVFGAIMPAFVGFANWMIPMQIGASDMAFARMNNFSFWLLPVAAIMLTASFFVPGGATAAGWTLYAPLSLQMGPGMDLGIFAMHLMGASSIMGAINIIVTILNMRAPGLTLMKMPLFCWTWLITAFLLLAVMPVLAAAITMVLTDRHFGTGFFNAAAGGDPVLYQHVFWFFGHPEVYIMILPAFGIVSAIVPAFARKKLFGYASMVYATASIAVLSFIVWAHHMFTTGMPVTGQLYFMYATMLISIPTGVKVFNWVATMWRGSMTFETPMLFSIGFIFVFTMGGFTGLILSVAPIDIQVHDTYYVVAHFHYVLVAGSLFALFAGAYYWVPKWTGRMYSEKLGKLHFWFTLISFNVTFFPMHFLGLAGMPRRYADYAAQFTTFHQMATIGAFWFGLSQLIFLWAIVRCYMGKGEPAAAKPWEGAEGLEWTVPSPAPFHTFETPPEVK
>NZ_CP025030.1|WP_100853508.1|1111609_1112767_-|cytochrome-c-oxidase-subunit-II
MKKWRGILGACAMLIGSVAGAQVQDMPGGPKVNQLNLHEGVTAISRDIMWLHWLLLTICIVIFIGVFGVMFYSIWAHRKSRGHKAATFHEHLGVEVAWTVIPFIIVIAMALPATKTVVAMKDTSSADLTIKVTGYQWKWGYEYLDGSAAGVKFLSTLSTPRAQIENREPKGEFYLMEVDNHMVVPVDKKVRVVLTAADVIHSWMIPDFGVKQDAIPGFLRDAWFRADTPGIYRGQCAELCGKDHAFMPIVVEVLAQADYDKWVEDQKKKMAANADDPNKEWTEAELVARGEKVFAANCVACHQANGKGIPGSFPPLDGDKVVLGPQAAQINTVLKGKPGTAMAAFGGQLNDVEIAAVISYTRHAWSNAGKGQDPTVLPKDVAAAR
>NZ_CP025030.1|WP_100853509.1|1113067_1113874_+|DUF4743-domain-containing-protein
MPKQLPDLYADLCARAQEPAPDGAHALYIAGRRCGWATHAACDALRDAPGVICDEAALHIGAHLTPGAALNAVLENTAQLLRQANCLRGWRDELLDVMDGDDALGVIERAAVRPLGLLTHAVHLNAWTPDGRMWVARRALSKSTDPGMWDTLVGGLAGSGEDLELALVRECGEEAGLDAPDLANRTPLRTILRIHRRLPEGYQVEDVLTSTCVLAAGVRPANRDGEVMEIATVDVPTVLRQIAEGEFTLEAALVIVEDIMQRQAAGQI
>NZ_CP025030.1|WP_100853510.1|1116808_1117645_+|phosphodiesterase
MPRVHPLARRHDAPAMLVQLTDSHLFGEPDTAMLGVNTDASLRAVLRQIEADGKRPDLLLATGDLSQDGEAAAYRRFAAILGQAGVLSGAQIRCLPGNHDQPAVMRQELPQWSAPVTDVGAWRVVTLDTTVPGSNAGHLPDSQLDMLEAALAAEPGRHTLIAMHHNPMQIDSHWHDSMMIDNPQALFKRLTRWPQARVLLWGHVHHEFDRRRHNLRMLATPSTCFQFSIRDGKHVVDNLAPGYRWIKLYQDGSMATGVRRVQDALWHTALAPDDAQAA
>NZ_CP025030.1|WP_100853511.1|1117949_1118834_-|RNA-polymerase-sigma-factor-RpoH
MKQPSTSLAASGNALALAIANPGALGTIDAYISTVNRLPVLSAERETELGRRLRDQEDLGAARELILSHLRLVVSVARQYLGYGLPHADLIQEGNVGLMKAVKRFDPERGVRLVSFAVHWIKAEIHEYIIRNWRLVKVATTKAQRKLFFNLRSMRPDGQTLDPDQVDHIARELNVRREDVSEMEVRMSGRDMSLENQDDDDDSYAPIAYLSDDGRQEPTRVLERAARDQLQSTGLTGALDALDARSRRIVEARWLQDDGGATLHELAQEFGVSAERIRQIEAAALKKMRGNLAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_4

1367524-1367721

Orphan

Consensus_repeat	Method
ATGTTCCACGTGAAACATGGAACTGGCATACCC	PILER-CR
ATGTTCCACGTGAAACATGGAACT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP025030_4

>merge|NZ_CP025030|4|1367524-1367721|PILER-CR,CRISPRCasFinder
TGTTTCACGTGGAACATAACTGTTTGGCCTGAACACTGCAATTCGGGGCGTTTGTGAGATGGAGGGGAAATTATGCGGGGCTTCAGTCAGCGAAGATGTTCCACGTGAAACATGGAACTTGCATGCCCGCAGGCGCCGACTCCCGGGGTTACCCGTCAAAGTTATGTTCCACGTGAAACATTGAACTGGCATACCCAC

>NZ_CP025030|4|1|1367524-1367721|PILER-CR
TGTTTCACGTGGAACATAACTGTTTGGCCTGAACACTGCA	ATTCGGGGCGTTTGTGAGATGGAGGGGAAATTATGCGGGGCTTCAGTCAGCGAAGATGTTCCACGTGAAACAT
GGAACTTGCATGCCCGCAGGCGCCGACTCCCGGGGTTACC	CGTCAAAGTTATGTTCCACGTGAAACATTGAACTG
GCATACCCAC

>NZ_CP025030|4|4|1367619-1367710|CRISPRCasFinder
ATGTTCCACGTGAAACATGGAACT	TGCATGCCCGCAGGCGCCGACTCCCGGGGTTACCCGTCAAAGTT
ATGTTCCACGTGAAACATTGAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100853705.1\|1368060_1369980_+\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-enzyme-MnmG	unknown	unknown	gnl\|CDD\|235362
NZ_CP025030.1\|WP_100853713.1\|1378880_1379894_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP025030.1\|WP_100853709.1\|1372377_1373301_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP025030.1\|WP_100853702.1\|1361438_1362965_+\|tripartite-tricarboxylate-transporter-TctA	unknown	unknown	gnl\|CDD\|225870
NZ_CP025030.1\|WP_100853711.1\|1374291_1375185_-\|transcriptional-regulator-LrhA	unknown	unknown	gnl\|CDD\|237907
NZ_CP025030.1\|WP_100853701.1\|1361004_1361442_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815
NZ_CP025030.1\|WP_100857531.1\|1358379_1359756_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|182388
NZ_CP025030.1\|WP_100853707.1\|1370698_1371499_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|379293
NZ_CP025030.1\|WP_100853697.1\|1355259_1355718_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP025030.1\|WP_100853712.1\|1375302_1375890_+\|cysteine-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|380416
NZ_CP025030.1\|WP_100853708.1\|1371508_1372333_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP025030.1\|WP_100853698.1\|1355738_1357115_-\|ClcB-like-voltage-gated-chloride-channel-protein	unknown	unknown	gnl\|CDD\|234987
NZ_CP025030.1\|WP_100853710.1\|1373293_1374298_+\|asparaginase	unknown	unknown	gnl\|CDD\|199208
NZ_CP025030.1\|WP_100853706.1\|1369976_1370702_+\|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG	unknown	unknown	gnl\|CDD\|234637
NZ_CP025030.1\|WP_046806066.1\|1365613_1365820_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP025030.1\|WP_100853704.1\|1364314_1365370_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377472
NZ_CP025030.1\|WP_100853700.1\|1359873_1360872_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP025030.1\|WP_100853703.1\|1363064_1364231_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|181642
NZ_CP025030.1\|WP_167400953.1\|1375892_1378679_+\|cystathionine-beta-lyase	unknown	unknown	gnl\|CDD\|223699
NZ_CP025030.1\|WP_100853699.1\|1357604_1358282_+\|response-regulator	unknown	unknown	gnl\|CDD\|185376

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100853705.1\|1368060_1369980_+\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-enzyme-MnmG	gnl\|CDD\|235362	PRK05192, PRK05192, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG.	0
NZ_CP025030.1\|WP_100853713.1\|1378880_1379894_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	5.11096e-121
NZ_CP025030.1\|WP_100853709.1\|1372377_1373301_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	1.62036e-81
NZ_CP025030.1\|WP_100853702.1\|1361438_1362965_+\|tripartite-tricarboxylate-transporter-TctA	gnl\|CDD\|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP025030.1\|WP_100853711.1\|1374291_1375185_-\|transcriptional-regulator-LrhA	gnl\|CDD\|237907	PRK15092, PRK15092, DNA-binding transcriptional repressor LrhA; Provisional.	1.04635e-109
NZ_CP025030.1\|WP_100853701.1\|1361004_1361442_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	2.66584e-08
NZ_CP025030.1\|WP_100857531.1\|1358379_1359756_+\|sensor-histidine-kinase	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	1.96241e-46
NZ_CP025030.1\|WP_100853707.1\|1370698_1371499_+\|ParA-family-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	1.318e-90
NZ_CP025030.1\|WP_100853697.1\|1355259_1355718_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.68115e-10
NZ_CP025030.1\|WP_100853712.1\|1375302_1375890_+\|cysteine-dioxygenase-family-protein	gnl\|CDD\|380416	cd10548, cupin_CDO, cysteine dioxygenase, cupin domain. This family contains cysteine dioxygenase (CDO; EC 1.13.11.20), which catalyzes the conversion of cysteine to cysteine sulfinic acid, the first step in the biosynthesis of essential oxidized cysteine metabolites such as sulfate, hypotaurine, and taurine. CDO also plays an important role in the regulation of intracellular cysteine levels in mammals; CDO expression is altered in cancer cells, and abnormal or deficient CDO activity has been linked to Parkinson's disease, Alzheimer's disease, and rheumatoid arthritis. CDO is an iron-dependent thiol dioxygenase that uses molecular oxygen to oxidize the sulfhydryl group of cysteine to generate cysteine sulfinic acid. The CDO active site contains an amino acid-derived cofactor. These enzymes are found in prokaryotes as well as eukaryotes and belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.46339e-15
NZ_CP025030.1\|WP_100853708.1\|1371508_1372333_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.72337e-11
NZ_CP025030.1\|WP_100853698.1\|1355738_1357115_-\|ClcB-like-voltage-gated-chloride-channel-protein	gnl\|CDD\|234987	PRK01862, PRK01862, voltage-gated chloride channel ClcB.	5.0227e-167
NZ_CP025030.1\|WP_100853710.1\|1373293_1374298_+\|asparaginase	gnl\|CDD\|199208	cd08964, L-asparaginase_II, Type II (periplasmic) bacterial L-asparaginase. Asparaginases (amidohydrolases, E.C. 3.5.1.1) are enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia. In bacteria, there are two classes of amidohydrolases. This model represents type II L-asparaginases, which tend to be highly specific for asparagine and localized to the periplasm. They are potent antileukemic agents and have been used in the treatment of acute lymphoblastic leukemia (ALL), but not without severe side effects. Tumor cells appear to have a heightened dependence on exogenous L-aspartate, and depleting their surroundings of L-aspartate may starve cancerous ALL cells. Type II L-asparaginase acts as a tetramer, which is actually a dimer of two tightly bound dimers. A conserved threonine residue is thought to supply the nucleophile hydroxy-group that attacks the amide bond. Many bacterial L-asparaginases have both L-asparagine and L-glutamine hydrolysis activities, to a different degree, and some of them are annotated as asparaginase/glutaminase.	2.47382e-135
NZ_CP025030.1\|WP_100853706.1\|1369976_1370702_+\|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG	gnl\|CDD\|234637	PRK00107, gidB, 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG.	4.43119e-73
NZ_CP025030.1\|WP_046806066.1\|1365613_1365820_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	5.4687e-34
NZ_CP025030.1\|WP_100853704.1\|1364314_1365370_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	8.71125e-69
NZ_CP025030.1\|WP_100853700.1\|1359873_1360872_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	3.45761e-93
NZ_CP025030.1\|WP_100853703.1\|1363064_1364231_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|181642	PRK09082, PRK09082, methionine aminotransferase; Validated.	0
NZ_CP025030.1\|WP_167400953.1\|1375892_1378679_+\|cystathionine-beta-lyase	gnl\|CDD\|223699	COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism].	3.37378e-132
NZ_CP025030.1\|WP_100853699.1\|1357604_1358282_+\|response-regulator	gnl\|CDD\|185376	PRK15479, PRK15479, transcriptional regulator TctD.	4.06892e-73

>NZ_CP025030.1|WP_046806066.1|1365613_1365820_+|cold-shock-protein
MAQKGKVKWFNADKGYGFITPDVGGTEVFAHFSAIQGRGYRSLNEGQEVEFEVKDGPKGPQAAEIRPL
>NZ_CP025030.1|WP_100853704.1|1364314_1365370_+|AbrB-family-transcriptional-regulator
MQVDGMVGQNVLLRVFGGLALALAGALLALWMHMPLPWMLGALFVTAATRIAGVGTVCPRPARNGGQWVIGTSLGLYFTPQVIGHIGSNAGPIVVGMLFALGLAFMGTAMLRRYTDADLKTAWFSSAIGGASEMASLAERHGARIDRVATAHSVRVLLVVVTVPFIFQWWGVAGLDPTVPGPTVVDGVGLAALVVLTCMGGMAFMKLRLPNPWVLGPMLVAMLLTSWSIELSALPDYVPKAGQLLIGWSLGDRYRPDFFRAAPRFIAVVATFTLAALGLAFGLGALLSYWSVAPVPTLILGTTPGGIAEMAITAKVLQLGVPVVTAFHVTRMVFVVIVTGPIYALLARRQG
>NZ_CP025030.1|WP_100853703.1|1363064_1364231_-|pyridoxal-phosphate-dependent-aminotransferase
MIRSKLPDVGTTIFTVMSRLAIEHKAINLGQGFPDFDPDPALCALVTQAMANGHNQYPYMPGVAPLREAIAAKTRELYGHAYDPETEITVTSGATEALMATVLAAVNSGDEVVVIEPCYDSYLPAIRLAGGTAVPVPLRAPTEADPYHRIDWQRVRDAITSKTRLLMLNFPHNPTGAVLDDSDLDALEAIVRDTGVLLVSDEVYEHIVFDGKPHASVARRPLLAEHAFVISSFGKTYHTTGWKIGYCCAPRQLSAELRKVHQFMVFTVPSPMQFALAEFMRDPKPYLDLPAFYQAKRDRLSQGLANTRFRPLPSPGTFFLLADYSQISKQNEADFARDLTVNHGVTVIPVSAFYRQPDAAESNHRIVRFCFAKKDATLDAALERLAHV
>NZ_CP025030.1|WP_100853702.1|1361438_1362965_+|tripartite-tricarboxylate-transporter-TctA
MSGILDHLSIGFGVALSLTNILVAMIGSFIGTMVGVLPGLGPVNGVAMLIPIAFAMNLPPETALILLAAVYVGAEYGGRITAILLNVPGEASAIMTTLDGYPLARQGMANVALSLSAWSAFFGAIVSVVGIILLAPLLAKWALAFGPAEYFVLMIFAFCCLTSLLGKQPVKGVLAAMIGLSISVVGVDANSGVYRYTFESVHLADGIDFVVVVIALFAVSEMLEMLEKVARGHSVEVKPSGRKLFNLKELAFTWWSVVRSALVGFGVGVLPGAGASVAAAVAYSQEKRIIEAKDPDAKFGKGDMRGLVAPEAAATASAIGSFVPMLTLGVPGSGTTAVMMGALTLYNITPGPVLFDTKPELVWGLIASLFVANVLLFVMNVPLVRLFSKVLSVPGWLMVPGILCISYIGVYAINSGTFDLLLVAGIGALGYFLRKFGVPMAPLVLGVVLGNMMEQNLRRALSITDGDIVVLFSSPVSLSLWAAALAVVIVPQVLRRIRRARKVAVDAA
>NZ_CP025030.1|WP_100853701.1|1361004_1361442_+|tripartite-tricarboxylate-transporter-TctB-family-protein
MNDRILGIGALALAAFMTAAGWGIAAPFAYEPVGPRAFPLLVAAIIGLCGLWLVYKGGHTVEGNPPGANGRIALMMAFTVAYAFLFQWLGFIIATSLMTVFVGRLFGGGWVKCAIGGVVMSVLFFLLFDKVLDVVLPGGLLETLL
>NZ_CP025030.1|WP_100853700.1|1359873_1360872_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MQTSLKLRLAALAALGAMTLSLGVAQAADEPRRPECIAPAQPGGGFDLTCRLATEGLKQSGALKSTMRIVYMPGGIGAVAYNNIVAQHPNEPGTIVAFSGGSLLNLAQGKFGKYNVNDVRWLAGIGTDYGVAVVRNDSPYTDLKSLMDAFKQDPTKIVLGAGGTVGSQDWMKAALTAKAAGVDFKKMRFVAFEGGGEAVTALRGGHIQAYMGDAAEAFTMLEGGAPIRVLAVFNDQRLPGKLNTVPTAKEQGYDIVWPIIRGFYVGPKVSDKDYQFWVDAFNKTAASPEFEKLRQQQGLFPFNKTGAELDAYVKERVKVYAELADSFGLIKK
>NZ_CP025030.1|WP_100857531.1|1358379_1359756_+|sensor-histidine-kinase
MMGALWLSNHQLRNQVDVAYDRSLSGALRAIDHNISTASGGLAMEQPYLMLEFFELTANGNVFYRVATEDGLAEIGHPDLPMPDQALKSGEPRFFYATYQGMPVRVAALARPMDPPLYANKGGRVIVQVAEGLEGRQAFLHQVLLRSVERDLAVILISVLVIILGVFMALRPLVRLRQEVEGRSGDDLSPVSDSEMPGEVLPLVAAVNLHMARFAAQGRVQSQFLDDASHQLRTPLSVLRTQTAYALRETDPQEVRTALLAMQEGLDRAVRTTNQMLALARAKDASLAESGFTVESVDLVELADTVIRTLLPAARARQLDIGLEAVQRPVPVNGTEWLLREAVTNLVDNAIRYASPAGEVTVTVQAKEREARLVVEDDGPGMSAEDIARACVRFRRGAAGKNTSGAGLGLAIVGTIAEILGARLVLENRAPLAGLRTILVFSLVPKANVAPRHENGPI
>NZ_CP025030.1|WP_100853699.1|1357604_1358282_+|response-regulator
MRILLIEDEAELARWLSRSLARHAGFVVEWADDGLVAERRLAIEEFDAVILDLGLPGMDGHALLAKIRARDDRTPVLVLTARDSLAEKIGTLHLGADDFLPKPFVVEELEARLIALIRRSRGREHPRLALGNLVFETSAQKFTVSGQTLHLSPREHAVLRVLIQKSGEPINKQQILDRIVSDDADINLEAIEVLVHRLRKKLADTGVQIVTMRGMGYCLENLVDN
>NZ_CP025030.1|WP_100853698.1|1355738_1357115_-|ClcB-like-voltage-gated-chloride-channel-protein
MAIEIKNRKWRWLNGLRDRFIADNLPATLFAAALMGLFGALATVVFRELLGWAQMVLGGEDAPHGMVSLARGLDPWQRFLTPALGGAIAGVILQMAARWLPKRGAADYMEAISIGRGVIGLRQTLARSLSSIFSIGSGASIGREGPMVQLAAMFSSLTGRFLLLPPRHLRLLVACGATAGITSAYNAPIAGALFISEIVFGVISSATLVPLVVSSVVANIVTRQILHYDAVFHMPHFEFVSGWEVINYLGLGVMAGLVAPQFLRLLDTARATFSRLPFPLWVRMALGGLIVGALSVINPEVWGNGYSVVNSMLHTQWAWQAVAAILLMKILATAASAGSGAVGGVFTPTLFVGAALGALYGTGLQALIPAGGLSTVSSYAVVGMGALLAATTHAPLMSILMIFEMTLSYEVMLPLMLACITGYVIAHWIRPESVYAKSLANNRLVQKKVAKTSPDKSE
>NZ_CP025030.1|WP_100853697.1|1355259_1355718_+|GNAT-family-N-acetyltransferase
MPFVIRLATPNDIPVIERIVADAYTPYVARIGTVPGPMRDDYAKRVAEGVVHVLEEADVIQAVLVLIPEPDCLLLDNIAVSPAAQGKGVGRVLMRFAETSAREAGLANIRLYTQEKMTENIAIYLRYGYVETHRAEELGLRRVFMRKSLLST
>NZ_CP025030.1|WP_100853705.1|1368060_1369980_+|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-enzyme-MnmG
MDYPREFDVIVVGGGHAGTEAALAAARAGARTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMALATDEAGIQFRILNGSKGPAVRATRAQADRVLYRQAIRGRLENQANLWLFQQAVEDLMVEGDRVVGAVTQVGLKFRAKTVVLTAGTFLNGLIHVGLQNYSGGRAGDPPAISLGQRLKELKLPQGRLKTGTPPRIDGRSINYSILEEQPGDLDPVPVFSYMGNVAMHPRQLPCWITHTNARTHDIIRGGLDRSPMYSGVIEGVGPRYCPSIEDKIHRFADKESHQVFLEPEGLDTHEVYPNGVSTSLPFDVQLDLIHSLRGLENAHIMRPGYAIEYDYFDPRGLKSTLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGVNAALLSLGRDQWTPRRDEAYLGVLVDDLVTRGVTEPYRMFTSRAEYRLSLREDNADLRLTEIGRQLGIVDDARWDAFNRKRDAVAAEVERLKSSWVNPRIMPVEIAEPLLGKAIEREYSLADLLKRPNVSYEALMAARNADGSLLAGPGVVADDILAEQVEIQVKYAGYIARQQDEVQKQISHEQQPIPADVDYDAVTSLSFEVRQKLKTHRPETVGQAARISGVTPAAISLLLIHLKRLHYGSRKQAA
>NZ_CP025030.1|WP_100853706.1|1369976_1370702_+|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG
MTANTNLAGTDMAGRLSRACEQLGLYADAAAQAKLLNYLAQMQRWNRTYNLTAIRDPQQMLIQHLFDSLSAVVPFSQALGAAGAAAKIFDVGSGGGLPGVVLAIMQPAWSVTCIDAVEKKTAFVRQMSGALSLPNLHARHARIETLDPAECNIVTSRAFASLDDFAQLAGRHVRNDGTLVAMKGKVPEEEIQALHARGEWQVDHIQPLRVPELQAERCLIWMRRNEGRSEERSEGRSQGTL
>NZ_CP025030.1|WP_100853707.1|1370698_1371499_+|ParA-family-protein
MKNLPPSTNARVFCIANQKGGVGKTTTAINLAAGLATHNQRVLLVDLDPQGNATMGSGIDKNALESNLYQVLIGEATIEQARVKSESGGYDVLPANRELSGAEIDLVQMEERERQLKRAIDTVSSQYDFVLIDCPPTLSLLTLNGLAAAHGVIIPMQCEYFALEGLSDLVNTIKRVHRNINDDLRVIGLLRVMFDPRMTLQQQVSAQLEAHFGDKVFKTVVPRNVRLAEAPSYGMPGVVYDRASRGAQAYISFGAEMIERVRKDFQ
>NZ_CP025030.1|WP_100853708.1|1371508_1372333_+|GNAT-family-N-acetyltransferase
MSAATLFVPTAPQAFCTPSIDERDRLRVRLEEAALNATAVNAQVLYDGWLVRFAHSSAKRARSVNVLGLSTRPLDERLAYCSSLYARHGLPMVLRITSIGPDFSLDAELEARGYTFTGETRVMSMSLAPTLSVRGGLSFTNVDTDRFAQAVGAMRGSAFEHIGEHQARLQGLAVDKQPVLAFDAAGQCVAAGLAVRDDELLGLFDIVTDPGHRRKGYADALVQHLLSEGAAGGAKTAYLQVEPENTAARALYGRYGFKDCYAYWYRLPAEQPDA
>NZ_CP025030.1|WP_100853709.1|1372377_1373301_+|ParB/RepB/Spo0J-family-partition-protein
MATKKPKGLGRGLDALLGADAPAIDNIGKAAAAKPEGPPSTLPLSKMRAGKYQPRTRMDEGALGELAESIRTQGIMQPILVRALGETAPGHYEIIAGERRFRAAQLAGLKEVPVLVREVADENAAVMALIENIQREDLNPLEEAHGVRRLLDEFGLTHEQAAQAIGRSRSATSNLLRLLNLAAPVQTMLLAGDVDMGHARALLAVDAATQIQLANQIIARRLSVREAEKLVAKTAKEAESASSPRKKANGVSRDLTRLEEALSDHLGTRVALKVGAKEKGQIVIDFHGWEHLNSLLERQGLSGVVDA
>NZ_CP025030.1|WP_100853710.1|1373293_1374298_+|asparaginase
MPERALPVIAVLATGGTIAGAQADATSAGYKAGSFSVNDLLSAVPQLARIADIRAEQVANVGSQNMTHEVWQALAARVDTLCQDASVAGIVITHGTDTLEETAYFLSLVVQHDKPVVLVGAMRPATALGAEGPANLYNAVALARHPDARGRGPLVVMNEDVHYAREIQKTASAGLCAFASPNRGRAGVMHGGVPCFYSRNTTTHSTQSEFSLALLESAGWPRVDIVYAHANLQADVIDFLADTAEGIVLAGVGDGNATDLAIDALSRAATNGVAVVRSSRTGSGFVARDVELDDDGLGFIAARDLNPQKARILLMLALSVTRDTDAVQAIFDRY
>NZ_CP025030.1|WP_100853711.1|1374291_1375185_-|transcriptional-regulator-LrhA
MRNLDLDLLRTLTAIAGHDTFSEAANRLHKTQSAITQQMQRLEASIGLPLFEKQGRNKVLSSHGRRLVEYARHMLAINDEALRALQDGPLEGDLRLGAPLDVADTILPTLLTHIARSAPRVKLEIRVDRSPFLMDALRAGELDLTISTRFDQDFEGVALRTSPTVWLASADYVHDPHAPVPLVLADEPSIFRRLALNALEQARVRWHTNYVAPNLVGIKAALRAGLGVTARSVELLGPEMRVLGDKEGLPPLPDVTYFLWIRRDLINPLTRQVYDMLRSNLGLAQQGDAAAEPPGAQ
>NZ_CP025030.1|WP_100853712.1|1375302_1375890_+|cysteine-dioxygenase-family-protein
MSNAHPHQAGIATAIGNIKKTVGNKGLNRDSLDEVLQELVGLAAHTDWWTGDRYAPPEEGERQARYLIAEDDDKSYALYLNVMRPGNKIVPHNHTTWACIAAVEGVEYNYVYDRLDDGSVPGVGRLQKTGTVVVGPGAGIALMPDDIHAVEIQGDSVIRHLHMYGRALETLDERLGFDLDAGTCKIMPIGVKTRR
>NZ_CP025030.1|WP_167400953.1|1375892_1378679_+|cystathionine-beta-lyase
MNKPYQSATRLLRAGRPHQGWVNTPVTRASTYVFDSVAAWRDTRERREQERLPSYGARGTDSTHALEDALVELEQGFRAALYPTGQAAITTVLLAYLRAGDHVLITDAVYEPVRRFCTEHLTRLGIEHTFYRPDGRGIDALIQPNTRMIYAEAPGSLTYEMPDLCELSTAAKKHGCWLAVDNTWASGLIYKPLTLGADISILAATKYLGGHADVMMGAVVVNAHAWRPLERATIDFGQTVGADDAFLVLRGMRSLPLRMAQHEKNAMRVAHFLQGRPEVARVLCPALPGDPSHAVWLRDCTGANGLLTVELNGAYSAKDAERLIDSLRLFGIGASWGGFESLVIPVQLASRALPNPTPRGAMLRLHIGLEDPEDLIGDLEQGLSALSLSTRIPLNSMTHPTSAPFIPAVDSHTLKQWLHDGREIALLDVREHGQYGESHLFFAAPVPYSRLEVDIVRLAPRHDVRVVVYDNGGDDSTAERAARALTRLGYGNVHRLAGGIAQWQRDGYAAFAGVNVPSKTFGELAEEVFHTPRIGARELAERQRRGDDLIVLDGRPYAEYQKMSIPGGICCPNGELALRAHTLVKDPNTTIVINCAGRTRSIIGAQTLINLGVPNPVYALENGTQGWYLEDLQLEHGARRRYDDGVSPEALPELAARSAQLAKRHDVPVVDARTVQAWLFDPSRTTFLCDVRSAEEFAQGSLPGAQHTPGGQLVQATDQYLAVRGARIVVFDAEGVRAPVVASWLRQMGWDACVLEEGVHAALSHEAPMPRTPQLSVLTDAALAAALPQGVQAVDIRAGMRYRAGHIAGAQWSIRPRLDRLNLDPARPVVLLADDADLAAWAAEDLRALGLHDIKVNTGTPASWSAAGIALEVTPAVPSDEACIDYLFFVHDRHDGNKAAARQYLAWETNLVKQIDERELATYRFPAS
>NZ_CP025030.1|WP_100853713.1|1378880_1379894_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKHHALHTCGAVALAVATLMGGTSVQAQAQAQTLQAPADYPKQAITVVSPFPPGGGNDNVARLIAQELGAITGQSVVVENRSGAGGNVGTAQVSRAKPDGYTLVMSQTSVMAVNPRLYKNVGFDPVKDFMPISQITSAPLVLVARTESPYKTLADYLEAARKQPGIITYATPGNGTMSHLMGALVSKKAGVTLVHVPYRGAAPAITDLMGGTVDMLITSPASAEPMVAAGKLRVLALSHENSVGIFKGAPTLKQSGLDGITADDWYGLFAPAGTPPERVAYLAQAVSQAMKSPKVIAKINSGGSWPVGSQPDAFKTRLQEDTVYWADMVKTAGVSLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_5

1499263-1499367

Orphan

Consensus_repeat	Method
AAATTAGCAACAGCCATGCTCATGGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_5

>merge|NZ_CP025030|5|1499263-1499367|CRISPRCasFinder
AAATTAGCAACAGCCATGCTCATGGAAGCACCTTTGGCCCGACTGGTTCTGGGGGGTTGGTGGGAATTAATAATGGTCAAATTAGCAACAGCCATGCTCACGGAA

>NZ_CP025030|5|5|1499263-1499367|CRISPRCasFinder
AAATTAGCAACAGCCATGCTCATGGAA	GCACCTTTGGCCCGACTGGTTCTGGGGGGTTGGTGGGAATTAATAATGGTC
AAATTAGCAACAGCCATGCTCACGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100853777.1\|1496374_1496899_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180777
NZ_CP025030.1\|WP_100853782.1\|1508987_1509887_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176168
NZ_CP025030.1\|WP_100853772.1\|1488139_1488781_+\|shikimate-kinase	unknown	unknown	gnl\|CDD\|234654
NZ_CP025030.1\|WP_100853769.1\|1484981_1485158_-\|lipoprotein	unknown	unknown	gnl\|CDD\|338858
NZ_CP025030.1\|WP_100853773.1\|1488777_1489854_+\|3-dehydroquinate-synthase	unknown	unknown	gnl\|CDD\|234565
NZ_CP025030.1\|WP_100853787.1\|1516146_1516455_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP025030.1\|WP_100853781.1\|1506185_1508987_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|273865
NZ_CP025030.1\|WP_100853774.1\|1491042_1491705_-\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|198303
NZ_CP025030.1\|WP_100853776.1\|1494790_1495975_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341025
NZ_CP025030.1\|WP_100857540.1\|1489878_1491006_+\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|234934
NZ_CP025030.1\|WP_100853785.1\|1514687_1515416_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP025030.1\|WP_100853780.1\|1503182_1505981_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|273865
NZ_CP025030.1\|WP_100853783.1\|1511281_1513489_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|236643
NZ_CP025030.1\|WP_100853779.1\|1500182_1502978_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|273865
NZ_CP025030.1\|WP_100853771.1\|1485574_1488025_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|227342
NZ_CP025030.1\|WP_100853786.1\|1515721_1516030_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP025030.1\|WP_100853775.1\|1491739_1494601_-\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
NZ_CP025030.1\|WP_100853784.1\|1513632_1514610_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP025030.1\|WP_100853770.1\|1485189_1485519_+\|iron-donor-protein-CyaY	unknown	unknown	gnl\|CDD\|234765
NZ_CP025030.1\|WP_050448316.1\|1510011_1511178_+\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	unknown	unknown	gnl\|CDD\|239442

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100853777.1\|1496374_1496899_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180777	PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional.	2.12827e-66
NZ_CP025030.1\|WP_100853782.1\|1508987_1509887_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176168	cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.81831e-102
NZ_CP025030.1\|WP_100853772.1\|1488139_1488781_+\|shikimate-kinase	gnl\|CDD\|234654	PRK00131, aroK, shikimate kinase; Reviewed.	1.04158e-84
NZ_CP025030.1\|WP_100853769.1\|1484981_1485158_-\|lipoprotein	gnl\|CDD\|338858	pfam13627, LPAM_2, Prokaryotic lipoprotein-attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.	0.000664207
NZ_CP025030.1\|WP_100853773.1\|1488777_1489854_+\|3-dehydroquinate-synthase	gnl\|CDD\|234565	PRK00002, aroB, 3-dehydroquinate synthase; Reviewed.	0
NZ_CP025030.1\|WP_100853787.1\|1516146_1516455_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	6.05866e-07
NZ_CP025030.1\|WP_100853781.1\|1506185_1508987_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	gnl\|CDD\|273865	TIGR01901, Heme/hemopexin-binding_protein, filamentous hemagglutinin family N-terminal domain. This model represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. Members generally have a signal sequence, then an intervening region, then the region described by this model. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, heme/hemopexin-binding protein, etc.	2.51612e-22
NZ_CP025030.1\|WP_100853774.1\|1491042_1491705_-\|glutathione-S-transferase-family-protein	gnl\|CDD\|198303	cd03194, GST_C_3, C-terminal, alpha helical domain of an unknown subfamily 3 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	2.60322e-60
NZ_CP025030.1\|WP_100853776.1\|1494790_1495975_+\|MFS-transporter	gnl\|CDD\|341025	cd17472, MFS_YajR_like, Escherichia coli inner membrane transport protein YajR and similar multidrug-efflux transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli inner membrane transport protein YajR and some uncharacterized multidrug-efflux transporters. YajR is a putative proton-driven major facilitator superfamily (MFS) transporter found in many gram-negative bacteria. Unlike most MFS transporters, YajR contains a C-terminal, cytosolic YAM domain, which may play an essential role for the proper functioning of the transporter. YajR-like transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.82837e-126
NZ_CP025030.1\|WP_100857540.1\|1489878_1491006_+\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|234934	PRK01286, PRK01286, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
NZ_CP025030.1\|WP_100853785.1\|1514687_1515416_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	7.22845e-25
NZ_CP025030.1\|WP_100853780.1\|1503182_1505981_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	gnl\|CDD\|273865	TIGR01901, Heme/hemopexin-binding_protein, filamentous hemagglutinin family N-terminal domain. This model represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. Members generally have a signal sequence, then an intervening region, then the region described by this model. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, heme/hemopexin-binding protein, etc.	3.92856e-20
NZ_CP025030.1\|WP_100853783.1\|1511281_1513489_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|236643	PRK10044, PRK10044, ferrichrome outer membrane transporter; Provisional.	0
NZ_CP025030.1\|WP_100853779.1\|1500182_1502978_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	gnl\|CDD\|273865	TIGR01901, Heme/hemopexin-binding_protein, filamentous hemagglutinin family N-terminal domain. This model represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. Members generally have a signal sequence, then an intervening region, then the region described by this model. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, heme/hemopexin-binding protein, etc.	3.62124e-21
NZ_CP025030.1\|WP_100853771.1\|1485574_1488025_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|227342	COG5009, MrcA, Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane].	0
NZ_CP025030.1\|WP_100853786.1\|1515721_1516030_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	2.86491e-07
NZ_CP025030.1\|WP_100853775.1\|1491739_1494601_-\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
NZ_CP025030.1\|WP_100853784.1\|1513632_1514610_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	6.09287e-22
NZ_CP025030.1\|WP_100853770.1\|1485189_1485519_+\|iron-donor-protein-CyaY	gnl\|CDD\|234765	PRK00446, cyaY, frataxin-like protein; Provisional.	2.5133e-44
NZ_CP025030.1\|WP_050448316.1\|1510011_1511178_+\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	gnl\|CDD\|239442	cd03326, MR_like_1, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. This subgroup's function is unknown.	0

>NZ_CP025030.1|WP_100853777.1|1496374_1496899_+|single-stranded-DNA-binding-protein
MASVNKVILVGNLGRDPEVRYSPEGAAICNMSIATTSTWKDKASGERREETEWHRVVMYNRLAEIAGEYLKKGRSVYIEGRLKTRKWQDKDTGADRYSTEVVADQMQMLGGREDGGGGGASYGGGGGYDDAPSRPQQQRAAPAQRPAPQQRPAPASAPASSGANLADMDDDIPF
>NZ_CP025030.1|WP_100853776.1|1494790_1495975_+|MFS-transporter
MPADIKLKLTPSERRASVALAGLFAARMLGLFLLLPVFAVAAAGMPGGDDPARVGLALGMYGLTQAFMQIPFGLASDRWGRRPVVLFGLLLFVAGSIVCAQATDVYWITIGRAIQGAGAISAAVTAWLADATRDEVRTRAMAMVGASIGLSFAVSLVLAPVLVGWWGLSGLFWTIACLGVICLAVARFVVPVVPRTQARTMQAARPMEVLTHRDLLRLNFGVFVLHLIQVSMFVVVPALLAKVGGLDARELWKVYLPVILVSFVLMVPVVFVAEKRRAHRGALRAAVAGLVLVCALMPAASHGFYTLAIALTGFFVAFNVLEALQPSLVSRVAPQAYKGLALGFYNTAQAAGLFMGGALGGWLAAHSGASAVFIGAAILSAVWLAVTWALRPLA
>NZ_CP025030.1|WP_100853775.1|1491739_1494601_-|excinuclease-ABC-subunit-UvrA
MDVTIRIRGARTHNLKNVSLDLPRHKLVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLQLMDKPDVDLIEGLSPAISIEQKAAGHNPRSTVGTITEIHDYLRLLYARVGTPYCPEHGLPLQAQSVSQMVDAVLGWTPETRLAVLAPIARGKKGSFEDECASLQAQGYVRLRVDGQLVEIDGMAPLKKTEKHDIDVVIDRLRIKPESKQRLAESFETALQLADGRALALDMDSEHEQVFSSRYACPVCSHSLPELEPRLFSFNNPMGACPSCDGIGQVGFFDPKRVVAFPELSLAAGAIRGWDRRNAFTHSLLASLAAHYEFDIEAPFEELPEALRDKVLYGSGEEEISFLYLNEKGRSTVKRHTFEGVIPNLERRWRETDSATVREELGKYRNIKTCPDCAGSRLRPEARNVLIGHDPRGGERHGQAIYEVEAMPLSGCLAWFRDLSLTGAKQEIAQRIVREIEARLSFLNNVGLNYLSLDRSADTISGGEAQRIRLASQIGSGLTGVMYVLDEPSIGLHQRDNDRLIGTLQHLRDLGNSVIVVEHDEDMIRMADWVVDMGPGAGEHGGEVVSQGDPETVQRDPNSLTGQYLSGAREIAIPPRRPVNDELPWLTLSGASGNNLKDVELRVPAGRLVCVTGVSGSGKSTLINDTLAVAVSRQLHHAQSEPAPYVSMQGLENFDKIISVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPEARTRGYDPGRFSFNVKGGRCEACQGDGVVKVEMHFLPDMYVPCDVCHGKRYNRETLEIRYRGRNISEVLDLTVEQALDYFESVPAISRKLHTLIDVGLSYIRLGQSATTLSGGEAQRVKLSLELSRRSTGRTLYILDEPTTGLHFRDIELLLQVLNQLVDSGNTVLIIEHNLDVIKTADWLIDMGPEGGDGGGYVVAQGTPEDVANTQASHTGQYLGKLLRRNASR
>NZ_CP025030.1|WP_100853774.1|1491042_1491705_-|glutathione-S-transferase-family-protein
MYTLIIGNKNYSSWSLRPWLALRATGIAFTEQKLGFFTEEFSRKVGAVSPAGLVPVLLDGDFAVWDSLAICEYVAEQRPEAGLWPKDAKARARARSLVAQMHSGFGALRNALPMNIEAHLPGIKLPEAAQQDISRLQAIWHDTRAEFGHGGPFLFGAFSIADAFFAPVVSRFTTYGIAAAGAVRDYMDAVLALPAMQDWMRDARAEATFVPEDEPYRKHR
>NZ_CP025030.1|WP_100857540.1|1489878_1491006_+|deoxyguanosinetriphosphate-triphosphohydrolase
MNELASYASDPSQSRGRKTAEAPPENRTEFQRDRDRIVHSGAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARTLARSLKLSEDLTEAISLAHDLGHTPFGHAGQDELNACMRELAPEAGGFEHNLQSLRVVDELEERYADFNGLNLCFETREGILKHCSAAHARQLGDVGERFLSRTQPSLEAQLANLADEVAYNNHDIDDGLRSGLITLEQLQDVSIFERHHAYVLDRYPGLAPRRAVAETIRRMINTLIGDLTQTSLARIRDAAPASVDDVRRSPPLAGFSDDIRREADALKKFLFDNLYRHYQVLRMTAKARRIVRELFAAFLDDPRLLPPDYRRPAFNEQARAIADYIAGMTDRYAIREHKRLFEMG
>NZ_CP025030.1|WP_100853773.1|1488777_1489854_+|3-dehydroquinate-synthase
MNVVDVDTPGGSYPIHIGPGRIDALDQCIPADATAIAVVTNPTVAALYGERAEAALARTGKRVLRIELPDGEAYKDWQSLNLIFDALLTHRLDRRCVLVALGGGVIGDMTGFAAAVYMRGVRFLQVPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPVAVEIDTDVLNTLPAREVSAGLAEVIKYGLILDPDFWTWCEDNAAKLRALDPQAVAHAIRRSCELKAQVVGKDERESGLRAILNLGHTFGHAIESGLGYGAWLHGEAVGCGMVQAAELSADVAGFDRADVERVRALVAAIGCPVVAPDLGADRWLDLMQVDKKTEGGSIRYVLMPRIGEAFMRAAPDDAVRAVLSRTTQ
>NZ_CP025030.1|WP_100853772.1|1488139_1488781_+|shikimate-kinase
MNFSAHSCPEADPDPAPTGEAPENVPCAVECTGKAVPLPHDLPVFLVGMMGAGKTTIGRSLARALGREFMDLDHELEARCGVRVPVIFEIEGEAGFRRRESAALEECTQRRNIILATGGGAILAAENRQRLHERGIVIYLRASVDELFRRTCRDRNRPLLATADPRGTLRDLMTLREPLYKEVADLVVETGATPIHTLVKALLPQLQAFEKRI
>NZ_CP025030.1|WP_100853771.1|1485574_1488025_-|PBP1A-family-penicillin-binding-protein
MSKPQNSSKKDKPAKSGSPILRFFVKTGIFCVGLFLCGVLLAGMALALAWPNLPNLNAMTDYRPRVPLRVYTADRVLIGEFGEERRNVLRFNEIPDVMKSAVLAAEDDRFYQHGGIDWMGVVRAGLTNVINMSKTQGASTITMQVARNFYLSSEKTYSRKFYELLLTFKIESELTKDQILELYMNQIYLGHRAYGFAAASRAYFGKPLSEVTPAEAAMLAGIPKAPSRFNPISNRPRAELRQRYVLGRMLSLGYLTEPEYKQAMAQPIVMKSAEGTPAGGYAIHGEYVAELARQLLYNVYQDNVYSRGINIYTTVQSKDQEAAYRAVREGVLEYTRRAPYPGPEEQLDLPPGTESNPAALDEFLDGVFDKFSDSGDLLTALVLSASPTEVKLARSSREIITITDKKVLAVVARALNDKAKPDQRIKRGSVVYIRKFGDHWEIINLPSVQAAFVALTPQDGAIRALVGGFDFYRGNFNRVTQAWRQPGSNIKPFIYAASLERGLTPATQISDQPFELTAAQTGSKAWNPKNYGNQYEPMLTLRQGLYKSKNMVSIRILQAIGPQYAQDYLTRFGFDKARQPPVLPLALGAGSVTPLQLAGAFSVFANGGYRVTPYLIDRVTDSSGKVIMQSRPVVAGDAAARAIDPRTAWVMDDILRGVATYGTAARARVLLKRNDIAGKTGTTNESVDAWFSGYTPNLVATSWLGFDQPKSLGSRETGGGVAMPIWVDYMQDVLKGVPEEKPRPRPDGLIVENGEYYFSEFPPGQAVARLGLAEADTLGEFLNGLGSGSSNPDTQIKVAPGVGTQNTAPWSQKIPF
>NZ_CP025030.1|WP_100853770.1|1485189_1485519_+|iron-donor-protein-CyaY
MTETEFLALIDQVLDSIESQADDWAASLDVDVETSRSGNVLTMVFEDNTHVVVNSQAAMQELWVAARSGGFHYRYDGQHWHDTRGGPQLPDALSQICSAAAGVPVTLKL
>NZ_CP025030.1|WP_100853769.1|1484981_1485158_-|lipoprotein
MFQLAFSRMALRIVATLVASGMVAACGYKGPLYMPTPDGKPPSSSQPAPQIPPVPSVP
>NZ_CP025030.1|WP_100853779.1|1500182_1502978_+|filamentous-hemagglutinin-N-terminal-domain-containing-protein
MNNRSQIIKNKKQRRARRSLPTAYPILACMSSSMILLAGSAYAQNLPMGGNITSGKGSISEPNRLSKKIEQASDKLSIDWTSFNIASGSRVDFHQPDANAIALNRVVGINGSKIMGQLNANGRVFLINPNGVLFGKTAKVNVGGLVASTLKLSNEDFNEGRFRFVGDGRPTLASVVNEGVLVAAEGGTIALLGGQVENKGVIRAKQGAIALAAGERITLGVSEDGLLNVEIDQAGLNALVSNQNALTAQGGQVTLKARAANAVAHAVVNNQGLIEAQTLNGRSGKIVLDGGEQGTVLAAGTLNASAFSGNAGDITVQGQRVDLRGNLLATAGGQGDGGNVLVQGRQVQMEGSAQVDTRAATGNVGWLTLEADQISVTTQEVPLVSGISGEHLNQQLAKNNIALKSTQGDLRVLEEISWDADTTLSLDAKKSVRLNANVEVSGDKAGFVMNHGADADYILGKDVAVTLPGAQASLRINGQDYQLIRNVHELQAIENNLNGYYALANRIDASETADWNGGRGFVPIGGYYRTPQEKFQGELTGLGHTIDHLTIKMDSSNTVKQVGVFSNSYGVLRNIGLVNQNISVARPNQQNIIGGLVAVNAGVVKYAHSSGQTSTTRFSHIIGGLVGYNLGEILQSHSRSVLRGGPSDAFELAYVGGLVGLNSGRIAHSYATGDIHGKLSASGGLVGRNRGTGSIEYTYATGNIASTIFAGGLVGENGGQISNSHARGSTDGEYYSGGLVGSNNETGIIMDSRASGDATNRSHFGRAGGLAGQNFGLINRSHASGSANGSRDNLVGGLVGSNERSGTIRDSSASGTVTAGFENRRDRVGTVGGLVGSNAGLIANSYASGNVIGLHDQNAVGGLVGLNSGLIEQSYSSGAVIGKGIQGSLVGWNVHPDSDGTLSEIRQSLGSGTVNGEDGPQVGLDEGTFEW
>NZ_CP025030.1|WP_100853780.1|1503182_1505981_+|filamentous-hemagglutinin-N-terminal-domain-containing-protein
MNNRSQIIKNKKQRRARRALRTAYPILACVSSSMMLLAGSAYAQNLPMGGNITSGKGSISEPNRLSKKIQQTSDKLSIDWTSFNIASGSRVDFHQPDANAIALNRVIGTDGSKIMGQLNANGRVFLINPNGVLFGKTAKVSVGGLVASTLKLSNEDFNEGRFRFIGDGRPTLASVVNEGVLVAAEGGTIALLGGQVENKGVIRAKQGAIALAAGERISLGVSEDGLLNVEIDQAGLNALVSNHNALTAQGGQVTLKARASNAVAHAVVNNQGLIEAQTLNGRSGTIVLDGGEQGTVLAAGTLNASAFSGNAGDITVQGQRVDLRGNLLATAGGQGDGGNVLVQGRQVQMEGSAQVDTRAAAGNGGWLTLEADQISVTTQEVPLVSGISGEHLNQQLAKNNIALKSTQGDLRVLEEISWDADTTLSLDAKKSVRLNANVEVSGDKAGFVMNHGADADYILGKDVAVTLPGAQASLRINGQDYQLIRNVHELQAVENNLNGYYALANRIDASETADWNKGGGFVPIGGDGGSVKDRFNGTLTGLGHSVDNLTIKVDSSNTVKQVGLFSNSYGVLRNIGLLNQNISAARVGRPNFVGGLVAANFGTVKYAHSSGQIVTTQIKDSLGGLVGVNEGEVLHSYSRSVVRGVPALGGQLGYVGGLVGKNSGRIAHSHATGDVHGGFSSAGGLVGANIERGNIQNSYATGNTTSSFLAGGLAGINRGQISNGHARGNVSGRNNTGGLVGINGVAGIIVDSRASGDAVSQYFGVGGLVGTNEGMIKRAHASGNVKGNVNAVGGLVGTNLGGMISDSSASGTATAGDHSTNMSGAVGGLVGQNSQYEGRAGTIINSYASGDVIGTRDQDMVGGLVGSNLGVIQASYSSGHVSGKGIKGSLVGWNFHPDSYGSVSEIRQSVGSGTVDGQEGPQVGIDQGTFDW
>NZ_CP025030.1|WP_100853781.1|1506185_1508987_+|filamentous-hemagglutinin-N-terminal-domain-containing-protein
MNNRRQSVKNKKERRARRALRTAYPILVCVSSSMMLLAGSAYAQNLPMGGNITSGKGSISEPNRLSKKIQQTSEKLSIDWTSFNIASGSRVDFQQPNANAIALNRVIGTDGSKIMGQLNANGRVFLINPNGVLFGKTAKVNVGGLVASTLKLSNEDFNEGRFRFIGDGRPTLASVVNEGVLVAAEGGTIALLGGQVENKGVIRAKQGAIALAAGERITLGVSEDGLLNVEIDQAGLNALVSNHNALTAQGGQVTLKARASNAVAHAVVNNQGLIEAQTLNGRSGKIVLDGGEQGTVLAAGTLNASAFSGNAGDITVQGQRVDLRGNLLATAGGQGDGGNVLVQGRQVQMEGSAQVDTRAAAGNGGWLTLEADQISVTTQEVPLVSGISGEHLNQQLAKNNIALKSTQGDLRVLEEISWDADTTLSLDAKKSVRLNANVEVSGDKAGFVMNHGADADYILGKNVTVTLPGAQASLRINGQDYQLIRNVHELQAIDNKLDGFYALANGIDASETATWHAGAGFRPIGGDNGSETHRFRGVLTGMGHAVNKLTMNVDSSDYKGYVGVFSDSYGVLRNVGLQDYSISASGLDSSYAVGGLVGANFGVVKYAHTSGQIRTTQIVNLLGGLVGYNVGEVSNSYSHGTVDGASNHGGKSMSGGLVGSNEGRIARSYSTAVINGRQSYAGGLVGSNYGGKIEQSYATGDVSSLFYAGGLAGENYGSINNSYASGNSSGHTAGGLVGLNFPGRTIADSRASGNATSTSGGYLGGLVGENAGLILRSHASGDATGGQDSRVGGLVGINRGGIIRQSSASGMATTGGRSSGAYPRGSAGGLVGSNFSAHGNTALIIDSYASGNAAGTHEQDAVGGLVGANSGVIESSSSSGQALGKGIMGSLVGWNFHPDTYGTESEIRQSLGSGTVNGENGPQVGIDQGTFEW
>NZ_CP025030.1|WP_100853782.1|1508987_1509887_-|LysR-family-transcriptional-regulator
MKTDIASELEFFIHLARLGSLSAAARELNLTPPAATKRLALMERRLGVRLVNRSTRNLSLTSEGETYLSHATKILEDLRDMEDAVSSSGATPRGALKVNATLGFGRTTIAPLVSDFAKRYPEVQVQLEVTDRPVDLVESGFDLGIRFGELPDRRLSARRVMSNRRFLCAAPRYLDKHGTPATLADLASHRCILHTQNDEAHGVWRFTRDGESVAIKVDGALSSNDGDIVLGWALDGHGILIRSEWDLAKYLKSGRLRVVLPDITLPSADLFVYYPQRRNQTARARAFIDYLVEVFKRSG
>NZ_CP025030.1|WP_050448316.1|1510011_1511178_+|mandelate-racemase/muconate-lactonizing-enzyme-family-protein
MRIVEIREQTLPISSPIRNAYIDFSKMTLSLVAVITDVIRDGKPVVGYGFNSNGRYGQGKLMRERFIPRVMEADPESLVDATGKNLDPHKIWNAMFTNEKPGGHGERSVAIGTIDMAVWDAVAKIEGKPLFQLLADRYGNGQADRRVFVYAAGGYYYPGQDHGKLKDEMRSYIDRGYTVVKKKIGGASLDEDLRRIDSILSVLQDGQKLAVDANGRFDLDTAIQYAKALSQYDLFWYEEAGDPLDYELQATLRNYYANPMATGENLFSMQDARNLIRHGGMRPDRDWLQFDCALSYGLVEYLRTLDMLKQHGWSASRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPFGGFPDGVKVDGGYVTMPELPGIGFEGKSDLITVMRQLSA
>NZ_CP025030.1|WP_100853783.1|1511281_1513489_-|TonB-dependent-siderophore-receptor
MSFTKKPLPLALLAAIAASPAIVAAQTASPAASGVTTLAPVVVQGARDASPTSGADFVATRSRSGTKSDAELIDTPQTINVITRNEMDQRGVTSVAQAVRYTPGVIAQYGDNDVRYDWLTIRGFTPSRYLDGLLLPFGARGYSQPRIDTYGLERIEILKGPSSGLYGQSAPGGLVNMTSKRPTAEPLNEVVLQAGSFNRFQGAFDFSGPADEEGKFLYRLTGTLRDSDTQYRHVDDERQFIAPSFTWRPSSDTSLNLSAQYQKITSHGGGGAPVLPVIGTLEKSDTAGYIPRDRFVGEPGYDIFTNEQTMVGYTLDHRVNNTWSLRQSARYTNVDTNTRRVQIGAMVSDTQAIRYAWAFPETSHTFQIDNQLNAKFSSGPMRHDLTFGLDYLREKSRYNESSLGLMLPPASPLFDVFDPDYGTSVTRPPTATKINMTRSQLGLYAQDQIELDRLRFTFAGRYDWTEGTTDNGTVGSGGQWGWTSRKADADRFTGRAGVTYRFDNGLSPYLSYSTSFQPMTGVTRDGSALKPTTGEQYEAGVKFQPDGYDSFITLSAFQITQKNVSTPDPVNTSFVVQTGEAQVQGIELEGKASFDNGLDLTMSYALSDSEITKTNVAAQRGNQLIFVPRHQAALWADYTLRDGPLQGVGLGAGVTYRGGFYGDLNNRYAIPAVTLVDAAIRYDLGRASPTLAGAQVALNVSNLFDKRYVANCLGTAVSCYWGAERTVMATLRYRW
>NZ_CP025030.1|WP_100853784.1|1513632_1514610_+|helix-turn-helix-transcriptional-regulator
MPASATAPLSTLSLPDPCTGPIKPHEWWRGTLPTVPATDDWEDVIEKVLRVDDGVSLVVLDGCPRRTLTIPAPGAPVFGMQVWLEGDALLALEGGEPLKVTGGAALLFNHERVMGWATHLPARRRVRMVDIRYTPDALARAGGTMPLGLLRQRFHRDVSVPAHGSLVASLDAPPSLLALAGSLSSDAPPAADARRLWYRAKSLEMLSAFVQLLSLPAALAGPAAHEHQRIRHACQLLRDRCAEHWPPGLLARTVGLSEKRLQQLMRECVGRSVHAYLSDMRLARASDLLQAGMSVTQVAGEVGFSSLSHFSKVFKLRYGASPRSW
>NZ_CP025030.1|WP_100853785.1|1514687_1515416_+|class-I-SAM-dependent-methyltransferase
MTQNIYDTAEFFEGYSQMARSVHGLDGAPEWPALRALIPALAGSRVVDLGCGFGWFCRWAEAQGAAQVLGLDVSQNMLDRARATTPAGPIAYQRADLENLALPAAAYDLAYSSLTLHYIERLPELLAAIYRALTPGGHFVFSAEHPIYTAPAQPGFVQDATGRRVWPLNQYAVEGPRTTDWLAKGVIKQHRTLGTYLNQLIAAGFTITHVQEWAPTAEQLAAQPALDEERDRPMMVLVAATR
>NZ_CP025030.1|WP_100853786.1|1515721_1516030_+|DUF4148-domain-containing-protein
MKTLVSALILSASFIGAAQAGELDYPPELNTASTVTRAQVQQELAAARANGELSFGEEGYAATTFADVGSDKTRAQVKQELAAARAQGLTESNELAYPPVQG
>NZ_CP025030.1|WP_100853787.1|1516146_1516455_+|DUF4148-domain-containing-protein
MKTLVSALILSASFIGAAQAGELDYPPPLNTASTLTRAQVQQELADARANGELVFGEEGESATAFAAVGADKTRAQVKQELAAARAQGLTDTGELDYPPVQG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_6

2067709-2067806

Orphan

Consensus_repeat	Method
TGCCGCGCTGCACCCATCCTACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_6

>merge|NZ_CP025030|6|2067709-2067806|CRISPRCasFinder
TGCCGCGCTGCACCCATCCTACGGACCGTGTGATGGGTTCCGCGCGATTGGCATTTTCGTTCTAGGCACGGCTGTGCCGCGCTGCACCCATCCTACGG

>NZ_CP025030|6|6|2067709-2067806|CRISPRCasFinder
TGCCGCGCTGCACCCATCCTACGG	ACCGTGTGATGGGTTCCGCGCGATTGGCATTTTCGTTCTAGGCACGGCTG
TGCCGCGCTGCACCCATCCTACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100854223.1\|2080501_2081407_-\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|188630
NZ_CP025030.1\|WP_100854215.1\|2066936_2067554_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025030.1\|WP_100854219.1\|2074363_2075446_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176161
NZ_CP025030.1\|WP_100854206.1\|2057920_2059096_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380582
NZ_CP025030.1\|WP_100854209.1\|2061838_2062867_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP025030.1\|WP_100854213.1\|2064740_2065817_-\|gentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|131325
NZ_CP025030.1\|WP_100854217.1\|2069539_2072755_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP025030.1\|WP_100854208.1\|2060454_2061807_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|378963
NZ_CP025030.1\|WP_100854224.1\|2081443_2083219_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224097
NZ_CP025030.1\|WP_100854214.1\|2066001_2066937_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274127
NZ_CP025030.1\|WP_100854210.1\|2062859_2063237_-\|chorismate-mutase	unknown	unknown	gnl\|CDD\|214841
NZ_CP025030.1\|WP_100854220.1\|2075598_2076714_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP025030.1\|WP_100854207.1\|2059208_2060435_-\|3-hydroxybenzoate-6-monooxygenase	unknown	unknown	gnl\|CDD\|181262
NZ_CP025030.1\|WP_100854216.1\|2067994_2069473_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP025030.1\|WP_100854212.1\|2063901_2064600_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP025030.1\|WP_100857579.1\|2072781_2073981_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP025030.1\|WP_100854222.1\|2077734_2078562_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|131484
NZ_CP025030.1\|WP_100854211.1\|2063251_2063890_-\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527
NZ_CP025030.1\|WP_100857483.1\|2078643_2079915_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP025030.1\|WP_100854221.1\|2076831_2077614_+\|phytanoyl-CoA-dioxygenase	unknown	unknown	gnl\|CDD\|227609

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100854223.1\|2080501_2081407_-\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|188630	cd00408, DHDPS-like, Dihydrodipicolinate synthase family. Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.	1.16073e-91
NZ_CP025030.1\|WP_100857579.1\|2072781_2073981_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.38022e-79
NZ_CP025030.1\|WP_100854219.1\|2074363_2075446_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176161	cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.63215e-113
NZ_CP025030.1\|WP_100854206.1\|2057920_2059096_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380582	cd06359, PBP1_Nba-like, type 1 periplasmic binding component of active transport systems predicted to be involved in 2-nitrobenzoic acid degradation pathway. This group includes the type 1 periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway; their substrate specificities are not well characterized.	4.10365e-167
NZ_CP025030.1\|WP_100854209.1\|2061838_2062867_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	5.44711e-119
NZ_CP025030.1\|WP_100854213.1\|2064740_2065817_-\|gentisate-1,2-dioxygenase	gnl\|CDD\|131325	TIGR02272, gentisate_12-dioxygenase, gentisate 1,2-dioxygenase. This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.	0
NZ_CP025030.1\|WP_100854217.1\|2069539_2072755_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP025030.1\|WP_100854208.1\|2060454_2061807_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|378963	pfam12831, FAD_oxidored, FAD dependent oxidoreductase. This family of proteins contains FAD dependent oxidoreductases and related proteins.	4.43569e-131
NZ_CP025030.1\|WP_100854207.1\|2059208_2060435_-\|3-hydroxybenzoate-6-monooxygenase	gnl\|CDD\|181262	PRK08163, PRK08163, 3-hydroxybenzoate 6-monooxygenase.	0
NZ_CP025030.1\|WP_100854210.1\|2062859_2063237_-\|chorismate-mutase	gnl\|CDD\|214841	smart00830, CM_2, Chorismate mutase type II. Chorismate mutase, catalyses the conversion of chorismate to prephenate in the pathway of tyrosine and phenylalanine biosynthesis. This enzyme is negatively regulated by tyrosine, tryptophan and phenylalanine..	1.59508e-13
NZ_CP025030.1\|WP_100854220.1\|2075598_2076714_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	5.57136e-46
NZ_CP025030.1\|WP_100854214.1\|2066001_2066937_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|274127	TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria. [Energy metabolism, Other, Regulatory functions, DNA interactions].	3.18688e-45
NZ_CP025030.1\|WP_100854216.1\|2067994_2069473_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	2.61583e-103
NZ_CP025030.1\|WP_100854212.1\|2063901_2064600_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	1.59696e-88
NZ_CP025030.1\|WP_100854224.1\|2081443_2083219_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	3.4879e-76
NZ_CP025030.1\|WP_100854222.1\|2077734_2078562_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|131484	TIGR02431, p-hydroxybenzoate_hydroxylase_transcriptional, beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions].	4.58503e-72
NZ_CP025030.1\|WP_100854211.1\|2063251_2063890_-\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	1.52466e-103
NZ_CP025030.1\|WP_100857483.1\|2078643_2079915_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.66662e-136
NZ_CP025030.1\|WP_100854221.1\|2076831_2077614_+\|phytanoyl-CoA-dioxygenase	gnl\|CDD\|227609	COG5285, COG5285, Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Secondary metabolites biosynthesis, transport, and catabolism].	1.85886e-29

>NZ_CP025030.1|WP_100854215.1|2066936_2067554_+|hypothetical-protein
MPSSGNRPQAGLNTLIAQCRKVEAVLSAMDERGGPVGSSAMRMHDPDDPAASSAMHRFVADMDARRAPPGMWSPLVLAVLVMTGGLGVGIEVLSLLLRSAGAAWAAFALVAVCAGTALALAIGVVWVMAGRSAGLVVVKWLVLGLVTVGALGVAVWTQGGITAVGPVLALLGGLGAWLVVNSAAFYVFAGYRVAQRVAQRGRLPT
>NZ_CP025030.1|WP_100854214.1|2066001_2066937_+|LysR-family-transcriptional-regulator
MDWTHRLRLRNLKMLLSLAQTRNISHSAAMLNTTQPGLSKWLKDLEDDIGLPLFERHARGLRPTPHGDVLIAHAQRLEAQLDRAGADMAALREGGGGRVVIGASGASASDTVPLAVMKLLERMPQARVKLVEGTTDRLLAQLAQGDLDIVVGRSAPEHHDPAIRFEALYLEPIHLVARPRHPLFTIEQPTWPDLLSYRWILWPKGTPIRNAVDAALAAAGQAPPADHVESNSVTINLTLINNSDMIGVASHRAALRFSQMRAMRIIPVRLSGFGSVAMYWREDAFRPLAVQEAMAALRNTVAEHAPGVTRL
>NZ_CP025030.1|WP_100854213.1|2064740_2065817_-|gentisate-1,2-dioxygenase
MPDGHTTGAERSTDRSADRSNYYARIAKKHMAPLWESLHNLVPRQPAPRCVPAIWKYDDVRDDVMASGSLITAEEAVRRVLILENPGLPGQASITQSLYAGLQLILPGEVAPSHRHTQSALRFIVEGRGAYTAVNGERTTMHPGDFIITPSWTWHDHGNAETVEGGEPVVWLDGLDIPLLRFLDAGFAENYPQAAQPVTRPEGDSMARFGHNMAPVRHQVSSGTSPIFNYPYERSREALDALYRHGELDAWDGVKLRYLNPATGGYPMPTMATFMQFLPAGFQGRPYRSTDSTVYSVVEGRGIARIGEEEFHFGPRDVFVAPSWLPVQLAALDDATLFSYSDRPVQDALGVWREERAG
>NZ_CP025030.1|WP_100854212.1|2063901_2064600_-|fumarylacetoacetate-hydrolase-family-protein
MPFVFAPAAPVAVPIAGGQDAFPVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADAVVPVADGQTLELPYPPETANLHYEIELVAAIGQGGANIAVDNALQHVWGYAVGLDMTRRDLQMKMREAGRPWELGKAFDQSAPIGPLHPAASVAGIEQAGIWLQVNGADKQRSDIGKLIWSVAETIAYLSRYFRLEPGDLIYTGTPEGVGPVVRGDKMLGGVDGLGTLSVQMV
>NZ_CP025030.1|WP_100854211.1|2063251_2063890_-|maleylacetoacetate-isomerase
MQLHSFFNSSTSYRVRIALALKGLPYEILPVNLRKQEQRAPEYVAKNPSAGVPLLIDRDVQLSQSLAIIDYLDATHPEPRLIPADTLARARVLELSNAIACDIHPVNNMRILRYLQDVLGASDAQKNTWYQHWVNEGLGAVEELLARHGHGAYCFGDAPTLADCCLVPQVANAQRMGCDLSAFPRILRIHEHCNAQPAFQHAAPARQPDATP
>NZ_CP025030.1|WP_100854210.1|2062859_2063237_-|chorismate-mutase
MQEPDTHGAPLREYTDPAYQPLCANLAEVRANIDRLDDEIVRLIADRALYVKDAARFKRDAYQVSAPARQAQVFDKARALATRHNRGFANLESVVDATYRAMVAAFIANEQTYFDNMKNVGDTDD
>NZ_CP025030.1|WP_100854209.1|2061838_2062867_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MTEFSPLKRHLGRPLSLAARVLTLAVAVIGPLAAPLSAAHAADAWPSQPLKAVVPFGPGSSPDQVARVVGEKASAILGQSIVIENKPGASGNIGTYAIANAKPDGYTFGVSITGPLVNNTLLFDKLPYAPATDLSPLTLAVHQPNVLVVPASAGITNVGQLLDALKKNPDKYNFPSTGAGTVSHLAVELMLQQIGGRATHVPYPSSPAALTSLLSGDTQFAALPPIAVMPMVKDGRLKALAVTSSKRSALLPDIPTLAEAGVSGIEGSAWIGFVVSSKVPADIQKKLSDALIQAIRDPEVAKRLQAQYMDPVGSTPAEFRAYMDDELKRWEPLIKKLGIKGQ
>NZ_CP025030.1|WP_100854208.1|2060454_2061807_-|FAD-dependent-oxidoreductase
MLITEPARQVPLYGEFDVVVLGGGPAGVLAAASAARNGARVLLVERYGFLGGMGTAAGVSNFCGLHANIHGNIRQVVHGMTDELLDRMRAMDGLNDPHLILGKIHAQAYDISAFKCAADGMVQDSGAQVLFHALATGLARDPQGRVDVLFLETKSGRCAVRARVFIDCSGDGDIAQWGGLPFEKGDEHGHMLYPTLMFKVGNVDGARAQEAWKTIPLLMDEAAASGEFTFPRRGAIVRPQKHDYEWRVNVTQLANADGSAADGTDVGSLSAGELEGRRQIVQYLAFLRAKVPGFEQAYVLDIAPQLGIRETRRIVGEAMLTKEHVLGCADFEDSIGVNGWPLEMHTAGDVKWAWPPIPESRGYNQLPFRMMVPKRGPGVADNVLVAGRCASMTHEGQSAARVSGSCFVMGEAAGTAAAMALRAGVMPAELPIAALQAQLTRQGAFLGGQE
>NZ_CP025030.1|WP_100854207.1|2059208_2060435_-|3-hydroxybenzoate-6-monooxygenase
MNASSTTTGTTTPATRSIIVVGGGIGGLAAALALTRQGIAVQLLEQAAHIGEIGAGIQLGPNAFAALDALGVGKTARTRAVFTDHIIMMDAVDAQEVVRIDTGEAFRARFGGPYAVIHRADIHLSILEAVQQNPLIRFRTSTQIAAMSQDGQGVEVVDTKGERYRADAVVGADGVKSVIRERIVGDPARVTGHVVYRAVVERENMPEELRINAPVLWAGPRCHLVHYPLRGGQQYNLVVTFHSREEEQWGVREGSKAEVLSYFDGIHPRPHQMLDRPTSWKRWATADRDPVEHWGQGRVTLLGDAAHPMTQYMAQGACMALEDAVTLGEAVRQCGHDLEAAFRLYESVRIPRSARVVWSTREMGRLYHARGVERTVRNMLWTGRSQSQFYDALQWLYGWKVERCLAPM
>NZ_CP025030.1|WP_100854206.1|2057920_2059096_-|ABC-transporter-substrate-binding-protein
MTCHILRGAAALALALTACAAGAQGKPLDIGFIGTLSTPAGYIGEDERDAFMLAVKEGGGKLGGVPVNVRVEDDALKPANAKQTADRMVQDGVRLFTGVNFSNVMAAVGPTVLNAGGFYVSLNAGPSNYAGKACNPNYFAVAFQNDSYADTAGIAANELGVKRVAVMAPNYQAGRDAVAGFKRAYKGDIVEEIYTKLDQSDFSVELARIRALNPDAIFQFHPGGAGINLTKQFANSGLSDKIKMITPLYSMDERMLAATGTAGKGFYLSSLWSADLDNAQNKHFVEAFTKAYQRAPTAYAAQAYDTANLIASALKAVNGDITGRADDFRAALRKADFASVRGKFKFGPNQHPIQDWYLLHIEADASGKLIYKNVKVLARDHTDVHAANCKM
>NZ_CP025030.1|WP_100854216.1|2067994_2069473_-|efflux-transporter-outer-membrane-subunit
MIQRLTRGSALLAVLLVLAGCAVGPTYEKPSAASPAAFKEAALPASEAGTWKPAEPSEDALRGAWWKVFGDEGLNQLEEEAQQANQNLQAAAARLAQSRALQREARAGFFPTLDAAFGPNRQRPSAVSQGLPDGTSTSPVTTWRAQGAVSYEADLFGRVASTADAATADAQQSEALYRSVLLALQADVASTYFLVREQDAESQLYHQTVKLRTDTLQLIQRRFDAGDISELDLARAKSELASAQSEALGIDRRRAAAEHALAVLLGRAPSDFTMPPQPIEKVALSIPAGLPSTLLERRPDIAAAERAMAAANARVGAAKSAFFPRLDITGAFGYESSDLGNLFQWSSRTFLLGPLVGAALSMPIFDGGRRQAGLDRARAVYEEDVAVYRQTVLNAFREVEDNLANLRILADQTKAQDAAVEASARAAMLSHTQYREGSISYLDVIEADRSVLLQQRVAVQLSGEQARSAVALIRAIGGGWDNPVPPDTVAAR
>NZ_CP025030.1|WP_100854217.1|2069539_2072755_-|efflux-RND-transporter-permease-subunit
MNISKFFIDRPIFAGVLSILVLLAGLLAMFQLPISEYPEVVPPSVVVRAQYPGANPKVIAETVASPLEESINGVEDMLYMQSQANSDGNLTLTVNFKLGVDPDKAQQLVQNRVSQALPRLPPDVQRLGVTTAKSSPTLTLVVHLISPNDRYDITYLRNYAILNIKDRLARITGVGEVTVWGSGNYSMRIWLDPQKVAQRGMTASEVVAAIREQNVQVAAGVIGASPTQGDVPLQLNVNARGRLQTEEEFRGIILKTSPDGAVTYLSDVARVELDAQEYGLRSLLDNKQAVGMGIMQSPGANALDVSSQVRAAMAELAQDFPPGVEYRIEYDPTQFVRSSIEAVVHTLLEAIALVVLVVILFLQTWRASIIPLLAVPVSIVGTFALLLVFGYSINALSLFGMVLAIGIVVDDAIVVVENVERNIAAGLSPRDATYRAMREVSGPIIAIALTLCAVFVPLAFMTGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSALLLKSHHDKPDWLTRGMNRVFGRFFNWFNNMFGRASESYGTGVSNVIRRKAGAMGVYAVLVAATIGVSYLVPGGFVPAQDKQYLIGFTQLPNGASLDRTEAVIRRMSDIALKEPGVQSAIAFPGLSINGFTNSSSAGIVFVTLKPFGERKSAELSGDAIAASLNQKFAAIQDSFIAVFPPPPVMGLGTLGGFKLQLEDRAALGYAELDKAKQAFLAKARETPELGPAFSSYEINVPQLDVDLDRVKAKQLGVPVTEVFDTMQIYLGSMYVNDFNRFGRVFQVRAQADAQFRAHADDILQLKTRNAAGDMVPLSSLVTVNQTFGPEMVVRYNGYTAADINGGPAPGYSSDQAQAAAERVAAETLPRGVKFEWTDLTYQQILAGNAGLWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILAALTGVYLTGNDNNIFTQIGLMVLVGLSAKNAILIVEFARELEMSGRTPLEAAIEASRLRLRPILMTSIAFIMGVVPLVLSSGAGSEMRHAMGVAVFFGMLGVTLFGLFLTPVFYVLLRSLGGKPLHSAAPHEAPECAPHIDTNAPPATQPHA
>NZ_CP025030.1|WP_100857579.1|2072781_2073981_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MMVSRNRIALLVVFAAVLAAGGGYALTRGPAGGNVAMAQGAPAAPPVEVAEVINKTIVDWQRYSGRLEAIDRVDIRPLVSGTLTKVHFQDGSIVKKGDVLFTIDPRPYKAEVDRAAAALTAARARASYTAADLARGQRLLKDNAIARRDFEEKQNASREAAANLQGAQAALDYAKLNLGYTSIEAPVDGRVSRAEVTEGNVVAAGAGSVPLTTLVSVSKMYASFDVDEQTFLKYVNPARNGKAGSVPVELGLANEEGYSRTGVVQSVDNRLDATSGTIRVRAEFDNADGSLLPGLYARVRLGGSEPRSAVLIDEKAIGTDQDKRYVLVLDDKNHAVYRQVKLGANQEGLRVVDSGLAVGDRIVVNGLQRIRPGDAVTPTVVPMVAAKRAPVQTAAAQVQ
>NZ_CP025030.1|WP_100854219.1|2074363_2075446_+|LysR-family-transcriptional-regulator
MDRFQAMQVFVRVVDANSFTRAADSLSLPRTTVTTIIQNLERLLGVRLLNRTTRRIGLTPDGAGYYQHCVRILADVEETEACFQEAALRLKGRLRIDVPTCIGRLILIPSLCDFHDKYPDVELVLGLGDRPVDMVQEAVDCVIRAGDLEDSSLVARRIGTLQTVTCASPTYVARHGMPQTIESLRDHHAVHYFMSRTGRNCAWDFKVDGKHQEVDMKGTVAVNEAGAYLDCGLKGFGLIQVARYMALPHLQSGELIEILPQWKPSSTPISVLYPQSRQLSPKVRAFTDWVAELFAGCPLLSGRDETDPAAASCGVYQRQLGMPSAMTMGAPAAQPRAEPVLAQTPPRRRSPREEAAEYAL
>NZ_CP025030.1|WP_100854220.1|2075598_2076714_+|AI-2E-family-transporter
MQPVLPAYLIARWLLLLVLLAGVYFLSGFLVPALAAMIIGLASWPLYRRLVVRCGGRTAIAATLALLMVIVVLIVPMSFALSYAIKEASTFFAWAIAANRHGVAVPNWISSLPVFGERLGQYWESYIGQPHALGELVEAVSGEHLGNIYRMVLAATGNVFQLLLTVLFMLITLFFVYKDGVRMVAQLDVLGERILPARWQRFSRVVPATINSTVTGMGLIALGEGLVLGIAYWVAGVPSPVLLGVVTGFMALIPGGAPLSFTLVSLYLVGSGHLVAGIALMVWGSVELFIVDKTLRPRLVGGPVKLPFLPTFFGLVGGVKTMGIVGLFVGPVLMALLVAVWREWVHHEVQELDAGRSQRPLPPQVEKTPSA
>NZ_CP025030.1|WP_100854221.1|2076831_2077614_+|phytanoyl-CoA-dioxygenase
MSGFLHDDQIAVLRKQGFVVARQFADPSQVAALRALAQRHLAEHVAPIEYEADLQYPGAPPSRGAEGGLTVRRLLNAYARDPLFAQWATDPRIGQWLARYFDEPPVLSTVHHNCVMTKHPAYGSLTGWHQDIRYWSFTDTDLVSCWLALGPETRNNGGLSFIPGSHAAAFAPDQFDEKKFFREDAPQNADWIARAVCPELQAGDVVFFHCRTLHAAQGNRSDQVKLSVVHTYHPASCHPVAGTRSASQPGVPLVAPAESD
>NZ_CP025030.1|WP_100854222.1|2077734_2078562_+|helix-turn-helix-domain-containing-protein
MRKKNIDDTQEPQAPTATRSSLFVGSTEKAFQVLHAFDGSKRHMTLADIARESGLDRSATQRLVYTLETLGYLRRIPDTRNYGLTPKVLQFSYNYVRANELIDKASPYLLDISRTLGETTNLQELDGHEIVFVARFPGHHLVNVDIAVGSRLPAFFTASGTAILSRLSDEHRREILAQTRLEAITPYTEVNPEKLLDRVQRVAEKGYAIIVNETVLGDISVAAPVTDHRGFAVAAINISVPTTRWTVARVEAELAPHVQVAATSISKSKFAGYSR
>NZ_CP025030.1|WP_100857483.1|2078643_2079915_-|IS256-family-transposase
MPMKKRRTAAAQAAARGPLPEVPAELLDHLVKGPMTPSEVQDLFLSFQKAVIERTMAAEMNLHLGYRPGEDKPEGQANERNGASGKTVLTEHGPVRVELPRDRDGSFAPILIPKHERRFTGFDDRIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMTETIAWQNRPLEAMYPVVFFDALRVKIRDDGGVSNKAVYLALGVQADGQRDVLGLWVEQTEGAKFWLKVFNDLKTRGCQDILIAVVDGLKGLADAIGAAFPRTTVQTCIVHLIRNSLDYAGWKDRKAVAAALRPIYAAASEQAAEQALQTFADGPWGIKYPTIVQAWQRAWENVTPFFVFPPDIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRATFDWKAAMNQFAILFGERFTAVRG
>NZ_CP025030.1|WP_100854223.1|2080501_2081407_-|4-hydroxy-tetrahydrodipicolinate-synthase
MLNATHLRGVFPAIPTPVNADDTINVKAAQALVAYLLKQGIDGIVPLGGTGEYGALARAERIRMCKLTVEAVAGRVPVIPGVLDPGFHDALQAGNEFADAGADALMVLTPYYTTPTQAGIRDYFLRYADASPLPVMIYEIPYRTRIAIAPEVLHELSRHENIIGMKACNTDMYHFLRTVAGVDESFAVFSGEDTLLPVHLAAGAKGGIVVTASLLPSAWKQVYALAMEGRTSESMALHRRLIPLMNLAFAETNPGPMKSVMDLIGVNAPEVLDPLVAPAEGLQAKLREKLVPLLEEFEGVK
>NZ_CP025030.1|WP_100854224.1|2081443_2083219_-|ABC-transporter-permease-subunit
MTTLATPRKRMSPGRRHFLMAAPLVVLLLVLLIYPVGQLLLLSFVGDQGFTLTQYHRLFESSVYINVLLITLKISLWTTFFSVVAGYPVAYLISSLTAKRKTSLLFWVLLSFWTSFLVRTFAWVVLLGRNGVVNQLLQALGILDAPANLLYNFGSVLVGMVHALMPLAVLTMLSVMENIDRNLPRAASTLGARPGTAFWKIYFPLSMPGVAAAAIMVFVTAIGFFITPALLGGRKETMITQIIIDQVQQTMNWEFAGAVSVLLLVVVLVVFAIYDKVLGLSTMTGGASTRVRGSGKESVSRRAGDAVLTVLANVSDALFALLPKRMRRSVSGTGQSRTLWWMVLGVLAFLSAPAFLMIPLSFDSGSGLTWPPKGFSLQWYEQMFTSPVWMQAITRSLIVGVGTGLLAMLIGTPAAFLLVRANMRGKSAMLAFVLSPIVVPRMIIAVGMFYFFARVGLVGSMIGLILAHTVVAVPYVVITMMAVLRNYDTRLDLAAQSLGAGPWSTLRFVTFPILGAGLMSSFLFAFATSFDELTIALFALGGLNATLPKQFWDEVTLQISPVIAAVSTCLFIFIAALIWLADRLRRRSLAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_7

2671492-2671569

Orphan

Consensus_repeat	Method
GCCGATCGTGGCTTGGCGGCCGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_7

>merge|NZ_CP025030|7|2671492-2671569|CRISPRCasFinder
GCCGATCGTGGCTTGGCGGCCGAAGTCCAGTTGGCCCCAGGCGTCGTTGGCCAGGCCGATGGTGGCTTGGCGGCCGAA

>NZ_CP025030|7|7|2671492-2671569|CRISPRCasFinder
GCCGATCGTGGCTTGGCGGCCGAA	GTCCAGTTGGCCCCAGGCGTCGTTGGCCAG
GCCGATGGTGGCTTGGCGGCCGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100857621.1\|2679457_2680501_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP025030.1\|WP_100854665.1\|2672120_2672774_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|223979
NZ_CP025030.1\|WP_167400980.1\|2676330_2676747_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|225667
NZ_CP025030.1\|WP_100854657.1\|2658776_2659427_-\|response-regulator	unknown	unknown	gnl\|CDD\|182771
NZ_CP025030.1\|WP_100854655.1\|2657048_2658017_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP025030.1\|WP_100854658.1\|2659482_2662848_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|182772
NZ_CP025030.1\|WP_100854667.1\|2675545_2676331_-\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|225883
NZ_CP025030.1\|WP_100854662.1\|2668578_2669865_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|319249
NZ_CP025030.1\|WP_100854663.1\|2670017_2670689_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP025030.1\|WP_100854659.1\|2662863_2664081_-\|EAL-domain-containing-response-regulator	unknown	unknown	gnl\|CDD\|238923
NZ_CP025030.1\|WP_100854672.1\|2682101_2683145_-\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212525
NZ_CP025030.1\|WP_100857619.1\|2668073_2668280_-\|gas-vesicle-protein	unknown	unknown	unknown
NZ_CP025030.1\|WP_100854661.1\|2667267_2668077_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025030.1\|WP_100854666.1\|2672870_2673713_+\|ribose-phosphate-pyrophosphokinase	unknown	unknown	gnl\|CDD\|223538
NZ_CP025030.1\|WP_100854656.1\|2658049_2658745_-\|pentapeptide-repeat-containing-protein	unknown	unknown	gnl\|CDD\|224276
NZ_CP025030.1\|WP_100854669.1\|2676743_2677385_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP025030.1\|WP_100854670.1\|2677377_2679381_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP025030.1\|WP_100854660.1\|2664083_2666909_-\|response-regulator	unknown	unknown	gnl\|CDD\|182772
NZ_CP025030.1\|WP_100854671.1\|2680721_2682056_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP025030.1\|WP_100857620.1\|2673765_2675460_+\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236407

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100857621.1\|2679457_2680501_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	6.33824e-129
NZ_CP025030.1\|WP_100854665.1\|2672120_2672774_+\|NUDIX-hydrolase	gnl\|CDD\|223979	COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism].	1.36733e-23
NZ_CP025030.1\|WP_167400980.1\|2676330_2676747_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|225667	COG3125, CyoD, Heme/copper-type cytochrome/quinol oxidase, subunit 4 [Energy production and conversion].	3.79726e-39
NZ_CP025030.1\|WP_100854657.1\|2658776_2659427_-\|response-regulator	gnl\|CDD\|182771	PRK10840, PRK10840, transcriptional regulator RcsB; Provisional.	7.86018e-53
NZ_CP025030.1\|WP_100854655.1\|2657048_2658017_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.71783e-13
NZ_CP025030.1\|WP_100854658.1\|2659482_2662848_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|182772	PRK10841, PRK10841, two-component system sensor histidine kinase RcsC.	1.10134e-125
NZ_CP025030.1\|WP_100854667.1\|2675545_2676331_-\|SURF1-family-protein	gnl\|CDD\|225883	COG3346, COG3346, Uncharacterized conserved protein [Function unknown].	6.54591e-79
NZ_CP025030.1\|WP_100854662.1\|2668578_2669865_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|319249	cd16390, ParB_N_Srx_like, uncharacterized family distantly related to the N-terminal domain of the ParB/Srx superfamily. Uncharacterized proteins distantly related to the N-terminal domain of the ParB superfamily, primarily involved in bacterial and plasmid parABS-related partitioning systems. A small minority of proteins in this family include a C-terminal inorganic pyrophosphatase domain. Also within the ParB superfamily is sulfiredoxin (Srx), which is a reactivator of oxidatively inactivated 2-cys peroxiredoxins. Other families includes a putative regulator in the biosynthetic gene cluster and a family containing a Pyrococcus furiosus nuclease and putative transcriptional regulators SbnI (Staphylococcus aureus siderophore biosynthetic gene cluster ) and EdeB (Brevibacillus brevis antimicrobial peptide edeine biosynthetic cluster). Nuclease activity has also been reported in Arabidopsis Srx.	1.19378e-59
NZ_CP025030.1\|WP_100854663.1\|2670017_2670689_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	1.69397e-21
NZ_CP025030.1\|WP_100854659.1\|2662863_2664081_-\|EAL-domain-containing-response-regulator	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.69281e-68
NZ_CP025030.1\|WP_100854672.1\|2682101_2683145_-\|histone-deacetylase-family-protein	gnl\|CDD\|212525	cd10001, HDAC_classII_APAH, Histone deacetylase class IIa. This subfamily includes bacterial acetylpolyamine amidohydrolase (APAH) as well as other Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Mycoplana ramosa APAH exhibits broad substrate specificity and catalyzes the deacetylation of polyamines such as putrescine, spermidine, and spermine by cleavage of a non-peptide amide bond.	2.19095e-153
NZ_CP025030.1\|WP_100854666.1\|2672870_2673713_+\|ribose-phosphate-pyrophosphokinase	gnl\|CDD\|223538	COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism].	2.46699e-28
NZ_CP025030.1\|WP_100854656.1\|2658049_2658745_-\|pentapeptide-repeat-containing-protein	gnl\|CDD\|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	2.78626e-21
NZ_CP025030.1\|WP_100854669.1\|2676743_2677385_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	2.6136e-103
NZ_CP025030.1\|WP_100854670.1\|2677377_2679381_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP025030.1\|WP_100854660.1\|2664083_2666909_-\|response-regulator	gnl\|CDD\|182772	PRK10841, PRK10841, two-component system sensor histidine kinase RcsC.	6.30246e-114
NZ_CP025030.1\|WP_100854671.1\|2680721_2682056_+\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.9831e-89
NZ_CP025030.1\|WP_100857620.1\|2673765_2675460_+\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236407	PRK09198, PRK09198, putative nicotinate phosphoribosyltransferase; Provisional.	0

>NZ_CP025030.1|WP_100854663.1|2670017_2670689_+|ankyrin-repeat-domain-containing-protein
MATLRHWRVVFVLMLGALGSQAGAAVNPAAQLREAAAQGDTARVRELLAQGVPLDGRDGEGNTALLRATQGNQVETARVLIEAGADVNAQNRLQDSAYLLAGAQGHREILDLTLRHGADLRSTNRYGGTALIPACERGHVDVVRTLLQAGVDPNHVNRLGWTGLLEAIILSDGGTRHQAIVALLIAAGADVNLADREGRTPLQHARLRGQAEIVQLLERAQAR
>NZ_CP025030.1|WP_100854662.1|2668578_2669865_-|chromosome-partitioning-protein-ParB
MTSQPARFLPLHPVARLLAALFLPLALAACNGGGGDDNEAAAPPVEQPAEAPTRNTAYLNTKAGDVIQVRIEELRPTQAAIGYDQIYYKLGRWQGDFNRSWAGDDARKLDYLDRTVGKKFDDYCEDMGGTERAAAFADLAAAQAARLDDPSTFTCLDAPGTHTENLKTVVVGWDGNLYLTDGHHTFSSLREIFDGGPKLPVWVKVDANYSDLTTAAAFWQRMVDERRAWLRDGQNQPITVDQLPTRLGLASADEAGGMQEDRYRSLVYFTRDIAYENGSLPEFAEFLWGDWLRRQAAGGQLPTLDQYRMVAPATPAQILAASTLNASLVPGGANDSYAAAVRDASLKMGALADTDIVFDDRQAASLGRIPLAANVAAGVSIKDQRDALEELPRIDVKADGSPRNAGKLWFAVHYRACGKPAAGTCWGW
>NZ_CP025030.1|WP_100857619.1|2668073_2668280_-|gas-vesicle-protein
MRRSLAELGDVFRVPQPADPLPNYIHLADALFFMADGTPVSGQPTLWRGRTSSVDGFILGRLQSEASS
>NZ_CP025030.1|WP_100854661.1|2667267_2668077_+|hypothetical-protein
MKDDARSWALSEESITLRFQPVFTAQGQVHEYAVIGRCRPSPWSGLNPVGQGAGLLAGVAFFKHFKTPIELSYEHALDVRGTGDLAERLCGELGIGLLDSSVWVNKHARYDDAPPLLIPAKRITFTLPLTDRLSDHAEVLARYPEFQARLRARLLPSASRSKSTGHGTLRADGLHVQVPLGLSENRALQGRFFTLMERAWSANLHVVAGGVEDIRDFAWMRLHSDLLFRGGALSAPLSSECLGIWLQADSNAWRSFNASTTRFAGVEDV
>NZ_CP025030.1|WP_100854660.1|2664083_2666909_-|response-regulator
MLVEDHGAPALEPQAAPRAASLLLHFLAVALLVCIAAGATLYLYWAFSNVVSNYRRHMNAAAYEAQHFFDQRESLLRSISASAVRNTNQDPISKTPTHFGKTGQVEVLPLQEGPDAYDWALVLTPRDLRRIAQANTRIVYSALRHANTMPVGSHDQPASPGIPPSIQQWLALTLADVQTRAPTKGLPPIVWLHPPHDTVKRLFLFTPLDAVHPEAAWIGLEVHGVESAISAPRSGAGDYVLFDEMSRPVLRSAGAGTTNQALPHTTREDAFGLQGKGWLPDYLVLSKSVGEDGWRLVYYTPMAHVLRDNALAFQTAAIASLLLIITVILRVRYIRRRLVLPALRQYEALADSVSLNRKLIEVAPVGLCLLRRSDRAVVLSNDMARRWFQGTPGWRTDILSSHGDEAGREHRLNDGRTAYLSFAPTTYRGEAVVLCGISDISALKRIEQSLLQAKRDAEAANQAKTVFLTTMSHEIRTPLYGILGTLELFSLTRVSGQQAQYLETIQQSSATLLRTINDTLDLSRIEAGHTVLERAPFSPVELLNNVVASFAARAHAKGVRSYAVADPDTPPAVIGDATRIRQILDNLANNAIKFTDSGQIVLRLKVNSRNRDSVDLCFQIADTGSGIAPEHQARLFEPYYQVDADTCVTLPGTGLGLSICRSLSDMMNGRLNAVSEPGLGTSITFEVRLPLAPEALDTAAPELDDTVVYVQGAVPEIVHNLCDWLRRWGAVGLPYPANGVTPSEPAVLLQAWPHAQKIANWIGPQVIVHPPGLRPRVEDSHRNWFASAYNLAGIHHAVRLAQGGAARSTSFDPKAAPEVLGLKILVTEDNPISQLILREQLEHMGCTVVLAGNGQEALNLPDLMHFDAVLTDLNMPLVDGYELTRILRKRGHDRPVLGVTANAFPDEQRRGMSAGMTSLLVKPLPLTILRQTLQTVKELRS
>NZ_CP025030.1|WP_100854659.1|2662863_2664081_-|EAL-domain-containing-response-regulator
MLSVYKVLVLDDHAFQCAQMRSLFLEAGFEHVDMANSAHEALEMVRQHSYQLVLMDLNMPGMDGVQFIHELARLQCNPMLAITTACSRRIMNSVSLMAKEKGLSVIAAYTKPVTREQALALARRLCNEKLDGTLPQTLPLLSTPLFDRHTLEKALATGQIQAWFQPKKALATGHIVGAEALARWHHLEFGFMLPASFLGAVRHHGLDHALLIRMLDDALAAYLDWRRLGFRMPVSVNLPTRLLDQPDLPDQLYNLVAQRGVPFEDVTFELLEDDTTSVPGHYYMGASRLRLKGFGLAQDDFGKGYNSMYTLISTPFTELKIDRAFVSGAATDGVRAAALLSSVQLGRQLGLQVTAEGVENTKDLEFLREIGCDFAQGFLISAAVNAHDFTDLLADEPRPYATHPL
>NZ_CP025030.1|WP_100854658.1|2659482_2662848_-|hybrid-sensor-histidine-kinase/response-regulator
MQETPFSRIARTSRRLNIALFGILPVALIMIGALLWGAQRIIKQEEDRLLMDFAVLVGYIREQEGFLLQFRKENQRLDGRAPIEHIKLSTPLDSTRPGLRIYRGQHALVAMPFSLFCNYPSECPVANSPVSAAAGYFADFYSTYWANSYFPAAAAFLVNRTDSLGIAVPAINVKPGYGEPLSEDTLLLVNDAVRTRLAPATADDASTMPSSGTPGVAAADGQILWVSPPGLPDRMMGLLHAGFSDAAWTNRGGGAPDVYVATLLSRARINIYDRALPSIQYDGFWLTHRDIGLMLGDGPLPATGESGLSATRDGLILKVSDPTSIWTAYYRVSYRNFFEDNLWLPITAALLLLLGLAGGIGYQRWYTRRVIEPAQNAHRDIAESEEFNRTLIQTAPIALCVLARANGDVLFANSLALEWLGAATGQGLRDSPAARPLLDQVLTASAPGTIETFHADDGRPLYVAYSPTRYKKQDVVLCAFADISARAEIERALAQAKRDADKASEAKSTFLATMSHEIRTPLYGVLGTLELMGMTELNAEQRQHLERIQNSSVILLQLISDILDITKIESGQLALESSQFRPRELVESCARSFAALARQKGLLLFACVDGSVAPWVTGDAVRIRQILSNLLSNAIKFTESGHVIVRLHGSDRADGTQVLALQVVDTGIGIDKEDQTQLFSPFYQIDSASHTVRGAGIGLSICARLAKLMDSHIRVTSELGLGSSFSLELALQPADGPPVDEPDLHGIRIYVRSPHRELTDNVCQWLTRWGADAQRAPEPLGRGEPDDVLLDILGPTDVAPANWTGHFLSAGDPREAAVGAPERIDGHDLDSIGFGISRLLRGDPPVPAPAPNALMDPLDLRVLVAEDNPINQATLRHQLEQLGCTVTVAGNGADALSMWNMATYDVLLTDVNMPKMNGYELTGELRSRGYAQPIIGVTANAMRDEEARCMAAGMNSWLVKPIELSALRHHLGGITRVRAKMPDVPAASDIPEVLDVQDLPEVPNVPDEPYVSDESPYKDAPPVPVDATPEPLVPEKYRRLFLDTMDTDLANLDQAVTRRDVLVALQTMHRMRGALVMVKMTTLSSDFQAVEAKLRRDGGDDEVFQDVVRLTHELRNLLAQV
>NZ_CP025030.1|WP_100854657.1|2658776_2659427_-|response-regulator
MERLRIVLADDHPLVLAGMRDLLEKDLSVEVTALLASPTALVEHLTHDLPHVVITDYSMPGDETYGDGIRLVKFLTRRFPKTQVVVLTMVSNPMIISALYDAGVAAVVLKRDNLAEIVTALHTLQAGRKYYPPGFQRDGTVDSRSKFIGERINSLSPKEFEVLRHFIRGESMMQVAETLKRSVKTVSGQKISAMRKLNVQTDQELVAFCVESEIFQ
>NZ_CP025030.1|WP_100854656.1|2658049_2658745_-|pentapeptide-repeat-containing-protein
MTQDVFEAITGQEVDRQAMLALIENAAGQALSFHDCDFQHADFSRLDLRGARFTACAIAGASFQGATLADTTWLRCRGGQANFASADASDATFQNCDLNNAKWHRARLAGARLQGCKLTGSDFDGIACLGWTVEECLLVGALLRGVSFRKTNIMQLDFSDADLAGSDFRDAVFHGGSLRNANLKNVRFEGADLREVDLSGLDLTAAARLAGATISKTQAATLLAELRISVL
>NZ_CP025030.1|WP_100854655.1|2657048_2658017_+|MarR-family-transcriptional-regulator
MDLIDFPSQSREQTIRDLREFSRKLVRELGFMRTSLAGSELAPSAVHAIIEVGLQPGIQARDLAVILRLDKSNTSRQLAKLESAGLVAREVDPEDARSSRLTLTEAGLALRDRIDQFATDQVSHALRRMTPDDQQSLIRFMSLYADALSRENPNLAPSTAAISEQIIEGYVPGCIGDVAGLHARYYAQASGFGVYFERKVATELAAFAEALPDHGKGMWLYAENGRTLASIVIDGDPAIGQAHLRWFIVDESLRGLGVGRHLLARALAFADAHYRETYLWTFKGLDAARHLYEDAGFVLTDESEGRQWGSVVVEQRFLRRRP
>NZ_CP025030.1|WP_100854665.1|2672120_2672774_+|NUDIX-hydrolase
MDYPLPLVTVDAVLLTLRAGVLEIALHQRDRAPFKNAMALPGGVVHVDEDGDTDASIRRVLREKTGFEPRYLEQLQVFSGKDRDPRQWSLSVSYVALVPAAELEAATQADFRFISVDALPPLAFDHADIVAAAVARLRGKSSYSTLPFFLLPERFTLTELQHTYEAILQTRLEKSNFRRKMEAWGVLEATGDQVGGAQRPARLYRLKDFTLFDRSVG
>NZ_CP025030.1|WP_100854666.1|2672870_2673713_+|ribose-phosphate-pyrophosphokinase
MFTITAVVEGQRHTGTPAAFVFPGGESQVTVPANLRAQADAASAFRIHALLKSADDVMQLLMLTDALRRLNPAVPVHLDMPYVPYARQDRVCNPGEALGAAVFCKLINDQQYATVTVVEPHSDVTPALLQRLRVVDAAAFLKNALAAPAFAHGVTLMAPDAGARKRVQALAKTLGVADVRYAEKVRDTQTGRITETRVPEDIPDQPVLVVDDICDGGRTFLELAAALGEKTRQPLYLYVTHGIFSKGLAELNARYAGIFTAYDWTDAEGANAPALVNIEN
>NZ_CP025030.1|WP_100857620.1|2673765_2675460_+|nicotinate-phosphoribosyltransferase
MNAPEPLTVKNGINPFLQADFYKTGHPFQYPKGTNKILANFTPRSARLAPVLPELFDDKIVWFGLQGFIKEILIDLFNREFFGKPAGAAVRQYQRRVDNALGKGAVTVDHLQALYELGYLPLEIRSVPEGARIDIRVPPVTFINTHPDFAWLVTYIETLFSCESWKPSTVATIAFEYRKLLTYFARLTGSPMDFVNWQGHDFSMRGMSGLYDARKSGAGHLLSFTGTDTIPAIDYLEDIYGADSDRELVGGSVPATEHSVMCLGSKEGEIETIRRLVTQVYPAGIVSVVSDTWDFWQVVTDFAAALKPEILSRRPDAFGNAKVVFRPDSGDPVKILTGYFCTDVPSVDDGAALAAARRDGAEAVRDAGTGEYWLLDDKAHATQTLREAEVKGAVQCLWDLFGGVETERGYKLLDPHVGLIYGDSITLARGRDILVRLERKGFASGNVVLGIGSYTYQYLTRDSFGWALKATYAEVNGVPEELVKDPVTDSGVKRSAKGLLRVEETATGYVLHDQQTPEQAAGGALVPVFRDGQLLVEQNLAQIRERLQGSWVCPEPGSIAWPLR
>NZ_CP025030.1|WP_100854667.1|2675545_2676331_-|SURF1-family-protein
MAAVKDSTRSDSPRKPRSKTTLVILGVVAAVLFAGLCALGTWQVHRLAWKKELISQVQQRAHAPTSPAPGKPDWRGLTAGNAEYRHVTATGTYQYDRQTLVQAATELGSGYWVMTPLQLADGGGTVLVNRGFVLPQWRKNQAVSPPQPAAEARVTGLLRMGEPGSGFLRNNDPAANLWYSRDLPGIAAARGLTDVAPYFIDADAASSPSRDPAQAPVGGLTVLTFPNNHLVYAITWYALALMIIVGVVIFVREEKRGRGKG
>NZ_CP025030.1|WP_167400980.1|2676330_2676747_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MSSHMDNLADRGHHGHGHDHHDDHDDDGASHGTMKSYVTGFILAAILTAIPFWLVMDRVFENSRTTALIILAFAMVQIVVHLVYFLHMDTKSESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMSIHDMRKMP
>NZ_CP025030.1|WP_100854669.1|2676743_2677385_-|cytochrome-o-ubiquinol-oxidase-subunit-III
MSDTLAPTLQGGAAPPSEPVFYVPGEHHPKNGTLLGFWVYLMSDCLIFACLFAVYGVLGRSYAAGPSGADLFDLPLVAVNTSLLLLSSITYGFAMLEMRRNRIGATQLWLGITGILGLGFLALEIYEFAHLIHLGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTMMIQVRMHGLIPENRRRLMCLSLFWHFLDLIWVGVFTFVYLMGVLP
>NZ_CP025030.1|WP_100854670.1|2677377_2679381_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MPDQPDLTKLIFGRLTWDAIPLHDPILLATFFMVAIGGIVVLGSITYYKKWGYLWHEWFTSIDHKKIGIMYVILGIVMLLRGFADAIMMRMQQAVAFGDSTGYLPPHHYDQIFTAHGVIMIFFVAMPLVTGLMNYIVPLQIGARDVAFPFLNNFSFWMTTGGVILVMMSLFVGEFARTGWLAYPPLSGILHSPDVGVDYYIWALQIAGVGTLLSGVNLLVTIVKMRAPGMKMMRMPIFTWTALCTNVLIVAAFPVLTAVLALLSMDRYVGTNFFTADFGGNAMMYVNLIWIWGHPEVYILILPAFGIFSEVVATFCRKRLFGYASMVYATVVITVLSYLVWLHHFFTMGSGASVNSFFGITTMIISIPTGAKIFNWLFTMYRGRIQFEVPMLWTMGFMVTFVIGGMTGVLLAVPPADFVLHNSLFLVAHFHNVIIGGVLFGLMAGITYWFPKAFGYKLDPFWGKCSFWFWLVGFYVAFMPLYVLGLMGVTRRVSHFEDMSLQIWFQVAAFGALLIACGIASFIIQLVVSYRRRDQLRDDTGDPWDGRTLEWSTSSPPPNYNFAFTPRVHDLDAWWQMKQHGYERPQQGFIPIHMPKNTWAGIVLAAISVVMGFALIWHMWPLAVLSFVALILVSIIHTFNYKRDYYVPTAEVVREEDARTRLLAKHV
>NZ_CP025030.1|WP_100857621.1|2679457_2680501_-|ubiquinol-oxidase-subunit-II
MSSLPRLRGLILIAALPLLAGCNAVLLSPSGDIAVQQRNLIIISTGLMLLIIVPVIFLTFLFAWRYRASNKDAHYDPEWNHSTMLELLIWAAPLLIIIALGALTWVSTHQLDPYRPLARLSEGREVPAGTKPLVVEVVALDWKWLFLYPEQGVAAVNEMAAPVDRPIQFKITSSSVMNSFFVPALAGQIYAMPGMQTTLHAVINHPGEYEGLSANFSGPGFSAMRFKFHGVDQQGFDKWVADARASSTTLSRDVYLKLEQPSERNPVQRYASVAPGLFDAIVNRCVEGNRMCMKDAMAIDSQGGMGIPGALNITTLDPATRERLGLTGTPPRMYVGSMCTSTEGLVL
>NZ_CP025030.1|WP_100854671.1|2680721_2682056_+|MFS-transporter
MSTSTRYPGHAPSVPGPGATSGGASHAKVAPGEIAVGVVVGRASEYFDFFVFGIACVLVFPKVFFPFEAPLEGTLWAFVIFSFAFIMRPIGTALSMAIQRRWGRATKLTVALFVLGTATVGMAFLPSYETIGAHAITLLAVFRCLQGLAFGGSWDGLPSLLALNAPPHRRGWYSMMGQLGAPVGFLVASALFLYLHVTLTEADFIEWGWRYPFFVAFAINVVALFARLRLVVTEEYTQLLEEGELEPISIAEMVRSQGYNLFIGAFAALASYALFHLVTVFPLSWIAISATQQITDVLIVQIFGAILGILGTVASGWLADRIGRRTTLGMLAVAIAIFALFTPWLLGGGPVAQDAFILVGFVLLGLSYGQASGTVTANFTRRFRYTGAALTSDMAWLIGAAFAPVVALGLSARFGLVAVSIYLLSGAACTLLALRINKVLETRD
>NZ_CP025030.1|WP_100854672.1|2682101_2683145_-|histone-deacetylase-family-protein
MLIFHNPVHDKHAGRQEMFRGKLVPCHETPARLEYVLDALRQRGIGELRAPSAPDMNLIKRVHTPRYVNFLASAWQDWVALDPANADLDILPSVWPVRGFRHDIEPTNFAARVGLFSFDSGCPLTAGTWEAATAGAACAVDAARAVMAPGGPRAAMALTRPPGHHAGADFFGGYCFLNNAALAAQALRDAGAARVAILDVDYHHGNGTQSIFYERGDVLTVSVHGDPTTEYPFFLGYADEEGEGAGFGANLNLPLAAGTDFATWTQALQQGISAIQAFKADAVVVALGVDTYEGDPISKFKLKSADYLEVGRMLAGLGLPTVFTMEGGYAVADVGINVANVLEGAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_8

2803041-2803141

Orphan

Consensus_repeat	Method
TTTCGCGCTTCACCCATCCTACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_8

>merge|NZ_CP025030|8|2803041-2803141|CRISPRCasFinder
TTTCGCGCTTCACCCATCCTACGGGGCGGCGGTTTGATGGGTTACGCGCGATGGGGGGTGGGGATTTTGCGGCGGGGTTTTCGCGCTTCACCCATCCTACG

>NZ_CP025030|8|8|2803041-2803141|CRISPRCasFinder
TTTCGCGCTTCACCCATCCTACG	GGGCGGCGGTTTGATGGGTTACGCGCGATGGGGGGTGGGGATTTTGCGGCGGGGT
TTTCGCGCTTCACCCATCCTACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100854769.1\|2810320_2810851_-\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP025030.1\|WP_100854762.1\|2802234_2802963_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP025030.1\|WP_100854755.1\|2790762_2791461_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP025030.1\|WP_100854759.1\|2795066_2796320_-\|urea-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|372603
NZ_CP025030.1\|WP_100854768.1\|2809216_2810185_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP025030.1\|WP_100854757.1\|2792299_2793427_-\|urea-ABC-transporter-permease-subunit-UrtC	unknown	unknown	gnl\|CDD\|132449
NZ_CP025030.1\|WP_100857634.1\|2807998_2809114_+\|4-oxalomesaconate-tautomerase	unknown	unknown	gnl\|CDD\|380230
NZ_CP025030.1\|WP_100854761.1\|2798593_2802238_+\|urea-carboxylase	unknown	unknown	gnl\|CDD\|274264
NZ_CP025030.1\|WP_100854763.1\|2804691_2805507_-\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP025030.1\|WP_100854766.1\|2806514_2806991_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP025030.1\|WP_100854770.1\|2811349_2812732_-\|DUF1501-domain-containing-protein	unknown	unknown	gnl\|CDD\|226587
NZ_CP025030.1\|WP_100854753.1\|2787781_2789977_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP025030.1\|WP_100854758.1\|2793423_2795055_-\|urea-ABC-transporter-permease-subunit-UrtB	unknown	unknown	gnl\|CDD\|200272
NZ_CP025030.1\|WP_100854760.1\|2796701_2798567_+\|allophanate-hydrolase	unknown	unknown	gnl\|CDD\|236177
NZ_CP025030.1\|WP_100857483.1\|2803358_2804630_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP025030.1\|WP_100854765.1\|2806047_2806416_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226765
NZ_CP025030.1\|WP_100854754.1\|2790217_2790655_-\|DUF2946-domain-containing-protein	unknown	unknown	gnl\|CDD\|371400
NZ_CP025030.1\|WP_100854767.1\|2806995_2807937_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176131
NZ_CP025030.1\|WP_100854756.1\|2791463_2792303_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	unknown	unknown	gnl\|CDD\|274568
NZ_CP025030.1\|WP_100854764.1\|2805508_2806021_-\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100854769.1\|2810320_2810851_-\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.08953e-19
NZ_CP025030.1\|WP_100854762.1\|2802234_2802963_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	9.40967e-36
NZ_CP025030.1\|WP_100854755.1\|2790762_2791461_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	5.43871e-141
NZ_CP025030.1\|WP_100854759.1\|2795066_2796320_-\|urea-ABC-transporter-substrate-binding-protein	gnl\|CDD\|372603	pfam13433, Peripla_BP_5, Periplasmic binding protein domain. This domain is found in a variety of bacterial periplasmic binding proteins.	0
NZ_CP025030.1\|WP_100854768.1\|2809216_2810185_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.26927e-122
NZ_CP025030.1\|WP_100854757.1\|2792299_2793427_-\|urea-ABC-transporter-permease-subunit-UrtC	gnl\|CDD\|132449	TIGR03408, urea_trans_UrtC, urea ABC transporter, permease protein UrtC. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	4.16929e-157
NZ_CP025030.1\|WP_100857634.1\|2807998_2809114_+\|4-oxalomesaconate-tautomerase	gnl\|CDD\|380230	NF033377, OMA_tautomer, 4-oxalomesaconate tautomerase.	0
NZ_CP025030.1\|WP_100854761.1\|2798593_2802238_+\|urea-carboxylase	gnl\|CDD\|274264	TIGR02712, Includes:_Allophanate_hydrolase, urea carboxylase. Members of this family are ATP-dependent urea carboxylase, including characterized members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae. The allophanate hydrolase domain of the yeast enzyme is not included in this model and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from Oleomonas sagaranensis was shown to be highly active on acetamide and formamide as well as urea. [Central intermediary metabolism, Nitrogen metabolism].	0
NZ_CP025030.1\|WP_100854763.1\|2804691_2805507_-\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	2.48926e-42
NZ_CP025030.1\|WP_100854766.1\|2806514_2806991_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.66604e-12
NZ_CP025030.1\|WP_100854770.1\|2811349_2812732_-\|DUF1501-domain-containing-protein	gnl\|CDD\|226587	COG4102, COG4102, Uncharacterized protein conserved in bacteria [Function unknown].	5.0371e-46
NZ_CP025030.1\|WP_100854753.1\|2787781_2789977_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	1.17355e-65
NZ_CP025030.1\|WP_100854758.1\|2793423_2795055_-\|urea-ABC-transporter-permease-subunit-UrtB	gnl\|CDD\|200272	TIGR03409, urea_trans_UrtB, urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	4.58739e-156
NZ_CP025030.1\|WP_100854760.1\|2796701_2798567_+\|allophanate-hydrolase	gnl\|CDD\|236177	PRK08186, PRK08186, allophanate hydrolase; Provisional.	0
NZ_CP025030.1\|WP_100857483.1\|2803358_2804630_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.66662e-136
NZ_CP025030.1\|WP_100854765.1\|2806047_2806416_-\|hypothetical-protein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	9.16748e-43
NZ_CP025030.1\|WP_100854754.1\|2790217_2790655_-\|DUF2946-domain-containing-protein	gnl\|CDD\|371400	pfam11162, DUF2946, Protein of unknown function (DUF2946). This family of proteins has no known function.	0.000735368
NZ_CP025030.1\|WP_100854767.1\|2806995_2807937_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176131	cd08440, PBP2_LTTR_like_4, TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.89239e-74
NZ_CP025030.1\|WP_100854756.1\|2791463_2792303_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	gnl\|CDD\|274568	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	8.02588e-160
NZ_CP025030.1\|WP_100854764.1\|2805508_2806021_-\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	5.52093e-42

>NZ_CP025030.1|WP_100854762.1|2802234_2802963_+|GntR-family-transcriptional-regulator
MMRLESVQVSPAIRQAPALAGSLADQAYQRIKDDLFDFRMLPGERFTEADLVARLGVSRTPVRLGLARLEREGFVLASPRSGWQVRPFDFERFEALYDVRVVLEQAAVDKLCTREQMDESGILGALKDVWLVPPPQRILDGRLVAQLDEAFHCSLVAAAGNPEMAQIHRDVTEKIRIVRRLDFTKDFRVDATYDEHAAILRAVLARRGDEAARMLKSHIEMSKAEVRKITLHMLHEAREGGR
>NZ_CP025030.1|WP_100854761.1|2798593_2802238_+|urea-carboxylase
MFDTVLIANRGEIAVRAIRTLKRLGIRSVAVYSDPDRNAAHVREADVAVALGGEKAVDSYLRMDLLLAAAREHGAQAIYPGYGFLSESAEFAEACEAAGIAFVGPTPLQIREFGLKHRSRELAAEAGVPMTPGTGLLASLGEALLHAERIGYPVMLKSTAGGGGIGLSRCENEAELTVAFDSVQRMGEHFFRDGGAFIERYVDNARHVEVQIFGDGAGRVLALGERDCSVQRRNQKVIEETPAPLLPAATRAALLAAAVQLGESVNYRSAGTVEFIYDPARDSFYFLEVNTRLQVEHPVTEAVTGLDLVECMLRVAAGEALDIAAMSRAPQGASIEVRLYAEDPLRQFQPSPGVLTEVSFPEGVRVDGWVATGTDVPAFYDPMLAKLIVHADTRDAALDKLADALARTRLHGIATNLDYLRQIVADARFRAGKLSTRFLESFTYRPAAIEVLEAGTYTSVQDYPGRTGYWDIGVPPSGPMDDYAFRLANRIVGNAPDAAGIEATLIGPTLRFHGDAIVALTGAECAATLDGEPVPMWQPIAVRSGQVLATGRALSGCRSYLAVRNGLDVPVYLGSRSTFALGQFGGHAGRTLRVGDMLPLVRPELGEAGAAVPVAEPMPAPAELIPTYGNTWEIGVLYGPHGAPDFFQPEAIDTFFAADWEVHYNSNRLGVRLIGPKPTWARENGGEAGLHPSNIHDCEYAIGSINFTGDSPVILTRDGPSLGGFVCPVTIARAELWKVGQVKPGDRIRFVRMDYPQAVALEAAQDQSVAALSAVAPTATAPSPVPATVSETIVAALPAEGSRPSVSYRQAGDGYLLLEYGDNVLDLALRMRIHLLMEALNADPIAGVQELSPGVRSLQIRYDSRQILQGALIERLLKIEAGLADVATLKVPTRVVYLPMAFEDSATLGAVQRYQETVRANAPWLPNNVDFIQRINGLASRNDVRDIVFDASYLIMGLGDVYLGAPCAVPIDPRHRLLTSKYNPARTFTAEGTVGIGGVYMCIYGMDSPGGYQLVGRTLPIWNKFLKNPVFQDGKPWLLRFFDQVRFYPVTEAELDVLREDFREGRATVRIEEEVFDFAAHQRFLAEQADSIAVFQTRQKSAFDAEVALWKSEDVAVEQEAPAQEAEADTALREGERLVSADMCGNIWKIPVQVGQSVSAGDTLVVVEAMKMELSVIAPASGTVTAIRCVPGKPVNAGDPLVVLAEDATCTVAG
>NZ_CP025030.1|WP_100854760.1|2796701_2798567_+|allophanate-hydrolase
MNAAATQTSPIGWTIAQWQAAYREGGAQPETLLADYAAPQDGPVDNAWIQRVDRVTLDEQLDGLRLMLAAAGGDLARLPLYGVPFAIKDNIDAAGWPTTAACPEFAYTPGEDATVVQRLRAAGAILIGKTNLDQFATGLVGTRSPHGAVANTFNADYVSGGSSSGSASVVARGIAAFSLGTDTAGSGRVPAGFNNIVGLKPTKGWLSTAGVVPACRTLDCVSIFALTVADAELVAEVAGGFDERDPYSRKMPAGASLPWPRAPKLAIPATLEFFGDAQAATVFDDAVRALKATGAEVETIDFAPFNELAALLYQGPWVAERFAAVEDLWKQTPDVINPVVRGIVEQAANYSALDAFKAEYRRADLTRRIHQALAGFDALVVPTSPSIYTIAQLQADPVTLNSRLGVYTNFANLADLSALAVPAGMRADGLPSGITLIGLAWQDRALAQFGRLWQAQRGLPLGATGAPLPAGMDVATPPADTVRVAVVGAHLTGMPLNHQLTSRNAVLVEKTRTAGDYRLYALANTTPPKPGLVKSESGAPIEVELWDVPVTAFGAFVAEIPAPLGIGTLELEDGRLVKGFICEPRGLDGARDITTFGGWRAYLASLSATPSAAAGANATPR
>NZ_CP025030.1|WP_100854759.1|2795066_2796320_-|urea-ABC-transporter-substrate-binding-protein
MKRRLALKQLTAVSLLAMSGWMPQVFAAEDTIKVGILHSLSGTMAISETSLKDVALMTIDEINANGGVMGKKLEAVVVDPASNWPLFAEKSRQLLSQDKVAVVFGCWTSVSRKSVLPVFKELNGLLFYPVQYEGEELEKNVFYTGAAPNQQAIPAVEYLMSEDGGGAKRFVLLGTDYVYPRTTNKILRAFLHSKGVKDSDIDEVYTPFGHSDYQTIVANIKKFATGGKTAVISTINGDSNVPFYKELGNAGLKATDVPVVAFSVGEEELRGVDTKPLVGHLAAWNYFQSVKNPVNEDFIKKWKAYAKAKNLPNANTVVTNDPMEATYVGIHMWKQAVEQAKTTDVDKVIAAMGGQKFSAPDGYTIEMDKSNHHLHKPVYIGEIKADGQFNVVWKSKGPIRAQPWSPYIPGNESKQGL
>NZ_CP025030.1|WP_100854758.1|2793423_2795055_-|urea-ABC-transporter-permease-subunit-UrtB
MHIAAIAHFLRRFILAWLLAMPLLTAPAAAAGVDPALLAPLTGDDTDAKLQAIAALGQYPDPGAAAVLQALGNDQLYATADGRVLIGIDSTRATDPTTGAAVDLPAGSGTVSINNRLRRAIQAALAGSRLFSDQPNERLDAARRLQQTGDPARLPMLEKALATEKNEAVREALLIAQANLELKSTDPAKRLHAVEVLGETRNAAFRPVLASLTQQRDGVYTEPDATVRDAAAAALKQIDRHLATIEWAGNLFYGISLGSVLLLAALGLAITFGLMGVINMAHGELLMIGAYVTYVVQTLFRAWFPGWLDWYVVAALPLAFVVTALVGMALERTVIRWLYGRPLETLLATWGISLMLMQGVRTLFGAQNVEVGNPSWMSGGINVLGGLVLTYNRIVIIGFAFFVVFLVWVLLNHTRLGLFVRAITQNRRMADCVGVPTGRVDMLAFGLGSGIAGLAGVALSQLGNVGPDLGRGYIVDSFMVVVLGGVGQLAGTVIAAMGLGGVNKFLEPYAGAVMAKITILVLIVLFVQKRPQGLFAPRGRSVE
>NZ_CP025030.1|WP_100854757.1|2792299_2793427_-|urea-ABC-transporter-permease-subunit-UrtC
MKQTALTDLTLLTRRPLFSGRAWTALAVAAALLALLPLLNLVFPPGHALHVSAYAVALLGKFMCYAMAALALDLVWGYAGILSLGHGLFFALGGYAHGMYLMRAIGRDGVYQSNLPDFMVFLDWKSYPWYWSFTEHFWYAMLLVVLVPGVLAFVFGYFAFRSRIKGVYFSIITQALTFAAMLLFFRNDTGFGGNNGFTDFKRILGFDITAPGTRATLYWITLAALAGALILARIVTQSKLGRVLTAVRDAESRLRFIGYDPLGFKLFVWTLSAVLCGIAGALYVPQVGIINPSEMSTETSIEMVIWVATGGRGTLIGPIIGAGAVNGLKTWFTSVLPEFWLYALGLIFVLVTLFLPTGIVGLARRITARLQEKKA
>NZ_CP025030.1|WP_100854756.1|2791463_2792303_-|urea-ABC-transporter-ATP-binding-protein-UrtD
MTSTHTELATLDGGPSGDAGYGRVSPKGLDTSHGAILYLEGITVSFDGFKALNDLTLDIGVGELRCIIGPNGAGKTTMMDVITGKTRPTAGTAFFGQSIDLTTLNEAQIAHAGIGRKFQRPTVFEQHSVFENLELAMKTDKRVRPTLFSRLTSEQADKIGETLDLIRLRPEVQRPAGLLSHGQKQWLEIGMLLMQEPQLLLLDEPVAGMTDAETERTGELLNELRGRHSLMVVEHDMDFVNQIAGDGKVTVLHEGSVLAEGPMSKVQADPRVIEVYLGR
>NZ_CP025030.1|WP_100854755.1|2790762_2791461_-|urea-ABC-transporter-ATP-binding-subunit-UrtE
MLDVSTINQYYGGSHTLRGVSLSVRQGECLALLGRNGVGKTTLLKCVMGVLPVASGNIAFDGADITRLAPHQRAARGMAYVPQGRDIFARLTVEENILMGMATKPAARARRIKEEVFELFPVLKSMLSRRGGDLSGGQQQQLAIARALVAEPKLIILDEPTEGIQPSIIKDIARVIHMLRERGDIAILLCEQYFDFARELADQFVVLSRGEVVASGDRSTIDGEDVRRHLSV
>NZ_CP025030.1|WP_100854754.1|2790217_2790655_-|DUF2946-domain-containing-protein
MCFATFLTRPNLWIALAAILWASLAPSLAHALSLSPDGHHIHRISVEYCASEGDASGTLTLEVPHNESHNDLHDSPHGSKADDAHGDHHCPLCRNPQADVSILPAPVPVVPAPVGRAITYPPLFFLAENSLHAWSAVQPRAPPAN
>NZ_CP025030.1|WP_100854753.1|2787781_2789977_-|TonB-dependent-receptor
MKHTTLYTLLLGAIAGSPALAAEPAVKTLAPTTVYGAGYAAPAPNGVIDLDAHDNTGSRLGLTLRETPASVTVISREQIEARGSLNTQEIARGIPGVDNASPPGNAGAVSYRGFSGGQVSQLFNGISVQYDAIAGRPIDSWIYDRVEAIGGPATFLFGAGAVGGAINYVTKLPERDTFYDAQFRLGSFDSRQYSIGLNQQLAGDAGGQGHYLRIDANTGSSHGWVDGNHSRATQVAASLLSDLGADVTQTFAFEFQREQVDRPYWGTPLKTNANGVVQGAGHIMDGTRFKNYNVNDGLYEQSVLWARSVTEWRAGSNLTLKNTLYHYRADRDFRNLESYRFNADNSLVLRSGALLQRHEQRLVGNRVEGLYRSSIAGLRSDWSFGADISQNKVTRFPTSLSGTVDAVDPYDFSAGDFYDIPGMTRGHKPDRENRIRTFALTLENRTQVLPGVAIVSALRKDFIDLDLTNRRAVTATSPASAQRSYSPLTGRLGVNWEISPEASLYAQYATAADPPSGLMATASFADVLNNDKLTTGTQAEVGGKFNFWDGRGAATVSVYEIKRKNLATSDPNNPGVSVPVGAQSARGVELAGGLQLTSKLSLQGNVAFVDPKYDDFTQSVGGVSVSRNGKVPTNTPRRLANVWVDYAFVPDWNASVAARYVGRAYADAANTVWAPSYMVFDAALSHRINRNVDATFRVRNLTDKVYAANSSPTMYYLGAPRSVELTLQMRF
>NZ_CP025030.1|WP_100857483.1|2803358_2804630_+|IS256-family-transposase
MPMKKRRTAAAQAAARGPLPEVPAELLDHLVKGPMTPSEVQDLFLSFQKAVIERTMAAEMNLHLGYRPGEDKPEGQANERNGASGKTVLTEHGPVRVELPRDRDGSFAPILIPKHERRFTGFDDRIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMTETIAWQNRPLEAMYPVVFFDALRVKIRDDGGVSNKAVYLALGVQADGQRDVLGLWVEQTEGAKFWLKVFNDLKTRGCQDILIAVVDGLKGLADAIGAAFPRTTVQTCIVHLIRNSLDYAGWKDRKAVAAALRPIYAAASEQAAEQALQTFADGPWGIKYPTIVQAWQRAWENVTPFFVFPPDIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRATFDWKAAMNQFAILFGERFTAVRG
>NZ_CP025030.1|WP_100854763.1|2804691_2805507_-|anti-sigma-factor
MNEKSLHPVPSSGSPITEADLHAYADGQLAPARHAEVDAFLASHPQDQTRVADWQAQRRALHALLDPVLDEPLPLRLPLKAPTRQLPWRALAAGVAIAAVSAGAAWTVRGAMDARHLQTVLATAGPDRAAGGYAQRAAIAHAVYAPDMGRPVEVSADNEKGLVTWLTKRMGAPVRAPSLSQAGYELVGGRLLPGGSGPVAQFMYGGADGQRLTLYVTREAAGGQTAFQFTQEGSVRVFYWVEGQFGYALSGAVSRDELQRVSQEVYRQLQG
>NZ_CP025030.1|WP_100854764.1|2805508_2806021_-|RNA-polymerase-sigma-factor
MRADDEALILACIPSLRRYARGLTGDPHRADDLVQDTLERAWSRYSRWQKRGELRAWMFGIMHNHFIDGVRANNRRADQTAPGDLPDLPVRATQTDQLEVRDLDRCLQALPPEQREVLLLICVEDLSYQDTARVLDVPIGTVMSRLSRAREKLAALMRGHDSVSRLHRVK
>NZ_CP025030.1|WP_100854765.1|2806047_2806416_-|hypothetical-protein
MRTHIAAALVLGSAALFSVGAHAQAVKTQDGILVNSAGMTLYTFDKDAAGKSACNDGCAKVWPPVAAPADAKPMGDMTVITRDDGSKQWAHKGKPVYLYVKDTKPGDKTGDNFKEVWHVIKP
>NZ_CP025030.1|WP_100854766.1|2806514_2806991_-|GNAT-family-N-acetyltransferase
MMSNATPDHSLALQPATEEDVPFLLALRKATMQEHMERAGAPATDAHHLARIQYHFDDAQIVWVDGRPAGLFKHYRDTDGWRIVQIQIAPDFQGMGLGRRLIEPVLDRADAEGAPVTLSVLKGNPAQRLYAALGFIPVKETDLEFEMRYEPGAVRPVG
>NZ_CP025030.1|WP_100854767.1|2806995_2807937_-|LysR-family-transcriptional-regulator
MARINFDLQELQAFVAVAERASFRAAAEDLHLSQPALSRRIDKLESILGARLLERTTRRVALTQVGRVFLERARSAIDELESAVLSIGDLAAQRGGLVTVACVPSVAYYFLPSVIRDYTERFPRIRVRIIDETANTVLNSVVTGRADFGISFFGTQEPDVDFKAVLREDFVLAVRRDHPLAGRRSVSWEALSQERFMTVAKESGNRLLIDDALAKSGKRTVSAFEVSHVMTLLGLVEAGLGVAAVPQLAMPLAGHATLTSVKLEHPRVTRTLGLIARRGRPLAPAAQQLYNLIHQAGKTAKRKTPSAEPISKP
>NZ_CP025030.1|WP_100857634.1|2807998_2809114_+|4-oxalomesaconate-tautomerase
METEIPCVLMRGGTSRGPFFLGDWLPADPVQRDRLLLTAMGSPHALQVDGIGGGNTLTSKVAIVSRSTRPDCDIDYLFAQVSVDRAMVDTRPNCGNMLSGAAPFAIDEGLVVPRDGVTSVRVHNVNTGAVIEAVVQTPGGHLTYEGDARIDGVPGTAAPVRLNFLEAWGAVTGKLFPTGQRQEYIDGVAVTLIDAAMPMVLMRAQDFGLRGDETSAQLDGNAGLLERMERIRLEAGLRMGLGDVSQSVIPKPVLVAPCDSAGALALHSRYFTPRACHRAHAATGAVGVASAFLMPGTVAHACGGPPVVAGYRTVRIEHPSGGMDIDVDLDTASGEVRAAGLVRTARKIMKGLLYVPGHYVLAGAEPMRAVA
>NZ_CP025030.1|WP_100854768.1|2809216_2810185_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKHHPIKALCAAAMLLAASAVAQADYPERAITLVVPTAAGGGNDVLARVVGQKVGELLGQTVIVVNKPGAQGAIASDYVARQPADGYTLMLGYIGTHGINPAMQKLNYDPVKDFTPIGMVADSPTIMVVSKRIPVKDVAGLVKYGHEHPDGLNFASAGPGTAPAIAGELFNQATGIAMLDVPYKGSAPALNDTLAGVTQVMFPSLFSVYPHLKSGAIQAVAVAGSSRIAALPDLPTLAEAGVSGVDVPQWYAIFAPAKVELAVVDKLNKALNQALSDPVVATKIAEQGAEVRRSTPAELGAFVQSEAVRWKQLADKRKLAAR
>NZ_CP025030.1|WP_100854769.1|2810320_2810851_-|transposase
MTAYRRLYIPGGTYFFTVTAQDREHQDLIVHAAWLKACIRAEQQIASFAVLAAVLLPDHLHMIWRLPASDADYSGRWRRIKTRCSRALRPCTVRRSVYRKGERGIWQRRFWEHVIRDERELSACIHYIHMNPIKHGHVTTPDAWEHTTFHAWQRRQIAWRSACRHTHNLRPTPSAS
>NZ_CP025030.1|WP_100854770.1|2811349_2812732_-|DUF1501-domain-containing-protein
MKRSHDADRRAFLLRACALGATGAAAPLALNLAALGAAAAQSAPASYKALVCVFQYGGNDPYNTVVPYDTDAYRAYAAARGDIGLKRDALQATVLRGKAPAAGGGQFALAPALAPLAPLYESGQLAVLLNVGPLVTPTSKAEYISARVPLPPKLFSHNDQQAYWQALAPEGASSGWAGRLTDLFAGANAQRTFTGITAGGSTVLLAGRKVAGYRVGINGSTSIDLLGRDMYGSSACTALLRQLITQPREHLMEREMARIAAQSISADTQLRAALADVAVPGDFSSPLAQQLKIVARIIGARQALGARRQVFFVSQNGYDNHTGLNDTHPALLRELGQAMAAFQQALSSMGVADQVTTFTASEFGRTLGSNGNGSDHGWGSHHFVMGGAVKGGRYYGTHPEIALDGPGFVDNGRLLPTLAVDQLGAALGGWFGAGKEELGMVFPNLRNFDAGGVGVMGGSV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_9

2981817-2981918

Orphan

Consensus_repeat	Method
CACCCATCCTACGGGCTTGCGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025030_9

>merge|NZ_CP025030|9|2981817-2981918|CRISPRCasFinder
CACCCATCCTACGGGCTTGCGGTGGATGATGGGTTTGCGCGGTGGCGGCTGCGTGTTTGGTGGATGCATCGCGCGCTGCACCCATCCTACGGGCTTGCGGTG

>NZ_CP025030|9|9|2981817-2981918|CRISPRCasFinder
CACCCATCCTACGGGCTTGCGGTG	GATGATGGGTTTGCGCGGTGGCGGCTGCGTGTTTGGTGGATGCATCGCGCGCTG
CACCCATCCTACGGGCTTGCGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100854901.1\|2973294_2974914_-\|benzoate-CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|341269
NZ_CP025030.1\|WP_100854902.1\|2974989_2975466_-\|DUF4863-family-protein	unknown	unknown	gnl\|CDD\|379780
NZ_CP025030.1\|WP_050449754.1\|2975644_2976553_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236167
NZ_CP025030.1\|WP_100854899.1\|2971145_2972027_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP025030.1\|WP_100854911.1\|2988492_2988990_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|198057
NZ_CP025030.1\|WP_100854900.1\|2972052_2973213_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380667
NZ_CP025030.1\|WP_100854898.1\|2970072_2971143_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP025030.1\|WP_167400994.1\|2991794_2992691_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP025030.1\|WP_100854909.1\|2987255_2987744_+\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
NZ_CP025030.1\|WP_100854912.1\|2989273_2990779_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173880
NZ_CP025030.1\|WP_100854908.1\|2986226_2987210_+\|site-specific-tyrosine-recombinase-XerD	unknown	unknown	gnl\|CDD\|234713
NZ_CP025030.1\|WP_100854904.1\|2979974_2981225_+\|benzoyl-CoA-2,3-epoxidase-subunit-BoxA	unknown	unknown	gnl\|CDD\|132268
NZ_CP025030.1\|WP_100854913.1\|2990778_2991795_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP025030.1\|WP_100854910.1\|2987766_2988477_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP025030.1\|WP_100854907.1\|2985246_2986161_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP025030.1\|WP_100854905.1\|2982101_2983295_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP025030.1\|WP_006221119.1\|2981305_2981749_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239538
NZ_CP025030.1\|WP_100854906.1\|2983427_2985110_-\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285
NZ_CP025030.1\|WP_100854903.1\|2978493_2979921_+\|benzoyl-CoA-2,3-epoxidase-subunit-BoxB	unknown	unknown	gnl\|CDD\|200253
NZ_CP025030.1\|WP_100857648.1\|2976736_2978407_+\|benzoyl-CoA-dihydrodiol-lyase	unknown	unknown	gnl\|CDD\|181274

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100854901.1\|2973294_2974914_-\|benzoate-CoA-ligase-family-protein	gnl\|CDD\|341269	cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase). Benzoate CoA ligase and 4-hydroxybenzoate-coenzyme A ligase catalyze the first activating step for benzoate and 4-hydroxybenzoate catabolic pathways, respectively. Although these two enzymes share very high sequence homology, they have their own substrate preference. The reaction proceeds via a two-step process; the first ATP-dependent step forms the substrate-AMP intermediate, while the second step forms the acyl-CoA ester, releasing the AMP. Aromatic compounds represent the second most abundant class of organic carbon compounds after carbohydrates. Some bacteria can use benzoic acid or benzenoid compounds as the sole source of carbon and energy through degradation. Benzoate CoA ligase and 4-hydroxybenzoate-Coenzyme A ligase are key enzymes of this process.	0
NZ_CP025030.1\|WP_100854902.1\|2974989_2975466_-\|DUF4863-family-protein	gnl\|CDD\|379780	pfam16155, DUF4863, Domain of unknown function (DUF4863). This family consists of uncharacterized proteins around 150 residues in length and is mainly found in various delta- proteobacteria, but also several fungal species. Distant homology analysis suggest proteins from this family have a cupin-like fold and may be related to a group of lyases involved in the metabolism of benzoate. Few proteins from this family are annotated as p-hydroxylaminobenzoate lyases, NbaB, and this proposed function matches well their phylogenetic distribution, but there seems to be no direct experimental verification of this function, therefore at this point we call it a DUF.	7.83669e-79
NZ_CP025030.1\|WP_050449754.1\|2975644_2976553_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|236167	PRK08154, PRK08154, anaerobic benzoate catabolism transcriptional regulator; Reviewed.	1.14641e-162
NZ_CP025030.1\|WP_100854899.1\|2971145_2972027_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.38688e-63
NZ_CP025030.1\|WP_100854911.1\|2988492_2988990_-\|hypothetical-protein	gnl\|CDD\|198057	smart00989, V4R, The V4R (vinyl 4 reductase) domain is a predicted small molecular binding domain, that may bind to hydrocarbons.	1.11642e-11
NZ_CP025030.1\|WP_100854900.1\|2972052_2973213_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380667	cd20014, PBP1_RPA0668_benzoate-like, type 1 periplasmic binding-protein component of an ABC system (RPA0668), involved in in the active transport of lignin-derived benzoate derivative compounds, and its close homologs. This group includes RPA0668 from Rhodopseudomonas palustris and its close homologs in other bacteria. Rpa0668 is the periplasmic binding-protein component of an ABC system that is involved in the active transport of lignin-derived benzoate derivative compounds. Members of this group has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP).	7.88844e-156
NZ_CP025030.1\|WP_100854898.1\|2970072_2971143_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.81147e-68
NZ_CP025030.1\|WP_167400994.1\|2991794_2992691_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.97351e-84
NZ_CP025030.1\|WP_100854909.1\|2987255_2987744_+\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	3.3475e-63
NZ_CP025030.1\|WP_100854912.1\|2989273_2990779_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173880	cd08515, PBP2_NikA_DppA_OppA_like_10, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.21624e-127
NZ_CP025030.1\|WP_100854908.1\|2986226_2987210_+\|site-specific-tyrosine-recombinase-XerD	gnl\|CDD\|234713	PRK00283, xerD, tyrosine recombinase.	5.47134e-158
NZ_CP025030.1\|WP_100854904.1\|2979974_2981225_+\|benzoyl-CoA-2,3-epoxidase-subunit-BoxA	gnl\|CDD\|132268	TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein. Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB. [Energy metabolism, Other].	0
NZ_CP025030.1\|WP_100854913.1\|2990778_2991795_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.75914e-102
NZ_CP025030.1\|WP_100854910.1\|2987766_2988477_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.8065e-26
NZ_CP025030.1\|WP_100854907.1\|2985246_2986161_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	2.5892e-67
NZ_CP025030.1\|WP_100854905.1\|2982101_2983295_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	0
NZ_CP025030.1\|WP_006221119.1\|2981305_2981749_+\|MaoC-family-dehydratase	gnl\|CDD\|239538	cd03454, YdeM, YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function. YdeM has sequence similarity to the hot-dog fold of (R)-specific enoyl-CoA hydratase. Other enzymes with this fold include the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	8.36279e-70
NZ_CP025030.1\|WP_100854906.1\|2983427_2985110_-\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0
NZ_CP025030.1\|WP_100854903.1\|2978493_2979921_+\|benzoyl-CoA-2,3-epoxidase-subunit-BoxB	gnl\|CDD\|200253	TIGR03225, benzo_boxB, benzoyl-CoA oxygenase, B subunit. Members of this protein family are BoxB, the B subunit of benzoyl-CoA oxygenase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. [Energy metabolism, Other].	0
NZ_CP025030.1\|WP_100857648.1\|2976736_2978407_+\|benzoyl-CoA-dihydrodiol-lyase	gnl\|CDD\|181274	PRK08184, PRK08184, benzoyl-CoA-dihydrodiol lyase; Provisional.	0

>NZ_CP025030.1|WP_006221119.1|2981305_2981749_+|MaoC-family-dehydratase
MKFAEFKDGMLIKAGPVTITEAEILEFARKFDPQWFHTDPQRAAEGRWGGLIASGWHTCALAMRMAVDAALHDSESFGSPGLGEVRWRTPVRPGDTLRLEARVQGARTSSSRPDLGIITWSWTVINQHDEGVLEMDATSLFDLSGEN
>NZ_CP025030.1|WP_100854904.1|2979974_2981225_+|benzoyl-CoA-2,3-epoxidase-subunit-BoxA
MNAPLPAQVLKQHLIDPEICIRCNTCEETCPVDAITHDSNNYVVDPDICNGCMACVPPCPTGSIDNWRLMVRSEAYSVQEQLGWEELPKEKALPVADEAVAAAAPSDDVSEALAQPSGQASFTLPGASVPPWSAAHPYVNLYTHKAPMTATVVGNYRVTGADTESDIHHIVLDFGELPFPVLEGQSIGILPPGVDAQGRPHHARQYSLASPRDGERAGYNNLSLTVKRVTEDHGGVAAHGVCSNYLCDLAKNDTVQVIGPFGHTFLMPNHPRANLIMICTGTGSAPMRAMTERYRRRIDTGENGKLMLFFGARTERELPYFGPLMKLPRDFIDINLALSREPGQPKRYVQDLIRDRAGQVRDLLADRNTCIYVCGLKGMEVGVLDALRDVTMQAGQDWSILHDVLRREGRLHFETY
>NZ_CP025030.1|WP_100854903.1|2978493_2979921_+|benzoyl-CoA-2,3-epoxidase-subunit-BoxB
MSGINYTDKIPNNVNLSGDRTLQRALEHWQPNYLQWWQDMGPDGSHGFDVYLRTAVSVEPDGWANFDHVRMPDYRWGIFLAPQDGQRKIHFGENIGRDVWQDVPGEHRANLRRIIVTQGDTEPASIEQQRHLGLTAPSQYDLRNLFQINVEEGRHLWAMVYLLHRYFGRDGREEADALLQRTSGDADNPRILGAFNEKTPDWLAFYMFTYFTDRDGKFQLCALAESSFDPLARTTKFMLTEEAHHMFVGESGISRVIQRTCEVMNQLKTDDPQSVRAAGVIDLPTIQRYLNFHYSVTIDLFGADQSSNAAIFYGSGLKGRYEESKRTDDHQLKNDTYRVLTVNNGKLNEVEVPMLNALNEVLRDDFIRDSVAGIGRWNKVIEKSGIPFRLQVPHKAFNRQIGTLAGIRMSPEGEIVSEAQWQANSHKWLPTPEDRAFVASLMGRVTEPGKFANWIAPPVMGVNRQPVNFDYVRFN
>NZ_CP025030.1|WP_100857648.1|2976736_2978407_+|benzoyl-CoA-dihydrodiol-lyase
MAEARVDFRTQPGQYRHWRLSFDGPVATLAMDVAEDGGLRPGYKLKLNSYDLGVDIELHDALQRIRFEHPEVKSVVVTSMKDRIFCSGANIFMLGLSSHAWKVNFCKFTNETRNGIEDSSRHSGLKFIAALNGACAGGGYELALACDEILLVDDRSSSVALPEVPLLGVLPGTGGLTRVTDKRRVRHDHADIFCTLVEGVRGQRAKDWRLVDDVVKPARFEEAVRERAMALAESSDRQGTEPGIALTPIERTEGADHLSYRYVDIQVDRDKRLATWTVRAPEGEVPSELADIMAAGAAWWPLQMARELDDAILTMRTNELDIGTWIFKTEGDAAAVLAADATLQRHAGHWFVRETAGMLRRTLARLDVTSRSLFALIEPGSCFVGTLLELALAADRSYMLDSEADAGADVDEPAAQIVVGERNFGAYPMVNGQSRLQRRFYEEIEPLEAVRARAGQALSAVDALNLGLVTYAPDSIDWDDEVRMMLEERRALSPDALTGLEANLRFGGKETMETRIFGRLTAWQNWIFNRPNAAGDKGALKLYGKGEQAAFDWKRV
>NZ_CP025030.1|WP_050449754.1|2975644_2976553_+|helix-turn-helix-transcriptional-regulator
MNQALDAAPTEPRREAFLVALGERVRRLRAIRGMTRKSLSQVTGVSERHLANLEHGVGNASILVLLQIARAFNCALAELVGDVTTESPDWLLIRELLSGRTESDLQRAREALTQLFGVGAGAQRPNRTQRVALIGLRGAGKSTLGQMLADDLGYPFVELNREIERVAGCSILEIHNLYGPNAYRRYERRALEEAVQIYPEMVLATPGGLVSEPATLNLLLAHCYTVWLRATPEEHMGRVMAQGDFRPMSGNNEAMADLKRILAGREAFYEKADLTWVTSNLEVQESFAGLRTQVRKACGLPL
>NZ_CP025030.1|WP_100854902.1|2974989_2975466_-|DUF4863-family-protein
MSTPDQFHALMREATRLVANQPLDEGLQAMLNREAGPDSTLYQNIFAACRQGVADGWMCNREGGGIRYGRVIKPAEDLAGCSVDVVDMNDLAGPHHAHPNGEIDLIMPLTADARFDGHGAGWLVYGPGSAHSPTVTQGRALVLYLLPGGAIAFTPPDG
>NZ_CP025030.1|WP_100854901.1|2973294_2974914_-|benzoate-CoA-ligase-family-protein
MNTCPAELNFASHLAALNAARAAKPAYIDDSRQLSYGELAERVARMAGALRQLGLRREERILLLMQDTVDWPVAFLGALHAGVVPVAVNTLLTPDDYAYIITHSRVRAVFVSGALMPALQAALAQSPGDVEHVVVSQPNNAQPKPAQPNNAQPKPAHPAATLPAPAQDFDALLAGAPLAPAVRTLSDEIAFWLYSSGSTGKPKGVVHTHGNLWHTAELYAKPVLGIREDDVVFSAAKLFFAYGLGNGLTFPLSVGATVILMGERPTPQAVFQRLTRHRPTVFYGVPTLYASMLASPDLPPREQVAMRVCTSAGEALPRDIGERFTRHFGCEILDGIGSTEMLHIFISNQSGQIRYGTTGKPVPGYEVQLRDDSGAPVAAGTIGDLYIKGPSAALMYWNNRDKTRQCFLGDWLKSGDKYTCDTDGYYTYAGRSDDMIKVSGQYVSPVEVENVLVQHEAVLEAAVIGVPDHDGLVKTKAYVVLRPGFEPDAQTGAALQSYVKQHLAPFKYPRQINFTEELPKTATGKIQRFRLRQLEEATL
>NZ_CP025030.1|WP_100854900.1|2972052_2973213_-|ABC-transporter-substrate-binding-protein
MNHALTRAAIAAALTFAASGAQAADKIKVGFMLPYSGTFAALGNAIENGFKLYVAEQGGKLGGREIEYFKVDDESNPAKAAENANRLIKRDQVDVLIGTVHSGVAMALAKAAKDSDTTLIVTNAGANAITGPLCGPGIFRTSFTNWQPAYAMGPVAYAKGHKTAVTISWKYAAGDEAIGGFKEGFEKAGGKVVKELSLPFPNVEFQSLLTEIAATKPDMVFTFFAGGGAVKFVQDYHAAGLDKTIPLYGSGFLTDGTLQAQGASAQGLLTTLHYADGLNTPRDNAFRADYAKNYKVQPDVYAVQGYDAAQLMQSGLSAVKGDFAKKADFRQAMRGATVDSPRGPFTLSAAGNPVQDIYLRRVDGLENKVVEVAAKKLADPARGCKL
>NZ_CP025030.1|WP_100854899.1|2971145_2972027_-|branched-chain-amino-acid-ABC-transporter-permease
MDISILLIQSLNAFQYGLLLFLVASGLTLIFGIMGIINLAHGSFYMIGAYMAFALGPLVDRWLGGGFIATLAVCVLLAGALGYVLEAAFFSYLYHRNHLQQVLMTYGLILVFEELRSILVGNDVHGVPLPAWLQGSISLGGVMTYPVYRLFISAVGIAVALLLYWVISRTRLGMMLRAGASNREMTASLGIDVNKLYRLVFAAGVALAALAGTIAAPVSSVYPGMGNGVLIICFVVVVIGGIGSIRGAFLAAMLVGFVETFGQVLFPSAAGVLVYLLMAFILLCKPEGLFKQG
>NZ_CP025030.1|WP_100854898.1|2970072_2971143_-|branched-chain-amino-acid-ABC-transporter-permease
MQRLLPLATLLALAAFAYSGSDYYTGLAIKVMIYAIFALSLQLLVGGAGLVSLGHAAFFGIGAYAAALLSPESQAGNLWWLLPAALLAAAAYALLTGALALRTRGVYFIMVTLAFAQMAYYVFHDTDFGGGSDGIYLYFRPELPVGGWMPFDLSNATTFYFFVLACLALTWGFLSLLRRSPFGAALAGIRINEQRMRAAGYATYPYKLTAYVVGATLASLAGFLFALKDGFVTPELLAWEQSGLVLLMVILGGMASLGGAVIGTVALVLMQELFQSQALFGDYARHWHLPLGIAIIALVALLPNGIAGLPAQWRQRREARAANAHAASGGGTQALAPSSTSVRPAARLPIQGERHV
>NZ_CP025030.1|WP_100854905.1|2982101_2983295_-|acyl-CoA-dehydrogenase
MSSNPSFQWQDPLLLDQQLTEEERMVRDAAYAYSQDKLAPRVLNAFRNEKTDPEIFSEMGELGLLGATIPEEYGGAGMNYVSYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGSEAQKKKYLPKLARGEWIGCFGLTEPNHGSDPGGMETRAVKTSDGYKVSGNKMWITNSPIADVFVVWAKCVGGDFDGKIRGFILDKGMKGLSAPAIHGKVGLRASITGEIVMDEVEVSEDQMMPGVSGLKGPFTCLNSARYGIAWGAVGAAEACWHTARQYTLDRKQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFY
>NZ_CP025030.1|WP_100854906.1|2983427_2985110_-|thiamine-pyrophosphate-binding-protein
MSQQDSRLGGHILVDQLVAQGVKHVFCVPGESYLAVLDGLHDADIKVTVCRQEGGAAMMADAHGKLTGEPGICMVTRGPGASNALAGVHIAKQDSTPLILFVGQIERGMREREAFQEMDYRAVFGTQAKWVTEIDQVERIPELISRAFHIATSGRPGPVVIALPEDMLVEAAKVADAPRYELIESAPTAGQLADLEKLLADAKNPVAILGGTRWDARAVQQFADFAQRHALPTAVSFRRQMLFPADHPCFIGDVGLGINPALLKRVADADLILLVGGRMSENPSQAYTLLDIPVPKQKLVHVHPDTAELGRVYRATLAINTSPAAFAESLGSLKAPAKPVWAEGTQAMRESYLKWSDPETVTTPGALQMGQVMAYLEKTLPADAIMTNGAGNYATWLHRFHRFTRFGTQLAPTSGSMGYGLPAAVGAKRVWPDKTVVCFAGDGCFLMHGQEFATAVQYDLPIVVVLVDNGMYGTIRMHQEKHYPGRVSATELKNPDFADYARAFGGHGERVETTEQFGPAFERALASGKPAILHCFIDPETITPSTTLEKIRDAALKAQH
>NZ_CP025030.1|WP_100854907.1|2985246_2986161_+|LysR-family-transcriptional-regulator
MRNGIPNLTALQAFEASARLGSFSRAAEELSLTHSAVYRQVASLEARLGVQLFTRVRRRIVLTDHGAEYAGRIRHHLDQIEKDTFGLVSRTGMGRSIHIAVVPTLATTWLIPRLADFQRTHADITVSLSVRTLPFQFKDQPFDGALYHGDGLWPGTQGGLLFPERELVPVCAPALAARAAKTAEAGVSVLAGMTHLHLASRPDAWRQWYAANNHLYGPQAAGGPRYELFTMVMAAVQAGLGVGLMPRFLAQPALDQGTLAMPVPQSLTVSQGYYFGYPQRSERSDALKLFETWLKSAAAGVGER
>NZ_CP025030.1|WP_100854908.1|2986226_2987210_+|site-specific-tyrosine-recombinase-XerD
MTTARPALASQADIDAFIDAVWLEDGLSANTLAAYRRDLTGFARWLEDPEAYAREMADRHGDAASAQALPVEPAKPLCDAQKADIEAWFAFRHEETRATTANRRLAALRRFFAWALRERRSERDPCLTLIAAKQPPRLPKTLSEQQVDALLRAPDVTQPRGLRDRAMLETLYATGLRVSELVGVRALDVSLNEGVVRVVLGKGGKDRLVPLGAEAAHWIDLYLKTARPELAAGRQSDALFITGRAEAMSRQAFWQLVKKYALLADIHAPLSPHVLRHAFATHLLNHGADLRVVQMLLGHADISTTQIYTHVARERLKALHAAHHPRG
>NZ_CP025030.1|WP_100854909.1|2987255_2987744_+|Cys-tRNA(Pro)-deacylase
MSKARHVSETPATQLLKQHKVPYTEHTYDYVDHGGAGEAARQLGLDPHAVVKTLVMEDESAKPLIVVMHGDREVSTKNLARQAGLKRVEPCKPEVAQRHSGYQVGGTSPFGTRKKMPVWVEADVLTYPVVYINGGRRGYLIGIDPNALVTVLGAKPVSVALE
>NZ_CP025030.1|WP_100854910.1|2987766_2988477_-|GntR-family-transcriptional-regulator
MKAKTTTRDTARKPNLREQVYGIVRERIQMGLIRLEDRLVDHDIAEELEVSRMPVREALMQLKSEGLLEGTARGFVLRRFTLGEMNEIFEIRTLLEPAAAAAASVHAGPKGLADMKAALERAEDAHARTDIDEFMRSNAHFRSAWLTMVPNRELAEVISRYIDHVQVVRLVTMDDQEIRSIILQGMRGLYEAFLSGDTELVRIRMLGHARAAAACYYSAYQKMLEQSAQEQALNRA
>NZ_CP025030.1|WP_100854911.1|2988492_2988990_-|hypothetical-protein
MGQLQERLVWDADAGAILDADRRYVMLRADVLMGLFAALPPAQRDAALGSLQASVRSHGGASARAYQAQGAPDRVQFLQVMTQAAADLGWGVWRFQTEGTDALALEVDNSPFAMAVTASDRPVCHAITGMLEAVSALVAGKASTFRETRCASMGAPCCAFQAQND
>NZ_CP025030.1|WP_100854912.1|2989273_2990779_+|ABC-transporter-substrate-binding-protein
MVCSGLMASSAWAQADKPAAQGEELKIAYPVDVPSWDPTAVTFPAGQSLYKAVFDSALFIDGNLKLQPALIKSWRWLDDKNMRLGIVLRDDVTFHDGSKLTTDDFKFSFLDRPKQDKRLAINGFFGALQDIQVASPTEATMVFSTPTPTAPNYLGFLTSYILPHAYFEKVGEDGFKAAPIGAGPYKVVRYERGSRVVLEAYDKYWGPKPAIKRVVFEFVPDSSARVAMLESGRADVAVQIPLREVNRLNKNPALKAEVYPYSEIFILQIPSYVPEFQNEHVRRALHLAINKQAISKAFYANVAKPLSVLATPGSPGDVAGFNYAFDKAAAQAELARAGYGPDKPLKIQFLSTNNTFPSDYEMARAIVQMWSQIGVQADLQEITLAKYLELSHSSKVPGVMLYSWANATGDPEIFAGKILDPRLRFSTWKEPELAKTIDALAAQADPDKRIQGYRELARQATEHAWSLPLLQSVATVASKKSVDMQVYQTGYILPATYRWSR
>NZ_CP025030.1|WP_100854913.1|2990778_2991795_+|ABC-transporter-permease
MWAALVSHFVRRLAVAVPTMLALSVVVFVVLRLLPADPLGMMLPPSATSAEVEALRHTMGLDRSLIVQYGIWLGQVLHGDLGRSISSGVPVTQLIATTLPATLELSIVALIMALAISVPGGLLLYVLHDRRGELVADTGLVLLISIPGFLWGIFLMLGFGVHWPILPFSGRFSSDVAMSGPTGFVLLDFLLQGRWAAWGDAASHLVLPALALALGFSPLIVRVLRASLLEASHEQYVAVARLRGQPERRVILRHMLRNAFLPTLTLIGVQFGFLFGGTLLIEMIFSFPGMGNMMVQAVRNHDLPLIQGISLVFCAVILLINASVDCLYAVIDPRLRDL
>NZ_CP025030.1|WP_167400994.1|2991794_2992691_+|ABC-transporter-permease
MTTLNFRAAPVAVRLSGWWLALRASPKAALGGAIVLALLAVALFAPAIAPNDPLAQDLLSPLLPPAWAADGLSQYPLGTDSLGRCVLSRLIFGTRVALWVGLCAAMGAMLVGCTLALVAAYFGGRVDKAIGYLVDLWMSFPPVVLSLILMVGLGTGVGNVILAIVLVDWTRFCRVVRAEALKIRRNDYVTAARLMGFGHMRVMLREMLPGLVPLILTLFSLQIGIAIIVEAILSFVGLSVPADVVAWGVMIADARSTMQEAIWTLIAPVAGIVLTVFGFNLLSDGMRQMLDPRKRGRN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025030_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025030_10

3430687-3430810

Orphan

Consensus_repeat	Method
CCGTAGGATGGGTGAAGCGCGGCAAAATCGACGCAAGAACACCCCCA	CRISPRCasFinder

1 spacers

PD-DExK

The CRISPR arrays of NZ_CP025030_10

>merge|NZ_CP025030|10|3430687-3430810|CRISPRCasFinder
CCGTAGGATGGGTGAAGCGCGGCAAAATCGACGCAAGAACACCCCCACAAATCGCGCGCAACCCATCACACCCGTCGCCGTAGGATGGGTGAAGCGCGGCAAAATCAACGCAAGAACACCCCCA

>NZ_CP025030|10|10|3430687-3430810|CRISPRCasFinder
CCGTAGGATGGGTGAAGCGCGGCAAAATCGACGCAAGAACACCCCCA	CAAATCGCGCGCAACCCATCACACCCGTCG
CCGTAGGATGGGTGAAGCGCGGCAAAATCAACGCAAGAACACCCCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025030.1\|WP_100855233.1\|3431793_3432129_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP025030.1\|WP_100855227.1\|3426083_3426716_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP025030.1\|WP_100855228.1\|3426715_3427012_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025030.1\|WP_100855234.1\|3432232_3433516_-\|Zn-dependent-hydrolase	unknown	unknown	gnl\|CDD\|237248
NZ_CP025030.1\|WP_100857681.1\|3425034_3425856_-\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|376655
NZ_CP025030.1\|WP_100855240.1\|3440569_3441199_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP025030.1\|WP_100855238.1\|3436308_3437931_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341275
NZ_CP025030.1\|WP_100855236.1\|3434564_3435518_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187627
NZ_CP025030.1\|WP_100857682.1\|3440132_3440573_+\|DUF1016-family-protein	PD-DExK	COG4804_PD-DExK_CAS-I:CAS-III	gnl\|CDD\|377634
NZ_CP025030.1\|WP_100855230.1\|3428991_3429720_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP025030.1\|WP_100855223.1\|3419477_3420182_-\|amino-acid-racemase	unknown	unknown	gnl\|CDD\|224707
NZ_CP025030.1\|WP_100855229.1\|3427093_3428596_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP025030.1\|WP_100855225.1\|3420864_3423528_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	unknown	unknown	gnl\|CDD\|236500
NZ_CP025030.1\|WP_100855239.1\|3438074_3439931_+\|phosphoenolpyruvate-carboxykinase-(GTP)	unknown	unknown	gnl\|CDD\|235256
NZ_CP025030.1\|WP_100855232.1\|3430828_3431797_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP025030.1\|WP_100855226.1\|3423672_3425031_+\|glutathione-disulfide-reductase	unknown	unknown	gnl\|CDD\|235701
NZ_CP025030.1\|WP_100855224.1\|3420178_3420637_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP025030.1\|WP_100855235.1\|3433632_3434427_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235664
NZ_CP025030.1\|WP_100855231.1\|3429710_3430595_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP025030.1\|WP_100855237.1\|3435463_3436207_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NZ_CP025030.1\|WP_100855233.1\|3431793_3432129_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	3.29943e-07
NZ_CP025030.1\|WP_100855227.1\|3426083_3426716_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.00893e-45
NZ_CP025030.1\|WP_100855235.1\|3433632_3434427_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	7.30325e-133
NZ_CP025030.1\|WP_100855234.1\|3432232_3433516_-\|Zn-dependent-hydrolase	gnl\|CDD\|237248	PRK12890, PRK12890, allantoate amidohydrolase; Reviewed.	0
NZ_CP025030.1\|WP_100857681.1\|3425034_3425856_-\|DUF72-domain-containing-protein	gnl\|CDD\|376655	pfam01904, DUF72, Protein of unknown function DUF72. The function of this family is unknown.	8.99186e-70
NZ_CP025030.1\|WP_100855240.1\|3440569_3441199_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	5.5604e-20
NZ_CP025030.1\|WP_100855238.1\|3436308_3437931_+\|AMP-binding-protein	gnl\|CDD\|341275	cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. MACS enzymes are localized to mitochondria.	0
NZ_CP025030.1\|WP_100855236.1\|3434564_3435518_+\|SDR-family-oxidoreductase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.0138e-91
NZ_CP025030.1\|WP_100857682.1\|3440132_3440573_+\|DUF1016-family-protein	gnl\|CDD\|377634	pfam06250, DUF1016, Protein of unknown function (DUF1016). Family of uncharacterized proteins found in viruses, archaea and bacteria.	6.80921e-37
NZ_CP025030.1\|WP_100855230.1\|3428991_3429720_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.41754e-27
NZ_CP025030.1\|WP_100855223.1\|3419477_3420182_-\|amino-acid-racemase	gnl\|CDD\|224707	COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane].	5.03492e-50
NZ_CP025030.1\|WP_100855229.1\|3427093_3428596_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	4.77294e-126
NZ_CP025030.1\|WP_100855225.1\|3420864_3423528_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	gnl\|CDD\|236500	PRK09405, aceE, pyruvate dehydrogenase subunit E1; Reviewed.	0
NZ_CP025030.1\|WP_100855239.1\|3438074_3439931_+\|phosphoenolpyruvate-carboxykinase-(GTP)	gnl\|CDD\|235256	PRK04210, PRK04210, phosphoenolpyruvate carboxykinase (GTP).	0
NZ_CP025030.1\|WP_100855232.1\|3430828_3431797_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	3.69141e-15
NZ_CP025030.1\|WP_100855226.1\|3423672_3425031_+\|glutathione-disulfide-reductase	gnl\|CDD\|235701	PRK06116, PRK06116, glutathione reductase; Validated.	0
NZ_CP025030.1\|WP_100855224.1\|3420178_3420637_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	6.04039e-14
NZ_CP025030.1\|WP_100855231.1\|3429710_3430595_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	7.63677e-14
NZ_CP025030.1\|WP_100855237.1\|3435463_3436207_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.48459e-12

>NZ_CP025030.1|WP_100855231.1|3429710_3430595_+|DMT-family-transporter
MRLIPVALALFWGLNWPAVKIILAIFPPFTLRVLGLGSGAILLLLLARAKRLALLPPRDAWPGIVVGGVLAVAVFNLAVAWAQLSTSTSRAAVLTFTMPMMSAVLAWLVLGERLDRRRGLALMLGAIGVAILAWPVLHAVFAEHDLAATKGLIFPLVAAFGWAAGTVYLKRWPVNGHRIVITAWQLAVGAACALTGVLIAGELFPTQGWNGRIVAALSFHIILGTAVAYWLWFVLSERVSATVAALTTLMVPVVGVLGAMALVGDRPGAADWWGFGFVLAGAALIVLNLGRGRG
>NZ_CP025030.1|WP_100855230.1|3428991_3429720_+|GNAT-family-N-acetyltransferase
MPPRVNAFQQPIGPDVPGWTPRPRPPLTPATGRYCRLEPLSAERHAADLYQAFSQAPDDSDWTYMGVGPYADEAAYRAFAEAAQAGNDPLHHAIIDLQTGRAIGTLALMRIDPANGVIEVGFVSFSRQLKRTRIATEAQFLLMHRAFDELGYRRYEWKCDSLNAPSRQAAARLGFQFEGVFRQATIYKGRSRDTAWFSIIDSEWPALRAAYERWLDPANFDEQGKQRQGLSELIAMEKAACA
>NZ_CP025030.1|WP_100855229.1|3427093_3428596_-|PLP-dependent-aminotransferase-family-protein
MPSPNLPADSALLSSPLARGPGALPRQRQLIQRLKQAILAGQLPAGGKLPSSRALSEDLAISRNTVLIAYEQLTAEGYVIADRQGTRVAPLSAPLSSPLSTASLPSANRAAKRALPPATATRLSRIVATRPPSDSSLPMTPGTPALTQFPLNAWRRAQDRALHAAPAATLGYGHPIGEPALREAIAQYLRVSRGVHCDASRIIITEGAQGALALCVQLLTNPGDTAWLEDPGYRGAKSAFHGGDLNVVAMRVDADGIVISEDAWHTQPPRLIQTTPTHQYPTGAVLSVARRLDLLERARRAGAWIIEDDYDSEFRHQGEPIAAMQGLVPDAPVLYVGTFSKTLFPALRLGFLVLPEALAQTALPSVVEMLRGGHRLEQLTLAAFIDNGQFSRHLGRMRRLYRDRQAALREALATHLRVDHEVLGGHSGLHLTVRLPPDIPDQTIVAQARQVGMNPSALSSFAMVPRPEDNGLVIGYGNTSADHFPTMIKRLGDFARQARR
>NZ_CP025030.1|WP_100855228.1|3426715_3427012_+|hypothetical-protein
MPQDDGFFGSLGVMLGEALRAVVAGIKWLLGGLGGALGDFYGGLSKAMGMSPSIFNFVLLVLGLMFLWAAIKALLRRSILGFLFWLVLAVLVLGGLVN
>NZ_CP025030.1|WP_100855227.1|3426083_3426716_+|LysE-family-translocator
MPDLTHLLAFALVSLGMVLTPGPNMIYLVSRSISQGARAGLISLGGVAVGFIFYVCCAAFGITALLLTVPMAYDALRIGGALYLLYMAWQAIRPGGRSPFQVRELPKSSARTLFTMGLVTNLLNPKIAVMYVSLLPQFIQPDHGSVFTQSLALGMTQVVISLSVNAVIAITAGSIAVFLAGRPLWMVIQRWLMGTVLAGLAVRMLMDTRR
>NZ_CP025030.1|WP_100857681.1|3425034_3425856_-|DUF72-domain-containing-protein
MPNRHQSQGAGPTIRVGIGGWTYAPWRGTFFPEGLPHARELEYASQRLTAIEINGTYYSTQKPATFAKWRDETPDGFVFSLKASRYATNRRELAGAKDSILRFVNSGIAELGPKLGPVVWQFAPTKTFNAEDFGAFLALLPDKVDGLPLRHVLDVRHPSFACEEYLELARRHRTATVYTDSEDFPSIADRTADFVYARLMRASTAFKAGYAPKVLDAWAERLRTWARGADPADLPRVGQPPPGAARPQDVYAFFINGAKERAPAAARAMIERL
>NZ_CP025030.1|WP_100855226.1|3423672_3425031_+|glutathione-disulfide-reductase
MAFDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHYSEDFEQAHGFGWSTGKPSFDWPTLIANKNREIERLNGIYRNLLVNSGVTLLEGHARIVDPHTVEINGQRHTAANILVATGGWPRVPDIPGKEHAITSNEAFFLPALPRRVLVVGGGYIAVEFASIFNGMGAQTVQAYRGPLFLRGFDQGVREHLRDELTKKGVDLRFFTDLARIDKQPDGSLAATLKDGSVIETDCVFYATGRRPMLDNLGLENTGVKLREDGFIEVDDEYRTAEPSILAIGDVIGRVPLTPVALAEGMAVARRLFRPEEYRKVDYKLIPTAVFSLPNIGTVGMTTEEAREAGYEVKLFESRFRPMKLTLTESQEKTLMKLIVDAKTDRVLGVHMVGPDAGEIIQGIAVALKAGATKQVFDDTIGIHPTAAEEFVTLRTPVAQ
>NZ_CP025030.1|WP_100855225.1|3420864_3423528_+|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type
MDTPIDSTDADPQETQEWLDAMQAVLAHEGRPRTHYLLDQLIQQDRADNGRYAAPGVTPYVNTISAACQPAFPGDIGIEQRLDAYLRWNAMAMVLRAGKTSGVGGHIATYASATTLYETGYRHFFRAATPDFLGDLLYIQGHSAPGIYARAYLEGRISEAQLDGFRREIGGGGLASYPHPRTMPDFWQFPTVSMGLGPLMAAYQARYMRYLEDRGLIPAQGRKVWGFLGDGEQDQPETLAAVAMAGREKLDNLIFVVNCNLQRLDGPVRGNAKIIQELESVYRGAGWNVIKVVWGAGWDALLAQDHDGRLRRRMMQCVDGEYQVFKARGGAYVREHFFGVDEVLLERVAHLSDEEIGALNRGGHDPAKVHAAYAAAVAHRGQPTVILAKTVKGYGMGAAGEAANTNHQQKKMADPAVRAFRDRFAIAVPDDQLAQIPYIKPTPGSAEHNYFQAAIARAGGHLPKRSAGPGPLATPPLAAFAAHLKGSDGREFSSTMAFVRVLAQLLKDPEIGPRVIPIVPDESRTFGMDGMFRQVGIYSHVGQLYTPQDADQLSVYREDRKGQILQEGINESGAMSSWIAAGTAHSTHGLATIPFYIFYSMFGFQRVGDLAWAAGDIRARGFLLGATSGRTTLEGEGLQHDDGHSHVLASVIPSCRAYDPAYAYEIAVIVQDGLRRMYQDGEDVFYYLTLVNEKTAHPPMPEDAQAGILQGMYCLRQGEPGALRVQLLGSGAILAETLAAADLLRQDFGVSADVWSVTSYSELTRDGQEVERWNRLHPQAQARRGHAETAFAASVGPVVAATDYMKTVPEQIRPFVAGRRYVTLGTDGFGRSDTRQALRSFFGVDRHHIALAALKALADDGRVDPAQAAQAIARYGIDAEAVSAALP
>NZ_CP025030.1|WP_100855224.1|3420178_3420637_-|MarR-family-transcriptional-regulator
MATGKPDGWSLFLTAHALVVEEIEKRLSAAELPPLAWYDALWALERAPEGTARMFEMAERMVIARYNLTRLMDRIEAAGLVERFRSDEDRRATYARLTPKGRALRREMWKVYGPAIDELFLSRLPAAQQAAMAKSFVDIARHVRAMNQDPTP
>NZ_CP025030.1|WP_100855223.1|3419477_3420182_-|amino-acid-racemase
MKAAPLHIGIVACSAEGAALCYRTLCAEGAQRMGPHAHPEISLHTHSLADYVVCLDNNDLPGVGALMLSSAGKLARAGADFLICPDNTIHQALGHVLPDSPLPWLHIAEEVAAEARARGYRRIGILGTRWLVDSSVYPDRLGALGLDYLRPAEADRITLGRIIMDELVYGEFKPESVARLQGIAERLRDAGCDAVVLGCTELPLVLNDGNCALPTLDSTRILARAALSRALAPR
>NZ_CP025030.1|WP_100855232.1|3430828_3431797_-|DMT-family-transporter
MSTRGSRSAPASKPLRLPLDALATTGMLVLCVCWGFQQIAIKLVAADIAPIMQIGLRSTFAALVLAVVVWRAEGLRAVRDGTALPGLIVGLLFAGEFLFVAQGLLHTTASHMSVFLYTAPIFAALGLHWLLPEERMQPLQWLGVAVAFGGIAVAFLVKGDAPQAAAGAPNMLLGDAMGLAAGLLWGATTVAIRATSLSEAAPSKTLLYQMMVAAVGLLAYAAATGQHTIHATQAAILSVAFQSVVVALSSYLAWFWLLRRYLASRLSILSFMTPLFGVSFGVLILDEPLDSGFAVGAVLVLIGITLVSGGEMVREWVRRRRG
>NZ_CP025030.1|WP_100855233.1|3431793_3432129_-|thioredoxin-family-protein
MEQIELNDSTADRYLLDAPGLTLLVFHSRTCGTCRIAREQLPALELPVERVCWVDAGDNRGLVERYEVFHLPAMFVTRDGAFFGPVQSTLAEWDLRQQIGLALDSYPAELP
>NZ_CP025030.1|WP_100855234.1|3432232_3433516_-|Zn-dependent-hydrolase
MPHPTSPSPAFPPLNADRLWARVEALSQFTLPDVPWTRRAFSPLFDDARAWLRGEFEAAGLATRLDAGGNLVGTRAGRDPLRKPIATGSHCDTVMAGGRFDGIIGVLAGIEVAHTLQEHGIELAHPFEVIDFLSEEPSDYGISCVGSRALSGLLTADMLAACNPDGESLAEGIARIGGDPAALHAPLRGPGGTAAFVELHIEQGPVLESRGLPIGVVTNIVGIRRVQIVVEGQPDHAGTTPMDIRRDALVGAARIIDAASRQASAASGNPHYVVATVGRLSMTPNAANAVPGRVEMTLEMRSDSNAVLDTFPETLMAGVASDLKALRLTAGFTPLSRAQPTDCSPLVMDAVKAAADQLGYASMRLPSGAGHDAVYMAPTGPIGMIFIPCLNGRSHCPEEWIEPAQLLDGTRVLYQSVLELDRVLRGA
>NZ_CP025030.1|WP_100855235.1|3433632_3434427_-|enoyl-CoA-hydratase/isomerase-family-protein
MTAPPPLDVARDGAIARLTLNRPDMRNAFDEALIAALTSAVRQAEQDPDVRVLLLTGAGKAFCAGGDLNWMRKMATHTDADNRADATRLADMLHTIWACSKPVVACVNGDAYAGGMGLLSACDIAIAADSAHFCLSETRLGLLPATISPYVIRAMGERAANRYFLTAERFDAATALRLGLLHDVVPADRLGEAVDALCRTLCANGPDAVKASKRLVRDFAGAPINAALIADTVERIAACRSTEEAREGVAAFLEKREPSWRRGS
>NZ_CP025030.1|WP_100855236.1|3434564_3435518_+|SDR-family-oxidoreductase
MDPQANQHAAPQAGNHTATTRYASVFRPGLFDGKTLVVTGGGSGLGRCTAHELASLGANLALVGRKPEKLEAASAEIARIYPEAAGRISLHACDIRDEAGVRGAVADVLARHGAIDGLFNCAGGQFPAPLDRISLNGWNAVVQNNLHGTFLMAREVYTQHMRQHGGAIVNMLADIWGGMPGMGHSGAARAGVWNLTETAACEWAHAGVRVNAVAPGWIASSGMDSYDDDYRAVLRDLKTKVPLQRFGTEAELAAAVVFLLSPASAFINGTVIRVDGGVPNARHSWTLQPAERGEVYNGFPQYVPPSLFSEPADSSAA
>NZ_CP025030.1|WP_100855237.1|3435463_3436207_-|TetR/AcrR-family-transcriptional-regulator
MEKTPVVPTRRPPASAKSEQRIRDILHMARQVFSEAGFQAATTTEIAQRLGVSEATIFTYFGGKRELCVRVISDWYDEIIAKVEDNLPHVQGARAQLHYLVHTHLRHLLAEGPGLCAFILSEGRARNDDFGEIYAGLQRRYTAPLMRILAQGQADGDIRQDMPLRLLRSTVYGPMEHVLWDAILRGARVDVAGTAEQLVGFLWQALQPPRQHALALARFRGEVRDALHRLQAAEESAGSENKDGGTY
>NZ_CP025030.1|WP_100855238.1|3436308_3437931_+|AMP-binding-protein
MLSRAESYKQLVSQFQWQVPEYFNIGVDACDKWADGSGRLALIFEKSDGAQTRYSFDDIKAQSNRLAHSLTRHGVARGDRVAVYLPQAPETAVTHIAVYKMGAVAVPLFTLFGVDAIQFRLANSGAVALVTDTEGCRKLHEIRASLPNLKVVYCIDGDGEDGTVPFHAASAQESDDYTPVNTAADDPAVIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSHEFFPENAALMWTPADWAWIGGLLDVLLPAWHHGVPVLARRFEKFDGTSALELMARHGVTHTFLPPTALKMMRGSAYPEGAGPLALRSVASGGESLGAELIDWGRRVLGVTINEFYGQTECNMLVSSCSSLFDPEIGSIGRAAPGHRVVIVDDLGVEVADGQEGNIGVLRPDPVMFLGYWNNPDATAEKFVGDTLLTGDLGVRDARGFIRFVGRNDDVITSAGYRIGPAPIEDCLIGHPAVRMAAVVGVPDEQRTEIVMAYVVLNDGFDGDDALVKALQAHVRTRLAAHEYPRAIRFVTSLPTTATGKIIRRELRDGSYR
>NZ_CP025030.1|WP_100855239.1|3438074_3439931_+|phosphoenolpyruvate-carboxykinase-(GTP)
MNKPLDGGLAALNVPAYVKHRGLIDWVASFVALAKPDHVVWCDGSQEEYDRLCEQMVQAGTMRRLNPAKRPNSFLACSDPSDVARVEDRTFICSDRPEDAGPTNNWADPAEMRDTLNGLFDGAMRGRTLYVVPFSMGPLGSDIAHIGVELSDSPYVAVNMRIMTRMGKQVYDVLGADGDFVPCVHSVGKPLAAGEADVAWPCNPTKYIVHFPKSREIWSFGSGYGGNALLGKKCFALRIASTMGRDQGWLAEHMLILGVTSPKGRKYHVAAAFPSACGKTNFAMLIPPQGMDGWKVTTIGDDIAWIKPGPDGRLHAINPEAGYFGVAPGTSEQTNFNAMATLKANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQGQDWTPAIARETGRKAAHPNARFTAPAAQCPSIDPEWENPKGVVIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETTAAAVGQQGVVRRDPFAMLPFCGYNMSDYFNHWLKLGKQLEATGATLPRIYCVNWFRKGPDGKFVWPGFGENMRVLRWMLGRIDGESKGVDQVFGVSPSYQDIDWTGLEFTPDKFEQVMSVDAAAWRDELALHHELFGQLSQGLPEDLPATKTKIEGRLAA
>NZ_CP025030.1|WP_100857682.1|3440132_3440573_+|DUF1016-family-protein
MESFLLELDMGFAFIGRQVRTPIDGDDACLDLLFYHRKLRRLVAVDLKVDEFRAAYKSQMERHLHWLDKFEREPDEAAPLGIIVCAGMQSEQIELLELDKSGVQVAQYLTDLPPRAVMAQRLQQAARRARSRIEQRAMRDPGTMTP
>NZ_CP025030.1|WP_100855240.1|3440569_3441199_+|class-I-SAM-dependent-methyltransferase
MKLDPEDLAKITALTLANYEENAVDFEAGTRGHDVSQNIAALLRHIQGVAPFDVLDLGCGPGRDLKTFAALGHRPVGLDGTPSFVEMARAASGCEVWHQDFLQLSLPPARFDGVFANAVLFHVPGQELPRVLRDLWATLRPGGVLFCSNPRGGNQEGWNRGRYGAYHDLDGWRTLMIEAGFDELEHYYRPDGLPREQQPWLASVWRRVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025030_7	7.1\|2671516\|30\|NZ_CP025030\|CRISPRCasFinder	2671516-2671545	30	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	244155-244184	7	0.767
NZ_CP025030_7	7.1\|2671516\|30\|NZ_CP025030\|CRISPRCasFinder	2671516-2671545	30	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	29309-29338	8	0.733
NZ_CP025030_7	7.1\|2671516\|30\|NZ_CP025030\|CRISPRCasFinder	2671516-2671545	30	NZ_CP034149	Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence	445653-445682	9	0.7

1. spacer 7.1|2671516|30|NZ_CP025030|CRISPRCasFinder matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.767

gtccagttggccccaggcgtcgttggccag	CRISPR spacer
gtcgagctggccccaggcgtcgtcgccggc	Protospacer
*** **.****************.* * .

2. spacer 7.1|2671516|30|NZ_CP025030|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

gtccagttggccccaggcgtcgttggccag	CRISPR spacer
gcggagttggccccaggcggcgttgtgaac	Protospacer
*.  *************** *****   *

3. spacer 7.1|2671516|30|NZ_CP025030|CRISPRCasFinder matches to NZ_CP034149 (Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence) position: , mismatch: 9, identity: 0.7

gtccagttggccccaggcgtcgttggccag	CRISPR spacer
tttgttgtggccccaggcgtggttggcctt	Protospacer
 *.    ************* *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1855893 : 1889128

Pseudomonas_phage(33.33%)

plate,integrase,transposase

attL 1846477:1846493|attR 1866583:1866599

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1846477:1846493	attL	NA	NA	NA	NA
WP_100857566.1\|1855893_1856760_-\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	5.6e-58	48.1
WP_100854051.1\|1857392_1861319_-	hypothetical protein	NA	NA	NA	NA
WP_100854052.1\|1861398_1862082_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_100854053.1\|1862086_1863481_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_100854054.1\|1863497_1864172_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_100854055.1\|1864183_1864588_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_100854056.1\|1864600_1865293_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_100854057.1\|1865314_1866265_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_100854058.1\|1866257_1868897_-	DUF2169 domain-containing protein	NA	NA	NA	NA
1866583:1866599	attR	NA	NA	NA	NA
WP_100854059.1\|1868901_1871358_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_100854060.1\|1871357_1874066_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	4.6e-90	32.2
WP_100854061.1\|1874062_1875106_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_100854062.1\|1875069_1876794_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_100854063.1\|1876797_1877217_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_050445814.1\|1877259_1877748_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_100854064.1\|1877849_1879337_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_100854065.1\|1879340_1879859_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_100854066.1\|1879883_1881470_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_167400965.1\|1881847_1885459_+	AAA family ATPase	NA	NA	NA	NA
WP_100854068.1\|1885724_1887209_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.5e-170	63.8
WP_100854069.1\|1887994_1889128_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

5383145 : 5446703

uncultured_Caudovirales_phage(21.88%)

protease,head,tail,transposase,portal,capsid,integrase,terminase

attL 5376162:5376184|attR 5439503:5439525

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5376162:5376184	attL	NA	NA	NA	NA
WP_100857842.1\|5383145_5383640_-	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	4.6e-49	66.9
WP_100856681.1\|5383642_5384086_-	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	1.6e-08	34.5
WP_100856682.1\|5384197_5384932_-	hypothetical protein	NA	NA	NA	NA
WP_100856683.1\|5384931_5385219_-	hypothetical protein	A5A3R2	Burkholderia_phage	8.2e-06	41.0
WP_100856684.1\|5385228_5388405_-	host specificity protein J	Q3HQU5	Burkholderia_phage	2.8e-272	45.7
WP_100856685.1\|5388401_5389016_-\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	1.5e-52	54.4
WP_100856686.1\|5389012_5389792_-	C40 family peptidase	Q3HQU3	Burkholderia_phage	2.8e-64	48.3
WP_100856687.1\|5389794_5390523_-\|tail	phage minor tail protein L	A0A2R3UA90	Siphoviridae_environmental_samples	4.0e-65	49.0
WP_100856688.1\|5390961_5392395_-\|tail	phage tail protein	A0A0B5A596	Achromobacter_phage	1.8e-48	56.4
WP_100856689.1\|5392400_5392742_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	5.9e-27	48.7
WP_100856690.1\|5392738_5395735_-\|tail	phage tail tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	5.1e-90	32.7
WP_100856691.1\|5395770_5396133_-	hypothetical protein	NA	NA	NA	NA
WP_100856692.1\|5396153_5396564_-	hypothetical protein	NA	NA	NA	NA
WP_100856693.1\|5396644_5397580_-	hypothetical protein	G8CLB2	Synechococcus_phage	2.9e-60	41.0
WP_100856694.1\|5397619_5397817_-	hypothetical protein	NA	NA	NA	NA
WP_100856695.1\|5397840_5398257_-	hypothetical protein	NA	NA	NA	NA
WP_145964668.1\|5398253_5398559_-	hypothetical protein	NA	NA	NA	NA
WP_100856697.1\|5398564_5399569_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.4e-68	44.3
WP_100856698.1\|5399647_5399998_-\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	7.4e-17	46.1
WP_167401050.1\|5400024_5401188_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	4.8e-36	29.2
WP_100856700.1\|5401199_5402720_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.4e-128	50.7
WP_100856701.1\|5402716_5402923_-	hypothetical protein	NA	NA	NA	NA
WP_100856702.1\|5402971_5404960_-\|terminase	terminase	R9TMM4	Vibrio_phage	1.8e-115	37.3
WP_100856703.1\|5405830_5407273_+	serine/threonine-protein kinase	M1HTZ5	Acanthocystis_turfacea_Chlorella_virus	2.0e-12	28.1
WP_100856704.1\|5407352_5410637_-	hypothetical protein	NA	NA	NA	NA
WP_100856705.1\|5410934_5411429_-	hypothetical protein	NA	NA	NA	NA
WP_100856706.1\|5411435_5411864_-	hypothetical protein	NA	NA	NA	NA
WP_111886302.1\|5412348_5414454_-	AAA family ATPase	A0A088F8A2	Idiomarinaceae_phage	8.9e-41	27.8
WP_100856708.1\|5414450_5414774_-	hypothetical protein	NA	NA	NA	NA
WP_100856709.1\|5414770_5415016_-	hypothetical protein	NA	NA	NA	NA
WP_100856710.1\|5415012_5415225_-	hypothetical protein	NA	NA	NA	NA
WP_111886298.1\|5415217_5415475_-	hypothetical protein	NA	NA	NA	NA
WP_100856712.1\|5415762_5415954_-	AlpA family phage regulatory protein	A0A1V0E8E5	Vibrio_phage	7.8e-05	47.2
WP_100856713.1\|5416035_5417226_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.3e-78	39.8
WP_100857844.1\|5417455_5417950_-	DNA packaging Nu1	NA	NA	NA	NA
WP_100856714.1\|5417946_5418732_-	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	1.6e-35	38.7
WP_100856715.1\|5419223_5419586_+	response regulator	NA	NA	NA	NA
WP_100856716.1\|5419849_5420293_+	hypothetical protein	NA	NA	NA	NA
WP_100856717.1\|5420402_5420762_-	H-NS histone family protein	NA	NA	NA	NA
WP_100856718.1\|5420985_5421261_+	hypothetical protein	NA	NA	NA	NA
WP_100856719.1\|5421530_5422172_-	hypothetical protein	NA	NA	NA	NA
WP_100856720.1\|5422171_5422585_-	hypothetical protein	NA	NA	NA	NA
WP_100856721.1\|5422794_5424159_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.0e-74	41.1
WP_100856722.1\|5424155_5424980_-	helix-turn-helix domain-containing protein	A0A0U4IBP5	Pseudomonas_phage	2.9e-27	62.9
WP_100856723.1\|5424976_5425474_-	DUF1364 family protein	NA	NA	NA	NA
WP_100856724.1\|5425464_5425770_-	hypothetical protein	NA	NA	NA	NA
WP_111886297.1\|5425762_5426038_-	hypothetical protein	A0A1J0GUZ1	Halomonas_phage	4.6e-06	36.7
WP_050449885.1\|5426064_5426508_-	hypothetical protein	Q8W6P5	Burkholderia_virus	1.5e-27	47.3
WP_100856726.1\|5426764_5427058_+	hypothetical protein	NA	NA	NA	NA
WP_100856727.1\|5427203_5427446_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_167401141.1\|5427670_5428546_+	helix-turn-helix transcriptional regulator	A0A1B0VRI7	Pseudomonas_phage	1.2e-10	30.5
WP_100854261.1\|5428674_5429794_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	4.0e-56	43.0
WP_126376288.1\|5430207_5430471_-	hypothetical protein	NA	NA	NA	NA
WP_126376285.1\|5430842_5431295_-	hypothetical protein	NA	NA	NA	NA
WP_100857845.1\|5432424_5433117_+	HNH endonuclease	NA	NA	NA	NA
WP_100856730.1\|5433372_5433609_+	hypothetical protein	NA	NA	NA	NA
WP_100856731.1\|5433764_5434664_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	1.7e-41	32.6
WP_126376281.1\|5434670_5435039_-	hypothetical protein	NA	NA	NA	NA
WP_100856733.1\|5435042_5435969_+	hypothetical protein	A1YZR3	Burkholderia_virus	5.1e-49	38.8
WP_100856734.1\|5436363_5436867_+	hypothetical protein	A0A2H4J4Q4	uncultured_Caudovirales_phage	1.5e-39	54.8
WP_100856735.1\|5436859_5437642_+	hypothetical protein	NA	NA	NA	NA
WP_100856736.1\|5437742_5437991_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_100856737.1\|5437987_5439277_-\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	5.5e-134	55.3
WP_100856738.1\|5439517_5442118_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	9.7e-21	28.3
5439503:5439525	attR	NA	NA	NA	NA
WP_100856739.1\|5442114_5443308_+	cupin domain-containing protein	NA	NA	NA	NA
WP_100856740.1\|5443525_5443747_+	endopeptidase	NA	NA	NA	NA
WP_167401051.1\|5443920_5445045_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_100856741.1\|5445062_5445968_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_100856742.1\|5446055_5446703_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_3

5458838 : 5472169

Pseudomonas_phage(36.36%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100856756.1\|5458838_5459333_-	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	2.5e-50	64.3
WP_100856757.1\|5459322_5459787_-	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	2.6e-09	34.5
WP_100856758.1\|5460197_5460554_-\|tail	phage tail protein	NA	NA	NA	NA
WP_100856759.1\|5460797_5462615_-	hypothetical protein	A0A0A8J8U5	Ralstonia_phage	7.2e-31	37.8
WP_100856760.1\|5462614_5463280_-	DUF2612 domain-containing protein	A0A0N9SSD8	Pseudomonas_phage	1.4e-29	35.6
WP_100856761.1\|5463279_5464731_-	hypothetical protein	A0A0N9SH53	Pseudomonas_phage	4.8e-70	34.0
WP_100856762.1\|5464764_5465169_-	hypothetical protein	E5AGC2	Erwinia_phage	4.8e-12	40.0
WP_100856763.1\|5465168_5465864_-	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	1.2e-10	31.6
WP_100856764.1\|5465860_5466814_-	hypothetical protein	M4SNA5	Psychrobacter_phage	1.2e-21	28.7
WP_100856765.1\|5466800_5467133_-	hypothetical protein	NA	NA	NA	NA
WP_100856766.1\|5467129_5467717_-	hypothetical protein	I3PGV3	Xanthomonas_phage	2.3e-07	27.0
WP_100856767.1\|5467725_5469735_-	hypothetical protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-20	29.6
WP_164741192.1\|5469737_5469887_-	hypothetical protein	NA	NA	NA	NA
WP_100856768.1\|5469883_5470369_-	hypothetical protein	NA	NA	NA	NA
WP_100856769.1\|5470368_5470797_-	DUF3277 family protein	NA	NA	NA	NA
WP_100856770.1\|5470810_5472169_-	DUF3383 family protein	A0A0N9SJA3	Pseudomonas_phage	5.3e-79	39.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection