CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018062	Enterococcus mundtii strain DSM 4838 plasmid pLDW-8, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP018061	Enterococcus mundtii strain DSM 4838 chromosome, complete genome	1 crisprs	cas14j,DinG,cas3,DEDDh,csa3	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

55668 : 61464

Staphylococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071868067.1\|55668_56244_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.2e-43	52.8
WP_071868068.1\|56762_57836_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.0e-45	32.0
WP_071868069.1\|57820_58441_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.6e-30	38.3
WP_071868070.1\|58437_59613_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.6e-102	50.3
WP_071868071.1\|59631_60093_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-37	53.3
WP_100917310.1\|60894_61464_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.7e-31	40.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018061

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018061_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018061_1

2598510-2598623

Orphan

Consensus_repeat	Method
TCATCTAATCACTGCGTTCTTAGTGATTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018061_1

>merge|NZ_CP018061|1|2598510-2598623|CRISPRCasFinder
TCATCTAATCACTGCGTTCTTAGTGATTCTACTCGCTTGCGCTCGAAAGGAAACTCCTTTCGCTCAACTCAACGAGTATTGTTCATCATCTAATCACTTCGTTCTTAGTGATTC

>NZ_CP018061|1|1|2598510-2598623|CRISPRCasFinder
TCATCTAATCACTGCGTTCTTAGTGATTC	TACTCGCTTGCGCTCGAAAGGAAACTCCTTTCGCTCAACTCAACGAGTATTGTTCA
TCATCTAATCACTTCGTTCTTAGTGATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018061.1\|WP_010734281.1\|2600357_2601026_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP018061.1\|WP_071866449.1\|2593718_2594069_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018061.1\|WP_065096676.1\|2606252_2607293_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP018061.1\|WP_010734286.1\|2596927_2597185_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018061.1\|WP_065096677.1\|2603334_2605059_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|223933
NZ_CP018061.1\|WP_071866450.1\|2597944_2598448_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP018061.1\|WP_071866453.1\|2602027_2603338_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|238623
NZ_CP018061.1\|WP_010734275.1\|2607353_2608133_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NZ_CP018061.1\|WP_071866445.1\|2589735_2590968_-\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP018061.1\|WP_071866447.1\|2592428_2593106_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP018061.1\|WP_081367414.1\|2594773_2596297_-\|putative-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225420
NZ_CP018061.1\|WP_019722298.1\|2594192_2594387_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018061.1\|WP_071866446.1\|2591154_2592348_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP018061.1\|WP_065096675.1\|2608125_2608962_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP018061.1\|WP_023520342.1\|2588841_2589543_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP018061.1\|WP_071866451.1\|2598823_2599513_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP018061.1\|WP_010734282.1\|2599614_2600037_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP018061.1\|WP_010734285.1\|2597517_2597886_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP018061.1\|WP_023520403.1\|2605168_2606230_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270307
NZ_CP018061.1\|WP_071866452.1\|2601041_2601914_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801

Protein	Function_ID	Function_description	E-value
NZ_CP018061.1\|WP_010734281.1\|2600357_2601026_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	2.54347e-74
NZ_CP018061.1\|WP_065096676.1\|2606252_2607293_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	7.97082e-155
NZ_CP018061.1\|WP_071866452.1\|2601041_2601914_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	1.61722e-98
NZ_CP018061.1\|WP_065096677.1\|2603334_2605059_-\|amidohydrolase-family-protein	gnl\|CDD\|223933	COG1001, AdeC, Adenine deaminase [Nucleotide transport and metabolism].	2.64653e-140
NZ_CP018061.1\|WP_071866450.1\|2597944_2598448_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.61842e-67
NZ_CP018061.1\|WP_071866453.1\|2602027_2603338_-\|amidohydrolase	gnl\|CDD\|238623	cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases. Atrazine, a chlorinated herbizide, can be catabolized by a variety of different bacteria. The first three steps of the atrazine dehalogenation pathway are catalyzed by atrazine chlorohydrolase (AtzA), hydroxyatrazine ethylaminohydrolase (AtzB), and N-isopropylammelide N-isopropylaminohydrolase (AtzC). All three enzymes belong to the superfamily of metal dependent hydrolases. AtzA and AtzB, beside other related enzymes are represented in this CD.	1.12592e-163
NZ_CP018061.1\|WP_010734275.1\|2607353_2608133_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	1.209e-56
NZ_CP018061.1\|WP_071866445.1\|2589735_2590968_-\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	1.17547e-23
NZ_CP018061.1\|WP_071866447.1\|2592428_2593106_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	1.01498e-17
NZ_CP018061.1\|WP_081367414.1\|2594773_2596297_-\|putative-DNA-binding-domain-containing-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	4.94676e-32
NZ_CP018061.1\|WP_071866446.1\|2591154_2592348_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.46776e-71
NZ_CP018061.1\|WP_023520342.1\|2588841_2589543_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	2.24688e-117
NZ_CP018061.1\|WP_071866451.1\|2598823_2599513_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	7.61628e-148
NZ_CP018061.1\|WP_010734282.1\|2599614_2600037_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	1.01488e-94
NZ_CP018061.1\|WP_010734285.1\|2597517_2597886_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	2.41963e-45
NZ_CP018061.1\|WP_023520403.1\|2605168_2606230_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270307	cd13589, PBP2_polyamine_RpCGA009, The periplasmic-binding component of an uncharacterized ABC transport system from Rhodopseudomonas palustris CGA009 and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic binding domain that serves as the primary high-affinity receptor of an uncharacterized ABC-type polyamine transporter from Rhodopseudomonas palustris Cga009 and related proteins from other bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.14499e-77
NZ_CP018061.1\|WP_065096675.1\|2608125_2608962_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	2.50367e-75

>NZ_CP018061.1|WP_071866450.1|2597944_2598448_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSAKFTEAASVVVVDYRGLTVDEVTRLRKQLREANVEMKVIKNSILSRAAKKAGLDGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKDAKALEIKGGIIEGKVSTLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP018061.1|WP_010734285.1|2597517_2597886_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAAVAAGGGAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP018061.1|WP_010734286.1|2596927_2597185_+|hypothetical-protein
MSDLEHKEEKALDKIVATVNKLDKELNELDTLSENPEKKHNLKKWLVERKAIHEIKKILHEADKYEKYDEKELDKEFKEINDLLQ
>NZ_CP018061.1|WP_081367414.1|2594773_2596297_-|putative-DNA-binding-domain-containing-protein
MKFIELKDEIFTEPKENFQLEFKKSQTKLSNDVWSTYSAFANTNGGIIILGIEELVSKKEYQVVGVDNPEKVITEFWNCIHDKQKVSVNLLTNEDVQTFKVSGKSIIEINVPKAPYERRPVYINNNKSKTYIRTDDGDRIADDAQFKYLIVDSQNDIDSELLQNYDIDDLNLETVNEYRNLLYKNTNNSKYFELSHEELLKNIGVLKKDRQDSKSPYRLTIGGLLFLGKYNSITDRFKKFQLDYFKKQSFLDTDWRDRVSSGDMNYPEMNLFSFYNLVIQKLELSVPDSYRQEENMTRGSYRTDLLLALKEALVNTLMHAYYVSDKVIKIINCDDYVSFYNPGEMKVSKDEFINGSFSVTRNSIISTLFRRVGIAEKGGSGGPRIFEVATKNSLRTPEVDTNFDSTEVRIWKINMLESLSGLNEVETSIIKYAMEKPAFKIKDIVNSTSYKDHTVRKNVNNLVEKEMLQKIGNGKATMFVLSSSEETGVMTFKRLLKEIEVGFMKSK
>NZ_CP018061.1|WP_019722298.1|2594192_2594387_-|hypothetical-protein
MYYVEVQTRGVKNKQYVKTVRHNYPLLGSWEEAEPFSKECALQIKSILEQELTCGKANVTIIEK
>NZ_CP018061.1|WP_071866449.1|2593718_2594069_-|hypothetical-protein
MTYEVKVSKEILNIFSENQSKRYQEIILYKVNEYLTHNFYRIKLVDTPVKPSIYEMKIRLGKENFRIAFIIEDKEVQVFYISRTLKKELFDKEVNRFVHRFNKKHRITKSMKKVEA
>NZ_CP018061.1|WP_071866447.1|2592428_2593106_-|TVP38/TMEM64-family-protein
MKKQYIRNTLIGLGLLLILFVGYQLYLEYRPDIHLLLDPQASRKEWMREIRSHGVSAAFILTLLISLMCAVPGIPTSVIGVVVGLSYGPFLGTVINVTGNALGNILSIILMQHLSFMDHSKKENRWVKAIRRMKHPKIGVMIGYMVPVIPSSVVNFAATSLNLSVRELLLSILIGVVPSSLLYACGGEALFHGEHIKALVLVASVLVLTVLVVIIYRDRRKHLVK
>NZ_CP018061.1|WP_071866446.1|2591154_2592348_-|MFS-transporter
MEMNKQTPLSKSLILLLAITCGVVVANMYYIQPIGTKVAANLSVNTSAVGLLTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAGLSALSLLAAFFAPNFALFAVASFLIGLLSIVPQIIIPYGAVLAGPAARGKTMGILLSGLLMGILLSRTVSGLLASWFSWRSVYLFALCLVGALTVLLYLKLPRTQGTLEKESTVSYLASLKSLPKLVKEQRLLREAAINGFFMFGTFSLFWSTLIFYISSPAYGWGTFEAGILAIFGLSGAVAAPIVGRLADTYSERRIVGMGLVMQTISFLALFVAGDYVAVLLVAIILLDVGNQFGQVANQSRVQGLGEATSNRNNTIFMFMYFIGGATGSLLGSVMWQHYGWVGVTVTGLIFQLCAFFFQAIIYPDKRK
>NZ_CP018061.1|WP_071866445.1|2589735_2590968_-|Fic-family-protein
MSYKPLKITFYENRNEFEEEYNSRFNFFSTFKTGLKIHPFDREQRITTESYELFYIPLLEHENLKERIQKNSSEIERYISMLPPIIQRNIFNSQIIDEIKSTNDIEGIQSTRKEIGTAIKKRNSDEIVRFKGIVNMYMNLGESEFEEIHDIVKIRNIYDELFRKDIPEEDQPDGQLFRKEVVYIGSENKRVHQGNPNEETIIRDLNNLVLFMNRKDIPFLLKCVITHYYFEYIHPFYDGNGRMGRFLISNYLSRKLDFLTGITISNAITHDKKAYGKLFEEVSNPRNKADLTLFVQNMYQLIIDGQTKVIEELQIAKAKLDNAINNLKKLDLKDKDMVEVLFVLIQGHLYNEVNEYITDIELRKHLNISYPKLKQINQYLIAKKLIVQIKKKPSIHILSTEFQERLESFS
>NZ_CP018061.1|WP_023520342.1|2588841_2589543_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKNGMENGAKVLGLATGSTPITLYKEMTSSDMDFSNMTSVNLDEYVGLGGSDDQSYRHFMNVELFDKKPFKETFVPDGKAADLDQACQSYDQIIEEHPIDIQILGIGQNGHIGFNEPGAPFDGKTSVVDLTESTINANKRFFDKVEDVPTKAVSMGIGSILNGKKIVLMAYGESKAEAIKGMINGPVTTDMPASALQNHDDVIVIVDEAAASKL
>NZ_CP018061.1|WP_071866451.1|2598823_2599513_-|50S-ribosomal-protein-L1
MAKKSKKMQEALKKVDSNKVYSVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAINEVKAGKVTYRVDKAGNIHVPIGKVSFDNEKLVENFAAIHDVLVKAKPSAAKGQYMKNITVTTTFGPGIHVDQASF
>NZ_CP018061.1|WP_010734282.1|2599614_2600037_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVKEIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP018061.1|WP_010734281.1|2600357_2601026_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLKYRSVFDIIGPVMIGPSSSHTAGAARIGKIVRSIFGDQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDSRLADSLRLAHEAGMEVLFVPKSEKADHPNSVKMLLKKGSRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIIVHQDVPGMIAKVTNILSETNTNIGTMTVTRESKGENAIMIMEVDDPQVEDTVKKLKQLPNIDSVNYFE
>NZ_CP018061.1|WP_071866452.1|2601041_2601914_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVQQAQDYPSVAELMIAVEMEMSGRSREQIIKIMEKNLLVMEQSIAEGNAGVTSVTGITGGDAKKMDNYLSHADFLSGETILTAVRNAIAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLQLTHEQQLDFLFTAGAFGLVIANNASISGAEGGCQAEIGSASAMASAALVCAKNGTAHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLTKEILEKQT
>NZ_CP018061.1|WP_071866453.1|2602027_2603338_-|amidohydrolase
MSTLIKNVHVLTMDDQLTEYKNGYVRIEENRIIEIGEWRKGIASAEEVIDGAGGILLPGFVNTHTHAGMIPFRSLGDDVPDRLRRFLFPLEAFMTPELVAASTAYAISEMLLSGVTGFCDMYYFEDQVAQVCDQFKIRAILGETIIDMPVCDNVEPSGGLTYCETFLPKWKDHPLITPALAPHAPNTNTYEGLKRTVELSERYDVPITLHVAEMDYEMQELAKQYQQTPFELLKDLGFMNRPLIMAHCIHMTEADIALVATAGEQVGIAHCIGANTKSAKGVAPVKAMLSAGLTVGLGTDGPSSGNTLDLFAQMKLFANFHKTFEKDRALFPAKEIVRLATRGGAELLDFKETGQLVVGNKADFIIVETQSVNMFPIFDPYSALVYSANASNVAHVWVDGRQLVRDHQLVHHDLKQIKADLYEQMGQFVFEAKRRM
>NZ_CP018061.1|WP_065096677.1|2603334_2605059_-|amidohydrolase-family-protein
MKIDLLIRDAQVYNTAKQCFEKKHVTVSGEKFYYITTKDLSHLEILHEIDGRGKYMIPGLIDSHMHIESSMTTPSIFSKAVLPFGVTTVIADAHEMANVFGLEGLTEFMAAETELDIFHAIPSSVPSTTPELETTGGIIGLAETEKLLDNPKVICLGEAMNFHGIAHEPTSLIRQIIDLCKEKRPTMPLEGHCPKIYEEELAAFMYSGISSDHTHQFPESLAEKIENGMFIQFQNKSITPENMAVITENEYYDYACLITDDVMADDLLTGHLNENLRKAVEAGLPVEQAIYMTTYTPARRMGLNDRGLIGPGRMADFILLDDLSTFAISAVFKSGKEVYRQGEAITYPEKIEQFPASYSQTVHCKKLSLDDLRLPVKTDLASVRCNVIRKHEVGTFTERITKEIPVKDGYLDWENSDCALLLVMERYGKNGNVAYALMEEPISKPGSIATTWAHDHHNVMVMGNNCQDILLAQQKLLELQGGYVVVNEGKLTATCPLPIGGIVSQAPIEELGQDLKTVRREMQNLGYKNMNEIMSFSTLSLPVSPAIKMTDKGMMNTKTQEFYPLVFPSDGVLL
>NZ_CP018061.1|WP_023520403.1|2605168_2606230_-|ABC-transporter-substrate-binding-protein
MKKGFLVSSVVLASMFVLTACGGGSETNSSEAKESKDLVVSTFGLSEDIVKSDVMDPFEKEFDAKITMDLGNSGDRFNKLISNPRGIDVIELAQANSADGASQELFEKLDESKIPNLADLTEGAKEVFDSGAGVPIAVNSVGIVYDREKVGKEITSWSDLWDSALEGKISIPEITTTAGPLMMYIASDHAGVAIEDDNGEAAFEALEELKPNIVKTYARSSDLANMFQAGEIEAAIVMDFAYDIVKGDSDTIEYVVPESGTYANYNTINIPKEAANKELAYSFINYRISEESQKTKALSLNEAPTNDKVELSEEEAGNMTYGAVADRAKNIDFDFVNSQMTDWIDRWNRLINQ
>NZ_CP018061.1|WP_065096676.1|2606252_2607293_-|ABC-transporter-ATP-binding-protein
MSFVNLNNIRVSYDGKQNILEDLSISMEKGELVSLLGPSGCGKTTTLRVIAGLISPNEGSFVLEDQELVKVPVHKRNFGMVFQSYALFPHLTIAENVAFGLKLRKENKADIAKKVADMLAICGLEQLGDRYPKQLSGGQRQRVALARALVIEPKLLLLDEPLSNLDAKLRVQMRIEIKRIQQQLGITTVFVTHDQEECFSISDKVAVMNNGVIEQYDTPETIYRHPKTRFVAHFIGFENFFPVEQIEGIRYQAAGNVIETPYEQPIAERLVATIRPEDIEIASDATHNLVKGEVKVRTFLGKSYQYEVTTALGKFLVNGTDKQIYQAGDQINLHFPKDKIVLLEDK
>NZ_CP018061.1|WP_010734275.1|2607353_2608133_-|ABC-transporter-permease
MRKQKGMTIIAVLVFAFLFLPLVIIVVTSFGQSSTIQFPIDGFSLEWYKKALSSETFMNSFKLSLSIGVGATLLALLVGVPTSYALSRYHMKSKQLFKNFFLSPTMIPGIVVGYSLFQYIVIKFNLPVIQALLIGHFLISLPYIIRVVGSSMEQLDFSIEEVAWTLGCTKTRAFMQVVLPNVSSGIFAAFMLAFVNSFNNVPVSMFLSGPGVTMLPTSLLSYIEYTYDPTVSAISVMIMVLTVFLMFIIEKTLGLASIA
>NZ_CP018061.1|WP_065096675.1|2608125_2608962_-|ABC-transporter-permease
MRKNVPYLIIAPGTILLLFFMILPLVNIIWPTIFTETGASLSAYTSFLTDDFNLKIFLRTIRVSVIVTLISAVLGIPTAYFIAGVGKKWKSLLMAMTMFPLLTNSVIRSFAWINILGRTGVINNFLIRIGLIEQPIALLYTEFAIIIGSVYLFLPTMVMTLVGVMENIEKETLEAAETLGASPFKTFYKIVMPLCIPGVIVGSILVFTGTLTAYTTPQLLGGNQNMMMATFLYQKASTLGDWTSASVIALIMIVTTLIVNKGLNMIAARLDRREMNHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

481564 : 489317

Planktothrix_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019722498.1\|481564_482647_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-20	29.6
WP_071866641.1\|482621_483575_+	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	8.5e-07	25.8
WP_071866640.1\|483587_484595_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	3.6e-56	40.1
WP_010736144.1\|484737_485559_-	NUDIX hydrolase	G3MA14	Bacillus_virus	1.9e-23	32.1
WP_010736142.1\|486206_488216_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	6.4e-97	38.3
WP_071866639.1\|488555_489317_+	Fic family protein	D7RWK9	Brochothrix_phage	3.2e-09	23.5

DBSCAN-SWA_2

609961 : 618674

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071866999.1\|609961_610624_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.5e-58	52.2
WP_010736048.1\|610620_610950_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_071866998.1\|610958_611897_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.2e-32	33.4
WP_071866997.1\|611936_612761_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_010736045.1\|612753_613101_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	1.1e-17	40.2
WP_071866996.1\|613240_614110_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.5e-95	63.7
WP_176285304.1\|614271_615408_+	DNA polymerase IV	NA	NA	NA	NA
WP_071866994.1\|615510_616113_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	5.5e-52	58.0
WP_071866993.1\|616484_618674_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.6e-287	66.0

DBSCAN-SWA_3

640520 : 718204

Enterococcus_phage(46.15%)

integrase,tRNA,terminase,tail,portal,plate,protease,capsid,holin

attL 641136:641154|attR 679275:679293

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010736012.1\|640520_640865_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_071866972.1\|640877_641159_+	50S ribosomal protein L27	NA	NA	NA	NA
641136:641154	attL	NA	NA	NA	NA
WP_071866971.1\|641252_642401_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	4.7e-68	40.6
WP_071866970.1\|642496_643099_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_071866969.1\|643244_643742_-	hypothetical protein	A0A1W6JPB4	Staphylococcus_phage	3.4e-15	33.8
WP_071866968.1\|643754_644294_-	helix-turn-helix domain-containing protein	C9E2M1	Enterococcus_phage	1.2e-37	51.7
WP_071866967.1\|644470_644695_+	DUF739 family protein	A0A0S2MYC3	Enterococcus_phage	3.6e-25	72.6
WP_071866966.1\|644728_645013_+	hypothetical protein	NA	NA	NA	NA
WP_071866965.1\|645466_646159_+	ERF family protein	A0A0S2MYH3	Enterococcus_phage	7.0e-43	41.7
WP_071866964.1\|646160_647045_+	DUF1351 domain-containing protein	A0A0S2MYB3	Enterococcus_phage	8.6e-30	48.4
WP_071867029.1\|647077_647764_+	hypothetical protein	C9E2N1	Enterococcus_phage	6.4e-89	68.2
WP_071866963.1\|647767_648700_+	phage replisome organizer N-terminal domain-containing protein	A0A1S5SFJ6	Streptococcus_phage	2.0e-48	69.0
WP_169925657.1\|648689_648857_+	hypothetical protein	NA	NA	NA	NA
WP_071866962.1\|648843_649170_+	hypothetical protein	D2IZY3	Enterococcus_phage	4.8e-10	32.7
WP_071866961.1\|649154_649382_+	hypothetical protein	NA	NA	NA	NA
WP_071866960.1\|649384_649624_+	hypothetical protein	NA	NA	NA	NA
WP_071866959.1\|649620_649806_+	hypothetical protein	NA	NA	NA	NA
WP_071866958.1\|649802_650540_+	hypothetical protein	NA	NA	NA	NA
WP_071866957.1\|650536_650740_+	hypothetical protein	NA	NA	NA	NA
WP_157811367.1\|650736_650874_+	hypothetical protein	NA	NA	NA	NA
WP_071866956.1\|650885_651092_+	hypothetical protein	NA	NA	NA	NA
WP_071866955.1\|651088_651631_+	DUF1642 domain-containing protein	W6LMV2	Streptococcus_phage	3.4e-13	39.1
WP_071866954.1\|651627_651831_+	hypothetical protein	NA	NA	NA	NA
WP_071866953.1\|651842_652034_+	hypothetical protein	NA	NA	NA	NA
WP_071866952.1\|652033_652228_+	hypothetical protein	NA	NA	NA	NA
WP_071866951.1\|652264_652462_+	hypothetical protein	NA	NA	NA	NA
WP_071867028.1\|652668_652911_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.2e-22	69.4
WP_071866950.1\|652907_653105_+	hypothetical protein	NA	NA	NA	NA
WP_071866949.1\|653101_653395_+	hypothetical protein	NA	NA	NA	NA
WP_100917235.1\|653982_654462_+	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	1.2e-25	46.0
WP_071867982.1\|654768_655056_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_071867981.1\|655300_655693_+	hypothetical protein	NA	NA	NA	NA
WP_071867980.1\|655740_656004_+	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	2.7e-32	73.6
WP_071867979.1\|656044_656287_+	hypothetical protein	NA	NA	NA	NA
WP_071867978.1\|656276_656798_+	ParB N-terminal domain-containing protein	C9E2P7	Enterococcus_phage	1.5e-69	74.0
WP_071867977.1\|656784_657387_+	protein Mom	C9E2P8	Enterococcus_phage	7.8e-107	91.5
WP_071867976.1\|657526_657736_+	hypothetical protein	A8ATN7	Listeria_phage	1.6e-11	59.4
WP_081367475.1\|657791_658565_+	hypothetical protein	NA	NA	NA	NA
WP_071867975.1\|658611_659478_+\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	1.4e-77	61.2
WP_071867974.1\|659437_660736_+\|terminase	PBSX family phage terminase large subunit	A0A0B5CYJ6	Listeria_phage	2.7e-149	58.4
WP_071867973.1\|660751_662251_+\|portal	phage portal protein	A0A1S5SAH6	Streptococcus_phage	2.6e-111	44.7
WP_071867972.1\|662250_663414_+\|capsid	phage minor capsid protein	Q5YA73	Bacillus_phage	7.2e-133	58.4
WP_071867971.1\|663529_664099_+	phage scaffolding protein	X2CYF9	Lactobacillus_phage	3.6e-13	31.2
WP_071867970.1\|664115_665006_+	hypothetical protein	A0A1S5SA37	Streptococcus_phage	9.7e-106	65.8
WP_157811368.1\|665013_665178_+	hypothetical protein	NA	NA	NA	NA
WP_071867969.1\|665213_665606_+	hypothetical protein	Q5YA68	Bacillus_phage	4.0e-27	53.4
WP_071867968.1\|665599_665941_+\|capsid	minor capsid protein	Q5YA67	Bacillus_phage	3.7e-37	61.9
WP_071867967.1\|665940_666267_+\|capsid	minor capsid protein	Q5YA66	Bacillus_phage	6.2e-26	52.4
WP_071867966.1\|666266_666668_+\|capsid	minor capsid protein	Q5YA65	Bacillus_phage	9.3e-40	56.5
WP_071867965.1\|666664_667132_+\|tail	phage tail protein	Q5YA64	Bacillus_phage	2.8e-27	46.9
WP_071867983.1\|667097_667469_+	fibronectin type III domain-containing protein	D2J067	Enterococcus_phage	7.1e-26	50.9
WP_071867964.1\|667440_667989_+	hypothetical protein	NA	NA	NA	NA
WP_071867963.1\|668026_668476_+	hypothetical protein	B3GW11	Streptococcus_phage	8.3e-13	30.8
WP_071867962.1\|668484_669063_+	bacteriophage Gp15 family protein	Q5YA62	Bacillus_phage	6.4e-42	48.9
WP_081367474.1\|669055_672511_+	tape measure protein	Q938K3	Temperate_phage	2.9e-12	41.9
WP_071867960.1\|672510_673272_+\|tail	phage tail protein	A0A1D3SNM1	Enterococcus_phage	3.0e-63	45.5
WP_071867959.1\|673268_675461_+\|tail	phage tail protein	A0A1G5SAE0	Enterococcus_phage	1.3e-135	45.5
WP_071867958.1\|675457_676906_+\|plate	BppU family phage baseplate upper protein	D2IYX9	Enterococcus_phage	1.7e-51	43.4
WP_081367476.1\|677026_677257_+	hemolysin XhlA family protein	NA	NA	NA	NA
WP_100917236.1\|677260_677458_+\|holin	phage holin	A0A0S2MYF6	Enterococcus_phage	1.2e-21	79.7
WP_100917237.1\|677468_678731_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	3.5e-186	75.0
WP_071865916.1\|678770_679079_-	hypothetical protein	NA	NA	NA	NA
WP_071865917.1\|679688_682544_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
679275:679293	attR	NA	NA	NA	NA
WP_066026051.1\|682707_683199_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_071865918.1\|683299_684271_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_071865919.1\|684303_685110_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_019724014.1\|685126_686041_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_071865920.1\|686356_686731_+	DUF956 family protein	NA	NA	NA	NA
WP_010736004.1\|686808_687054_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_071865921.1\|687206_688271_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_010736002.1\|688483_688909_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_010736001.1\|688901_689351_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_071865922.1\|689445_690300_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.5e-39	37.8
WP_071865923.1\|690296_691637_+	exodeoxyribonuclease VII large subunit	A0A160DEV2	Gordonia_phage	2.5e-28	31.6
WP_010735998.1\|691638_691866_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_071865924.1\|691862_692750_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_010735996.1\|692758_693580_+	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_010735995.1\|693679_694129_+	arginine repressor	NA	NA	NA	NA
WP_071865925.1\|694146_695826_+	DNA repair protein RecN	NA	NA	NA	NA
WP_071865926.1\|696682_698626_+	hypothetical protein	NA	NA	NA	NA
WP_010735989.1\|698710_698827_-	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_010735988.1\|698898_699855_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_071865927.1\|700064_700433_+	DUF3397 domain-containing protein	NA	NA	NA	NA
WP_029594184.1\|700603_701035_+	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_071865928.1\|701056_702016_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_010735984.1\|702020_702419_+	cell division protein FtsL	NA	NA	NA	NA
WP_071865929.1\|702419_704612_+	penicillin-binding protein	NA	NA	NA	NA
WP_066026042.1\|704628_705591_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_071865930.1\|705603_706974_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_071865931.1\|706992_708081_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_071865932.1\|708095_709268_+	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_071865933.1\|709422_710751_+	cell division protein FtsA	NA	NA	NA	NA
WP_010735977.1\|710772_712020_+	cell division protein FtsZ	NA	NA	NA	NA
WP_071865934.1\|712035_712722_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_065095674.1\|712721_713321_+	cell division protein SepF	NA	NA	NA	NA
WP_071865935.1\|713351_713621_+	YggT family protein	NA	NA	NA	NA
WP_065095675.1\|713656_714439_+	RNA-binding protein	NA	NA	NA	NA
WP_019722916.1\|714459_715167_+	DivIVA domain-containing protein	NA	NA	NA	NA
WP_071865936.1\|715411_718204_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.8e-73	26.4

DBSCAN-SWA_4

833644 : 914235

Enterococcus_phage(21.95%)

integrase,tRNA,terminase,tail,portal,plate,transposase,capsid

attL 833538:833559|attR 881706:881727

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
833538:833559	attL	NA	NA	NA	NA
WP_071866012.1\|833644_834826_-\|integrase	site-specific integrase	A0A0S2MYI6	Enterococcus_phage	5.3e-67	41.7
WP_081367398.1\|834926_835382_-	hypothetical protein	A0A1X9IGD6	Lactococcus_phage	9.9e-22	61.7
WP_071866013.1\|835562_836003_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_071866014.1\|836012_836363_-	helix-turn-helix transcriptional regulator	A0A1S5SBE7	Streptococcus_phage	3.5e-19	42.7
WP_071866015.1\|836656_836848_+	hypothetical protein	Q9AZF4	Lactococcus_phage	6.0e-05	38.1
WP_071866078.1\|836872_837127_+	hypothetical protein	A0A0S2MYC6	Enterococcus_phage	4.2e-30	73.2
WP_071866016.1\|837138_837864_+	ORF6C domain-containing protein	A0A1P8BKT1	Lactococcus_phage	2.3e-41	62.3
WP_157811369.1\|837926_838103_+	hypothetical protein	NA	NA	NA	NA
WP_071866079.1\|838169_838385_+	hypothetical protein	NA	NA	NA	NA
WP_071866018.1\|838875_839076_+	hypothetical protein	NA	NA	NA	NA
WP_071866019.1\|839072_839753_+	ERF family protein	Q6JM07	Lactococcus_phage	6.2e-36	55.9
WP_071866020.1\|839753_840638_+	DUF1351 domain-containing protein	A0A0S2MYB3	Enterococcus_phage	3.1e-27	28.2
WP_071866021.1\|840670_841357_+	hypothetical protein	C9E2N1	Enterococcus_phage	6.6e-86	65.9
WP_071866022.1\|841375_842338_+	phage replisome organizer N-terminal domain-containing protein	A0A2H4J2I9	uncultured_Caudovirales_phage	7.4e-35	56.1
WP_169823210.1\|842327_842492_+	hypothetical protein	NA	NA	NA	NA
WP_071866023.1\|842485_842800_+	hypothetical protein	NA	NA	NA	NA
WP_071866024.1\|843691_843937_-	toxin-antitoxin system, toxin component	NA	NA	NA	NA
WP_071866025.1\|844347_844725_+	DNA-packaging protein	A0A141E176	Streptococcus_phage	1.8e-29	53.9
WP_081367399.1\|845135_845543_+	DUF1642 domain-containing protein	A8E2L2	Enterococcus_phage	9.5e-24	46.6
WP_071866027.1\|846471_846939_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_071866028.1\|847505_847688_+	hypothetical protein	NA	NA	NA	NA
WP_071866029.1\|848492_848672_+	hypothetical protein	NA	NA	NA	NA
WP_071866030.1\|848671_848914_+	hypothetical protein	NA	NA	NA	NA
WP_071866031.1\|848903_850175_+	DNA modification methylase	D0R0C5	Streptococcus_phage	2.9e-95	45.4
WP_071866032.1\|850314_850521_+	hypothetical protein	A8ATN7	Listeria_phage	2.1e-11	61.4
WP_100917238.1\|850545_851262_+	hypothetical protein	D2IYV9	Enterococcus_phage	3.4e-85	68.2
WP_071866034.1\|851308_852205_+\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	2.7e-63	54.3
WP_071866035.1\|852179_853475_+\|terminase	PBSX family phage terminase large subunit	I1TLD6	Bacillus_phage	9.1e-129	55.1
WP_071866036.1\|853489_855028_+\|portal	phage portal protein	Q5YA75	Bacillus_phage	1.2e-95	40.7
WP_071866037.1\|855032_856181_+\|capsid	phage minor capsid protein	O03929	Lactobacillus_phage	2.8e-57	37.4
WP_071866038.1\|856378_856969_+	phage scaffolding protein	D2J060	Enterococcus_phage	1.4e-15	41.4
WP_071866039.1\|856983_857871_+\|capsid	capsid protein	U3PDP8	Lactobacillus_phage	4.1e-64	45.9
WP_100917239.1\|857867_858053_+	hypothetical protein	NA	NA	NA	NA
WP_071866040.1\|858081_858525_+	hypothetical protein	NA	NA	NA	NA
WP_071866041.1\|858521_858857_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_157811370.1\|858856_859219_+\|capsid	minor capsid protein	A0A1S5SEB7	Streptococcus_phage	1.8e-13	35.9
WP_071866043.1\|859218_859596_+\|capsid	minor capsid protein	Q5YA65	Bacillus_phage	3.5e-12	32.8
WP_071866044.1\|859606_860083_+	hypothetical protein	NA	NA	NA	NA
WP_081367401.1\|860037_860199_+	hypothetical protein	NA	NA	NA	NA
WP_071866045.1\|860226_860688_+	hypothetical protein	B3GW11	Streptococcus_phage	1.4e-10	34.3
WP_071866046.1\|860696_861266_+	bacteriophage Gp15 family protein	Q5YA62	Bacillus_phage	1.8e-41	47.8
WP_071866047.1\|861258_866298_+	tape measure protein	A0A1X9IGH8	Lactococcus_phage	1.5e-38	34.5
WP_071866048.1\|866290_867121_+\|tail	phage tail family protein	Q9T1A6	Listeria_phage	7.5e-60	42.5
WP_071866049.1\|867129_868158_+\|tail	phage tail protein	A0A0B5D0G3	Listeria_phage	1.9e-81	44.9
WP_071866050.1\|868157_869204_+	hypothetical protein	NA	NA	NA	NA
WP_157811371.1\|869228_871391_+\|plate	BppU family phage baseplate upper protein	A0A0C5K8Z4	Enterococcus_phage	1.3e-103	54.7
WP_023519336.1\|871403_871751_+	hypothetical protein	NA	NA	NA	NA
WP_023520196.1\|871743_871872_+	XkdX family protein	NA	NA	NA	NA
WP_023520195.1\|871882_872116_+	hypothetical protein	NA	NA	NA	NA
WP_071866052.1\|872117_872375_+	hypothetical protein	A0A0U4JE55	Bacillus_phage	6.2e-05	40.5
WP_071866053.1\|872443_873337_+	N-acetylmuramoyl-L-alanine amidase	A0A142F1N7	Bacillus_phage	2.6e-42	55.7
WP_071866054.1\|873559_874357_+	hypothetical protein	NA	NA	NA	NA
WP_071866055.1\|874362_875181_+	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_071866056.1\|875426_876008_+	hypothetical protein	NA	NA	NA	NA
WP_169823211.1\|876361_876508_+	hypothetical protein	NA	NA	NA	NA
WP_071866057.1\|877766_878099_+	hypothetical protein	NA	NA	NA	NA
WP_071866058.1\|878224_879517_-	D-serine ammonia-lyase	NA	NA	NA	NA
WP_071866059.1\|879564_879939_-	hypothetical protein	NA	NA	NA	NA
WP_071866060.1\|880419_880725_-	hypothetical protein	NA	NA	NA	NA
WP_071866061.1\|880819_881458_-	SHOCT domain-containing protein	O48432	Lactobacillus_phage	2.0e-20	34.4
WP_071866062.1\|882220_882859_+	hypothetical protein	NA	NA	NA	NA
881706:881727	attR	NA	NA	NA	NA
WP_071866063.1\|883057_885340_-	AAA family ATPase	NA	NA	NA	NA
WP_071866064.1\|885536_887348_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.3e-72	29.6
WP_002287649.1\|887458_887638_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_019723795.1\|887963_889898_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.7e-113	36.8
WP_071866065.1\|890057_890861_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_071866066.1\|890903_891308_+	VOC family protein	NA	NA	NA	NA
WP_034688402.1\|891590_892436_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_041684181.1\|892690_894847_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_023519426.1\|895001_895820_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_071866067.1\|896102_897539_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.9e-41	28.3
WP_010735844.1\|897690_898887_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_010735843.1\|898932_899127_-	YjzD family protein	NA	NA	NA	NA
WP_071866068.1\|899349_902664_+	DNA polymerase III subunit alpha	A0A0K1Y906	Streptomyces_phage	2.9e-139	31.2
WP_034691339.1\|902830_903793_+	6-phosphofructokinase	NA	NA	NA	NA
WP_010735840.1\|903921_905706_+	pyruvate kinase	NA	NA	NA	NA
WP_071866069.1\|905781_906672_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019723059.1\|906906_907872_+	AEC family transporter	NA	NA	NA	NA
WP_010735837.1\|908047_908617_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_010735836.1\|908674_908854_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_034688385.1\|909059_910481_+	NADP-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	3.9e-32	31.3
WP_010735834.1\|910668_911355_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-28	31.2
WP_071866070.1\|911351_912854_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	2.1e-07	29.0
WP_071866071.1\|912939_914235_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	1.5e-06	20.2

DBSCAN-SWA_5

1103340 : 1112374

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034690182.1\|1103340_1104636_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.2e-17	32.0
WP_071867138.1\|1104778_1105156_-	hypothetical protein	NA	NA	NA	NA
WP_071867137.1\|1105412_1106144_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	1.3e-44	41.5
WP_071867136.1\|1106147_1106402_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_019724081.1\|1106403_1107078_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_071867135.1\|1107078_1109301_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.0e-148	40.6
WP_071867134.1\|1109285_1110725_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-53	33.7
WP_071867133.1\|1110755_1111799_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.8e-64	43.5
WP_071867132.1\|1111795_1112374_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.2e-25	36.5

DBSCAN-SWA_6

1730298 : 1834201

123

Enterococcus_phage(17.86%)

head,integrase,tRNA,terminase,tail,portal,plate,protease,capsid,holin

attL 1784585:1784643|attR 1820671:1820729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071867875.1\|1730298_1731990_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	4.4e-75	32.8
WP_071867874.1\|1732527_1733481_-	carbamate kinase	NA	NA	NA	NA
WP_010735175.1\|1733594_1734614_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_062805084.1\|1734719_1735949_-	arginine deiminase	NA	NA	NA	NA
WP_023519859.1\|1736408_1737110_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_010735172.1\|1737158_1738577_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_071867873.1\|1738581_1739748_-	nucleotide sugar dehydrogenase	M1HV26	Paramecium_bursaria_Chlorella_virus	1.9e-101	50.1
WP_010735170.1\|1739744_1740536_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	1.3e-05	29.6
WP_071867872.1\|1740580_1741846_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_071867871.1\|1741871_1742963_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_071867870.1\|1742959_1743586_-	sugar transferase	NA	NA	NA	NA
WP_071867869.1\|1743578_1744697_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_071867868.1\|1744698_1745328_-	acetyltransferase	NA	NA	NA	NA
WP_071867867.1\|1745338_1747156_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.4e-26	31.6
WP_071867866.1\|1747177_1747918_-	tyrosine protein phosphatase	NA	NA	NA	NA
WP_062805073.1\|1747935_1748613_-	CpsD/CapB family tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	5.4e-24	37.2
WP_010735161.1\|1748625_1749402_-	hypothetical protein	NA	NA	NA	NA
WP_010735160.1\|1749422_1750277_-	hypothetical protein	NA	NA	NA	NA
WP_023519871.1\|1750286_1750934_-	class D sortase	NA	NA	NA	NA
WP_065096446.1\|1750965_1751547_-	hypothetical protein	NA	NA	NA	NA
WP_071867865.1\|1751838_1752882_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.7e-59	39.6
WP_065096444.1\|1752878_1753349_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_065096443.1\|1753355_1753898_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_065096442.1\|1753881_1754604_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_071867864.1\|1754738_1755734_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.6e-16	26.5
WP_071867863.1\|1755763_1757248_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_071867862.1\|1757258_1758248_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	8.4e-50	35.8
WP_010735150.1\|1758495_1758663_+	DUF3042 family protein	NA	NA	NA	NA
WP_071867861.1\|1759036_1760839_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_010735146.1\|1761172_1761568_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_019723942.1\|1761582_1762548_-	ROK family glucokinase	NA	NA	NA	NA
WP_065096497.1\|1762550_1762760_-	YqgQ family protein	NA	NA	NA	NA
WP_065096498.1\|1762779_1763484_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_065096499.1\|1763502_1764054_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_065096500.1\|1764414_1764771_-	hypothetical protein	NA	NA	NA	NA
WP_086334752.1\|1766302_1766650_-	DUF3958 family protein	NA	NA	NA	NA
WP_086334828.1\|1766649_1766931_-	TIGR04197 family type VII secretion effector	NA	NA	NA	NA
WP_065095550.1\|1767153_1768158_-	iron ABC transporter permease	NA	NA	NA	NA
WP_065095551.1\|1768154_1769144_-	iron ABC transporter permease	NA	NA	NA	NA
WP_023519886.1\|1769143_1769944_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.2e-14	29.7
WP_023519887.1\|1770109_1771066_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010735133.1\|1771219_1771903_-	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	1.1e-05	26.7
WP_071868014.1\|1771880_1774505_-	sensor histidine kinase KdpD	NA	NA	NA	NA
WP_071868013.1\|1774532_1775054_-	potassium-transporting ATPase subunit C	NA	NA	NA	NA
WP_071868012.1\|1775090_1777121_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	4.0e-30	26.3
WP_071868011.1\|1777136_1778813_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_071868010.1\|1779128_1779620_-	dihydrofolate reductase	A0A0A0RMX1	Bacillus_phage	5.0e-19	36.4
WP_002356321.1\|1779702_1779852_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_010735127.1\|1780084_1780531_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_071868009.1\|1780661_1782557_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	2.3e-19	26.2
WP_071868008.1\|1783207_1783771_+	hypothetical protein	NA	NA	NA	NA
WP_071868007.1\|1784162_1784369_+	hypothetical protein	NA	NA	NA	NA
1784585:1784643	attL	NA	NA	NA	NA
WP_100917261.1\|1784762_1786025_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	1.0e-185	75.2
WP_100917262.1\|1786035_1786233_-\|holin	phage holin	A0A0S2MYF6	Enterococcus_phage	2.5e-22	82.8
WP_081367477.1\|1786236_1786455_-	hemolysin XhlA family protein	D2J075	Enterococcus_phage	1.1e-05	40.8
WP_071867986.1\|1786543_1787317_-	hypothetical protein	NA	NA	NA	NA
WP_071867987.1\|1787331_1789098_-\|plate	BppU family phage baseplate upper protein	Q9AZX4	Lactococcus_phage	8.3e-40	46.0
WP_071867988.1\|1789109_1791872_-\|tail	phage tail protein	D7RWE0	Brochothrix_phage	4.4e-56	64.1
WP_071868005.1\|1791868_1792573_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_071867989.1\|1792584_1794969_-\|tail	phage tail tape measure protein	A0A1G5SB90	Enterococcus_phage	4.1e-58	32.9
WP_071867990.1\|1795163_1795634_-	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	4.4e-17	42.5
WP_071867991.1\|1795633_1796284_-\|tail	phage tail protein	A0A1B0Y6C3	Lactobacillus_phage	1.3e-22	31.6
WP_071867992.1\|1796291_1796660_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_071867993.1\|1796649_1796988_-	hypothetical protein	A0A2H4JFJ3	uncultured_Caudovirales_phage	3.6e-21	45.9
WP_071867994.1\|1796977_1797304_-\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	2.2e-23	54.4
WP_071867995.1\|1797281_1797557_-\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	1.4e-23	67.5
WP_071867996.1\|1797556_1798132_-	hypothetical protein	NA	NA	NA	NA
WP_071867997.1\|1798088_1799477_-\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	9.1e-127	64.9
WP_071867998.1\|1799489_1800059_-\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	5.3e-65	69.2
WP_071867999.1\|1800030_1801260_-\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	1.9e-144	64.7
WP_071868000.1\|1801281_1803018_-\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	8.7e-260	72.8
WP_071868001.1\|1803014_1803467_-\|terminase	terminase small subunit	A0A2H4JFK0	uncultured_Caudovirales_phage	8.0e-48	68.5
WP_071868002.1\|1803578_1803959_-	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	1.8e-45	68.8
WP_071868003.1\|1803955_1804342_-	hypothetical protein	A0A1B1P7N8	Bacillus_phage	4.0e-08	32.0
WP_071868004.1\|1804622_1805105_+	hypothetical protein	NA	NA	NA	NA
WP_100917265.1\|1805340_1805820_-	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	1.6e-25	45.2
WP_071868099.1\|1806066_1806258_-	hypothetical protein	NA	NA	NA	NA
WP_071868098.1\|1806254_1806476_-	hypothetical protein	NA	NA	NA	NA
WP_157811374.1\|1806514_1806691_-	hypothetical protein	NA	NA	NA	NA
WP_081367484.1\|1806687_1806918_-	hypothetical protein	NA	NA	NA	NA
WP_071868097.1\|1806914_1807223_-	hypothetical protein	NA	NA	NA	NA
WP_100917266.1\|1807222_1807423_-	hypothetical protein	NA	NA	NA	NA
WP_100917267.1\|1807425_1807995_-	DUF1642 domain-containing protein	A8E2L2	Enterococcus_phage	1.4e-20	39.8
WP_081367427.1\|1808142_1808385_-	hypothetical protein	NA	NA	NA	NA
WP_071866785.1\|1808381_1808849_-	class I SAM-dependent methyltransferase	A0A097PAU8	Streptococcus_pyogenes_phage	1.0e-58	66.4
WP_071866786.1\|1808849_1809239_-	hypothetical protein	A0A1S5SD94	Streptococcus_phage	5.5e-13	40.5
WP_071866787.1\|1809235_1809430_-	hypothetical protein	NA	NA	NA	NA
WP_071866788.1\|1809442_1809664_-	phosphocarrier protein HPr domain protein	NA	NA	NA	NA
WP_071866789.1\|1809667_1809856_-	hypothetical protein	NA	NA	NA	NA
WP_071866790.1\|1809870_1810290_-	single-stranded DNA-binding protein	A0A097PAQ3	Streptococcus_pyogenes_phage	3.3e-40	59.7
WP_071866791.1\|1810292_1810829_-	hypothetical protein	NA	NA	NA	NA
WP_071866792.1\|1810841_1811294_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.4e-31	54.5
WP_071866793.1\|1811290_1811608_-	hypothetical protein	NA	NA	NA	NA
WP_081367428.1\|1811604_1812840_-	DnaB-like helicase C-terminal domain-containing protein	A8YQM1	Lactobacillus_phage	2.4e-46	31.7
WP_071866794.1\|1812836_1813613_-	conserved phage C-terminal domain-containing protein	A0A2H4J2N5	uncultured_Caudovirales_phage	6.2e-40	58.0
WP_071866795.1\|1813634_1814333_-	hypothetical protein	A0A1J0MFS2	Staphylococcus_phage	3.0e-33	40.5
WP_071866796.1\|1814335_1815295_-	DUF1351 domain-containing protein	A5GZ46	Lactococcus_phage	2.9e-15	24.4
WP_071866797.1\|1815294_1815945_-	ERF family protein	Q6JM07	Lactococcus_phage	5.2e-40	61.9
WP_071866798.1\|1815955_1816180_-	hypothetical protein	D2IZX4	Enterococcus_phage	4.1e-13	50.7
WP_071866799.1\|1816176_1816512_-	hypothetical protein	NA	NA	NA	NA
WP_169823218.1\|1816553_1816730_-	hypothetical protein	NA	NA	NA	NA
WP_071866800.1\|1816743_1817010_-	hypothetical protein	NA	NA	NA	NA
WP_071866801.1\|1817020_1817212_-	hypothetical protein	NA	NA	NA	NA
WP_071866802.1\|1817609_1817939_+	helix-turn-helix transcriptional regulator	A0A097QQ00	Enterococcus_phage	1.9e-19	45.0
WP_071866803.1\|1817958_1818390_+	ImmA/IrrE family metallo-endopeptidase	D2IZV8	Enterococcus_phage	7.2e-14	34.7
WP_071866804.1\|1818386_1818587_+	hypothetical protein	A0A097BY73	Enterococcus_phage	1.9e-25	86.4
WP_071866805.1\|1818673_1819270_+	hypothetical protein	NA	NA	NA	NA
WP_071866806.1\|1819414_1820575_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	4.3e-61	37.2
WP_023519894.1\|1821078_1821645_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1820671:1820729	attR	NA	NA	NA	NA
WP_071866807.1\|1821898_1823233_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_176285314.1\|1823201_1823537_+	hypothetical protein	NA	NA	NA	NA
WP_010735121.1\|1823741_1824338_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	1.8e-31	39.1
WP_177187683.1\|1824439_1826239_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	7.9e-14	27.9
WP_010735118.1\|1826838_1826988_+	hypothetical protein	NA	NA	NA	NA
WP_071866810.1\|1827131_1827521_-\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	1.8e-19	38.3
WP_071866811.1\|1827837_1828200_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	1.5e-17	37.8
WP_019722947.1\|1828206_1828635_+	ImmA/IrrE family metallo-endopeptidase	I3VYZ2	Thermoanaerobacterium_phage	6.9e-09	32.1
WP_081367429.1\|1829151_1831329_+	C40 family peptidase	B5LJD6	Mycobacterium_phage	4.3e-14	38.9
WP_081367433.1\|1831476_1831890_+	nucleoside deaminase	S4VYT2	Pandoravirus	6.7e-09	40.8
WP_019722950.1\|1832183_1832381_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.0e-23	76.9
WP_071868102.1\|1832594_1832987_-	hypothetical protein	NA	NA	NA	NA
WP_071868101.1\|1833192_1833651_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_019722950.1\|1834003_1834201_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.0e-23	76.9

DBSCAN-SWA_7

2173094 : 2223418

Staphylococcus_phage(18.18%)

transposase,integrase,protease,holin

attL 2180274:2180290|attR 2211326:2211342

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157811375.1\|2173094_2173940_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.8e-37	60.3
WP_071867291.1\|2174015_2176259_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.4e-140	34.9
WP_010734798.1\|2176508_2177165_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_071867290.1\|2177380_2179321_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.7e-60	32.1
WP_071867289.1\|2179393_2179717_-	L-rhamnose mutarotase	NA	NA	NA	NA
WP_071867288.1\|2180118_2181189_-	hypothetical protein	NA	NA	NA	NA
2180274:2180290	attL	NA	NA	NA	NA
WP_071867287.1\|2181546_2182677_-	ABC transporter permease	NA	NA	NA	NA
WP_071867286.1\|2182676_2183777_-	ABC transporter permease	NA	NA	NA	NA
WP_071867285.1\|2183788_2184724_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.2e-25	32.5
WP_071867284.1\|2184788_2185919_-	hypothetical protein	NA	NA	NA	NA
WP_071867283.1\|2185919_2186552_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.7e-08	31.1
WP_071867282.1\|2186946_2189805_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_100917299.1\|2190614_2190701_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_100917271.1\|2190975_2191158_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_071868080.1\|2191464_2191611_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_081367480.1\|2191827_2192040_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071868082.1\|2192102_2192450_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_071868083.1\|2192945_2195234_-	hypothetical protein	NA	NA	NA	NA
WP_071868084.1\|2195223_2196285_-	SIR2 family protein	NA	NA	NA	NA
WP_071868085.1\|2196433_2197600_-\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	1.1e-29	28.8
WP_071868086.1\|2197608_2197818_-	DUF3173 family protein	NA	NA	NA	NA
WP_100917272.1\|2197886_2198297_-	hypothetical protein	NA	NA	NA	NA
WP_100917273.1\|2198336_2198843_-	hypothetical protein	NA	NA	NA	NA
WP_100917274.1\|2198955_2200086_-	glucosaminidase domain-containing protein	E9LUJ4	Lactobacillus_phage	5.8e-39	55.3
WP_081367465.1\|2200075_2202178_-	hypothetical protein	NA	NA	NA	NA
WP_071867879.1\|2202189_2204709_-	ATP-binding protein	NA	NA	NA	NA
WP_071867880.1\|2204777_2205167_-	conjugal transfer protein	NA	NA	NA	NA
WP_016631968.1\|2205168_2205387_-	hypothetical protein	NA	NA	NA	NA
WP_071867881.1\|2205390_2206416_-	conjugal transfer protein	NA	NA	NA	NA
WP_071867882.1\|2206582_2207020_-	hypothetical protein	NA	NA	NA	NA
WP_071867883.1\|2207055_2207670_-	Phi-29-like late activator	A0A1W6JN36	Lactococcus_phage	8.7e-21	68.9
WP_071867884.1\|2207693_2208977_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	8.9e-44	31.0
WP_071867885.1\|2209244_2209676_-	hypothetical protein	NA	NA	NA	NA
WP_071867907.1\|2210253_2211702_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.8e-61	34.8
2211326:2211342	attR	NA	NA	NA	NA
WP_071867887.1\|2211771_2212320_-	hypothetical protein	NA	NA	NA	NA
WP_071867888.1\|2212331_2213069_-	class A sortase	NA	NA	NA	NA
WP_071867889.1\|2213122_2214706_-	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_100917300.1\|2214865_2215354_-	C39 family peptidase	NA	NA	NA	NA
WP_081367467.1\|2216222_2216633_+	hypothetical protein	NA	NA	NA	NA
WP_071867891.1\|2216646_2216841_-	hypothetical protein	NA	NA	NA	NA
WP_071867892.1\|2216876_2217284_-	DUF961 family protein	NA	NA	NA	NA
WP_071867893.1\|2217283_2217610_-	hypothetical protein	NA	NA	NA	NA
WP_071867894.1\|2218833_2219211_+	helix-turn-helix domain-containing protein	A0A139ZPI6	Marinitoga_camini_virus	1.5e-10	53.7
WP_071867895.1\|2219239_2219701_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_100917275.1\|2220005_2221580_-	hypothetical protein	NA	NA	NA	NA
WP_071867897.1\|2221888_2223418_-\|protease	ATP-dependent Clp protease ATP-binding subunit	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018062

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018061

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection