CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP017999	Rhizobium sp. Y9 chromosome 1, complete sequence	0 crisprs	WYL,csa3,cas3,DEDDh	3
NZ_CP018000	Rhizobium sp. Y9 chromosome 2, complete sequence	1 crisprs	csa3,DEDDh	0
NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	0 crisprs	csa3,WYL	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

624527 : 631902

Geobacillus_phage(33.33%)

tail,portal,capsid,protease,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004440739.1\|624527_625694_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	4.6e-63	38.7
WP_003509186.1\|625881_626202_+	hypothetical protein	NA	NA	NA	NA
WP_004440741.1\|626230_626821_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.4e-28	44.1
WP_004440743.1\|626852_628121_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	6.7e-76	42.1
WP_004440746.1\|628291_628861_+	hypothetical protein	NA	NA	NA	NA
WP_004440748.1\|628864_629206_+\|head	phage head closure protein	NA	NA	NA	NA
WP_004440751.1\|629202_629598_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_081859385.1\|629604_630714_-	MFS transporter	NA	NA	NA	NA
WP_004440755.1\|630893_631301_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_004440758.1\|631300_631660_+	gene transfer agent family protein	NA	NA	NA	NA
WP_072494180.1\|631656_631902_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA

DBSCAN-SWA_2

1281132 : 1289389

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004442081.1\|1281132_1282665_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	4.8e-20	24.4
WP_081859541.1\|1282744_1283926_+	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_034498956.1\|1283926_1285084_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	9.9e-42	42.7
WP_004442089.1\|1285275_1286406_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.1e-105	53.0
WP_004442091.1\|1286405_1287488_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_004442093.1\|1287750_1288260_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	6.5e-46	58.8
WP_004442095.1\|1288296_1288866_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-47	53.8
WP_004442098.1\|1288894_1289389_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.9e-26	37.7

DBSCAN-SWA_3

1305766 : 1314169

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082055473.1\|1305766_1307377_-	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	I3PV24	Clostridium_phage	1.1e-11	30.4
WP_080822813.1\|1307677_1308319_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.0e-11	35.1
WP_004442133.1\|1308327_1309098_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-23	29.8
WP_004442134.1\|1309271_1310555_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.8
WP_022556270.1\|1310656_1311460_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.4e-42	40.7
WP_004442140.1\|1311456_1312203_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003509722.1\|1312259_1312466_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.1e-08	69.8
WP_004442146.1\|1312596_1313331_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-40	47.1
WP_034498970.1\|1313323_1314169_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.5e-34	34.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018000

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018000_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018000_1

1661819-1661940

Orphan

Consensus_repeat	Method
TCGCTGTACGACTTGCTTTCATAGCTCCAGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018000_1

>merge|NZ_CP018000|1|1661819-1661940|CRISPRCasFinder
TCGCTGTACGACTTGCTTTCATAGCTCCAGTCGTAATCGGTCTTGATGTCGGTGTTGGTTTCGGTGCTCGTCTTGGTGGTCGTGTCGTTATCGCTGTACGACTTGCTGTCATAGCTCCAGTC

>NZ_CP018000|1|1|1661819-1661940|CRISPRCasFinder
TCGCTGTACGACTTGCTTTCATAGCTCCAGTC	GTAATCGGTCTTGATGTCGGTGTTGGTTTCGGTGCTCGTCTTGGTGGTCGTGTCGTTA
TCGCTGTACGACTTGCTGTCATAGCTCCAGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018000.1\|WP_044459837.1\|1663086_1663857_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP018000.1\|WP_004438583.1\|1651414_1652095_+\|exopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|274395
NZ_CP018000.1\|WP_004438580.1\|1650247_1650796_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|182158
NZ_CP018000.1\|WP_044459945.1\|1671676_1672630_+\|cellulose-biosynthesis-protein-BcsN	unknown	unknown	gnl\|CDD\|374958
NZ_CP018000.1\|WP_100911401.1\|1656755_1658969_-\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|226969
NZ_CP018000.1\|WP_004438628.1\|1668589_1669093_+\|DUF995-domain-containing-protein	unknown	unknown	gnl\|CDD\|336337
NZ_CP018000.1\|WP_044459834.1\|1654808_1655303_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018000.1\|WP_044459841.1\|1669106_1670069_+\|glycosyl-hydrolase-family-5	unknown	unknown	gnl\|CDD\|226609
NZ_CP018000.1\|WP_044459831.1\|1647629_1648556_+\|homocysteine-S-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224951
NZ_CP018000.1\|WP_044459842.1\|1670121_1671303_-\|AGE-family-epimerase/isomerase	unknown	unknown	gnl\|CDD\|225493
NZ_CP018000.1\|WP_006698572.1\|1665663_1666647_+\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|224012
NZ_CP018000.1\|WP_022563664.1\|1672697_1674887_+\|UDP-forming-cellulose-synthase-catalytic-subunit	unknown	unknown	gnl\|CDD\|274400
NZ_CP018000.1\|WP_044459839.1\|1664639_1665662_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187541
NZ_CP018000.1\|WP_004438597.1\|1655388_1656747_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP018000.1\|WP_035211045.1\|1648766_1650101_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|181707
NZ_CP018000.1\|WP_044459840.1\|1666643_1668575_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133043
NZ_CP018000.1\|WP_044459832.1\|1652279_1653536_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224512
NZ_CP018000.1\|WP_044459833.1\|1653543_1654812_+\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|225844
NZ_CP018000.1\|WP_044459836.1\|1659037_1661059_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018000.1\|WP_044459838.1\|1663899_1664247_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP018000.1\|WP_044459837.1\|1663086_1663857_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	9.63465e-40
NZ_CP018000.1\|WP_004438583.1\|1651414_1652095_+\|exopolysaccharide-biosynthesis-protein	gnl\|CDD\|274395	TIGR03022, WbaP_sugtrans, Undecaprenyl-phosphate galactose phosphotransferase, WbaP. The WbaP (formerly RfbP) protein has been characterized as the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. This model includes the enterobacterial enzymes, where the function is presumed to be identical to the S. typhimurium enzyme as well as a somewhat broader group which are likely to catalyze the same or highly similar reactions based on a phylogenetic tree-building analysis of the broader sugar transferase family. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. The most likely heterogeneity would be in the precise nature of the sugar molecule transferred.	7.19492e-98
NZ_CP018000.1\|WP_004438580.1\|1650247_1650796_+\|cupin-domain-containing-protein	gnl\|CDD\|182158	PRK09943, PRK09943, HTH-type transcriptional regulator PuuR.	2.14578e-37
NZ_CP018000.1\|WP_044459945.1\|1671676_1672630_+\|cellulose-biosynthesis-protein-BcsN	gnl\|CDD\|374958	pfam17038, CBP_BcsN, Cellulose biosynthesis protein BcsN. This is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).	1.02586e-86
NZ_CP018000.1\|WP_100911401.1\|1656755_1658969_-\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|226969	COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].	0
NZ_CP018000.1\|WP_004438628.1\|1668589_1669093_+\|DUF995-domain-containing-protein	gnl\|CDD\|336337	pfam06191, DUF995, Protein of unknown function (DUF995). Family of uncharacterized Proteobacteria proteins.	5.08222e-67
NZ_CP018000.1\|WP_044459841.1\|1669106_1670069_+\|glycosyl-hydrolase-family-5	gnl\|CDD\|226609	COG4124, ManB, Beta-mannanase [Carbohydrate transport and metabolism].	4.44567e-132
NZ_CP018000.1\|WP_044459831.1\|1647629_1648556_+\|homocysteine-S-methyltransferase-family-protein	gnl\|CDD\|224951	COG2040, MHT1, Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism].	1.20895e-98
NZ_CP018000.1\|WP_044459842.1\|1670121_1671303_-\|AGE-family-epimerase/isomerase	gnl\|CDD\|225493	COG2942, COG2942, N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism].	1.39646e-157
NZ_CP018000.1\|WP_006698572.1\|1665663_1666647_+\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|224012	COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP018000.1\|WP_022563664.1\|1672697_1674887_+\|UDP-forming-cellulose-synthase-catalytic-subunit	gnl\|CDD\|274400	TIGR03030, Cellulose_synthase_UDP-forming, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.	0
NZ_CP018000.1\|WP_044459839.1\|1664639_1665662_+\|SDR-family-oxidoreductase	gnl\|CDD\|187541	cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs. UGD catalyzes the formation of UDP-xylose from UDP-glucuronate; it is an extended-SDR, and has the characteristic glycine-rich NAD-binding pattern, TGXXGXXG, and active site tetrad. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP018000.1\|WP_004438597.1\|1655388_1656747_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	6.76091e-132
NZ_CP018000.1\|WP_044459833.1\|1653543_1654812_+\|O-antigen-ligase-family-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	9.1689e-46
NZ_CP018000.1\|WP_044459840.1\|1666643_1668575_+\|glycosyltransferase	gnl\|CDD\|133043	cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.	1.41647e-69
NZ_CP018000.1\|WP_044459832.1\|1652279_1653536_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224512	COG1596, Wza, Periplasmic protein involved in polysaccharide export, contains SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis].	9.62614e-36
NZ_CP018000.1\|WP_035211045.1\|1648766_1650101_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|181707	PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional.	0

>NZ_CP018000.1|WP_044459836.1|1659037_1661059_-|hypothetical-protein
MHIDKISDMIAHFIGLFDTMAEEARLRNNYSEGPARSGPEQLPEEEAARLLDKDYDVALQDYDPGVKYHAGYYDFDYLPPHFARTVEHDMQQFANSIPVDISGANFRFPGRLSFEDERELVIHTGPGSVVAHVAQVNILQDDDYLNMTDGPNVARDTSFVTERTVEFYNEASVFTPFSGFQRTDSYDALQALAKTAHDYIEHARDNDVTSLGTGADEDFVLAGNDINGLYINGVAAAEKPALDDYMPDRGIAKPPEEPERSDVALHEESPAGNSLDVAAGANVVANVATLVNTAVMTSVTAVMGDYHQIDAITQAYIYSDRDEIASVFTRSEDQADTAAYNIANFERSVFPGAENTAAESPETGEMPIFPTAWRVSVLEGDVSFVHWIEQYEFVSDNDTMTITTSGASVSLLTGGNAALNIANFLGIGMQYDLIIVGGDVLDMNLISQIAVLYDNDWARANPDAPGGATIQSGNNLLWNDASIYNVGSNDRFETMPDYMAQTVSAINQRDPNMPDALAHDVNFAGYQGLNVLYITGNLYDVSIIKQVSVLGDSDDVTQAAAKVLENNENADVNIDTGSNAVINLAQIIDYDSFGSTTYVAGGVYSDAILIQGGIIENDTSQPAQPGQLANEVIAFLHDDPATIENESDGVINAGHDLSWSDAHSSDVMQAVTA
>NZ_CP018000.1|WP_100911401.1|1656755_1658969_-|type-I-secretion-system-permease/ATPase
MDHISRRTIADGRSLDLPLDQDAEDSKLTDACISAINEAVENLRQLSGAEQIARATPSSPEVAPPPSPTTPQSSMLRDKPSGNPAPQQEPHPASQPTPKAKIDNAELKSAPDLPFVKTIDNNDGPIRENERRPATGGGGDGKEPTGNGGGGGGGGGGSSQSGFHKRSEPINFAASLAKGIAAVRRNMIVVMLFTVAINVLLLAIPLYLFQISDRVLTSRSMDTLVMLTVAVLGAVLLQAFMDAIRRFILMRTAVELEVQLGAPILSAAARASLHGSGKDYQILQDLQQLRSFLTSGTLIAFLDAPLMPLFIVVVYLVHPHLGIIIMVCCAVLFTIAWLNQRFTARQFSEASGYLSRANFHLDSMSRNSQIINALAMIPEAVKMWGRDTAGSLKSHVAAQDRNIMFSGVSKAARMITQVALLGWGAHLSLSGELTGGMVIAASIVSGRALAPIEGAIEGWHQFNKSAASYGRIKQLLISSPLNFPRLRLPNPEGRLDVERILFVPPPQKKVILNGISFSLKKGESLAIIGNSGSGKTTLGKMLVGSILPTSGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDIEDRQIYEAAVLADVHELIAGFPQGYETVVAADGAPLSGGQKQRIALARAFFGDPKFVVLDEPNSNLDTQGEQALAKALLHAKRQGITTVTITQRPALLQCVDKIMVLKDGSVAMFGERMDVLKALSGNGRQASQSPQIEG
>NZ_CP018000.1|WP_004438597.1|1655388_1656747_-|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MFRKKNAIAEVKPQGQLEWYSEVPRSIRLHSSIGLAVLLASFGGFGYWAGTAPLSSAIIAQGSFVATGNNKVVQHLEGGIIKEMMVSEGDTVKVGDVLLTLDKTTALANERMLQLRRLRLETIVTRLRAEAQGAKSFKVPDIVMKEAGDPDINAIIQSQNIVFHSKLIKLEEQLNLIEKNIRSLEFRYAGYDGQKQSFDRQLALLTQERDSKERLAKDGVIRKTDMLALERAIADAMGDIARLSGEMNQSEAEIAKFKQEAIIAVNANKQAALDALETAESDLDSVREQVRGAAEVLERTVIRSPVNGTVVRAYYHTPGGVITTGKPIMEILPAHVPLILEAQVLRTSIDQLHEGQTAAIRLSALNRRTTPVLNGKVFYVSADSIEENAGLQVKDVYIVRVQVPDEEIAKVHNFRPVPGMPADVLIQTSERTFFEYLTKPIADSMSRAFKER
>NZ_CP018000.1|WP_044459834.1|1654808_1655303_-|hypothetical-protein
MAAMSDVLLLVGRLNYVWTNTESLMIYLIVHLLKVDKEAAIVVFLTLNTTRARMDLIERLAKLPSTDAKDRKTVLSIMARLKREAKTRNKYNHCIYSFDEKGDIASTQLMRLVEDDSQVRYGKVECMDEKEIGQLEKSIADIVEVSKDMWSFIHASPHVSADYL
>NZ_CP018000.1|WP_044459833.1|1653543_1654812_+|O-antigen-ligase-family-protein
MRIAKSALIDPERNEIYGMTAVALSFFVFAYSSRFGQISVLAYYGMWLPLVVVDYRRVLGNYPRYLWIFGFGILTVLSSFWSEAVSVTMRASIQYMTHIVCALVAMRVISIRTLTRGALIGIGVVLLYSLLFGIYLFDALDGTYSFVGAFSSKNQLGFYASLGVIFAASSVLVLKQRGIWLPIAGVTGLLSAYSLVASQSATSAITTAAVVALIIGFIPIGMLSPANRKMMFFALAGLGALLAVASLQFGLLDAILGIFGKDSTLTGRTYLWQQGIEAAKQAPILGVGYQGFWVAGFADAERLWNDFFITGRSGFHFHNTYIETVVENGFVGMILLGMVLYGTLLGHLRSVLMRRSDPQGVILFAICALFVVRSFVEIDIIFPYQIGSFLLYFAAGKLCLPVKAARNGETHPAIGMRLQTRP
>NZ_CP018000.1|WP_044459832.1|1652279_1653536_+|sugar-ABC-transporter-substrate-binding-protein
MNGFSAAHRPFVALVLAATVAFSAPLSAMAADGAQYKLGTADKLRIRVAEWQPADGSIRNWDVINGDYSVGPSGTLSLPFIGQLDVAGKTPSEVSDQIGAQLQSKFALRNLPSASVEIAQFRPIFLSGDVQTPGEYPYAPNITVLKAISLAGGLRRSDAGQRFARDFINARGDAAVYDNQRARLLARQARLIAEVKGDQTITKTPEMEKIAEIDTLLASESALMKSRTERYTLQLKALTDLHALLQSEVESLKKKSETQNRQLQLANEDRDRVNRLNEQGLALSQRRISAEERAAEVESTLLDIDTQSLRAKQDINKATQDEINLRNDWVAQRSKELQDTEAELDKLNLQLTTSRELMSEALAQSAEAIRFDPSGKSATISYVVVREENGKPKELKVDENALLQPGDVIKVSSEILMQ
>NZ_CP018000.1|WP_004438583.1|1651414_1652095_+|exopolysaccharide-biosynthesis-protein
MKSATQSAEQTLSSSEDFDVSFPIGGIAKRSFDMTSAALALLIFSPIFLLIAVLVKMSDPGPIFYGHRRVGHNGRYFHCLKFRTMAMNGDEILRQYLAANPEAAEEWRATRKLKNDPRVTAVGAVLRKLSLDELPQLINILRGEMSVVGPRPVVDEELSYYESAAAYYLSTRPGLTGLWQISGRNDVSYKTRVAFDTQYVQNWSMRQDVFIIVKTIPAVCLSRGSY
>NZ_CP018000.1|WP_004438580.1|1650247_1650796_+|cupin-domain-containing-protein
MSVDIGGRLRHLRLRHNISQRELARRAGVTNSTISLIESNTSNPSVGALKRILDGIPIGLAEFFAFEPETSRKAFYRADELVEIGKGPISFRQVGENVFGRSLQILKECYQPGADTGKVPLVHDGEEGGIILSGRLEVTVDEERRVLGPGDAYYFESRRPHRFRCVGPVACEVISACTPPTF
>NZ_CP018000.1|WP_035211045.1|1648766_1650101_-|aspartate-aminotransferase-family-protein
MDNPSRSNSTSLDSYWMPFTANRQFKANPRLLASAEGMYYTSNDGRQVLDGTAGLWCVNAGHGRQQIASAVKHQLSTMDYAPSFQMGHPVAFEFAERLAEIAPGPEGGKLDRVFYTGSGSESVDTALKIAIAYQRAIGQGTRSRLIGRERGYHGVGFGGISVGGLVNNRRVFPQIPADHLRHTHDLAKNSFVKGQPEHGAELADDLERLVALHGAETIAACIVEPVAGSTGVLVPPKGYLERLRAICDKYGILLIFDEVITGFGRMGSSFASNYFGVTPDIVTTAKGLTNGAIPMGAVFTSRKVHDALMHGPESQIELFHGYTYSGHPVACAAGIATLDIYRDEGLFTRASELQDAWHDAIHSLKGSPNVIDIRTIGFIAGIELQPRDGAIGARAYDVFVDCFERGLLIRVTGDIIALSPPLIAEKSHFDDIVSILGDALKRAE
>NZ_CP018000.1|WP_044459831.1|1647629_1648556_+|homocysteine-S-methyltransferase-family-protein
MSDIRILDGGMSRELQRLGAELKQPEWSALALINAPDIVRQVHAEFIEAGADVVTTNSYALVPFHIGEDRFNKEGASLIALSGRLAREAAEASKRNVAVAGSLPPIFGSYEPENFDPSRVQDYLKVLVENLQPHVDVWLGETLSLVAEGEAVRQAVAETGKPFWISFTLNDEPAQVNGAEPKLRSGETVRSAAEWAAGSGATALLFNCSKPEVMRAAVETAAAVFKEKGVALDIGVYANAFEGEQGDSAANEGLHGTRADLTDDVYSRFACSWADAGATLIGGCCGIGAAHIHTVADTLRRRGAGRTI
>NZ_CP018000.1|WP_044459837.1|1663086_1663857_+|response-regulator-transcription-factor
MFMGTSDYAAKQKNAVTHINGTLLIVADPDLFSECLMEALGKKFPTFSVVSVTSSATIDDDYGADVRLVLPYRLAGERLHSVLSAIREKHPEAPIALVVETIDKIEEPLKRLVGMRIIDGVLPLNLRLDVFMAAVDLLMKGGEHFPAALLGKLTPYSAAAGGKSVQNSAVIANRADALAESRSDMATLTTREVQILDLLCKGTQNKIIADRLHLSENTVKVHVRNIYKKMNVRNRTEAASRFFNKDEGATFSDWKN
>NZ_CP018000.1|WP_044459838.1|1663899_1664247_-|hypothetical-protein
MMNEMPYFRGGKTVRQCRLALVAGALLTFTFATASCSVVEDAVLTNASASPATIKSRVTPAKAAYGYQKTGNAAVTLVADASDTPTVSRPSYSGSSPYICSPSGFGQKSRCFLRP
>NZ_CP018000.1|WP_044459839.1|1664639_1665662_+|SDR-family-oxidoreductase
MRNFVPNEHDNGVTIYSDWKPGQRVLVNGGAGFLGSHLCERLLSSGHEVICLDDLSTGRTANVEHLRNNKRFLMVEHDVRKPYDIDVSLIFNFASPASPPDYQRDPVGTLLTNVLGAVNVLEVARRCGATVVQSSTSEVYGDPHVNPQPETYFGNVNTIGPRACYDEGKRSAETLFFDYHRTFGVDIKVGRIFNTYGPRMRPDDGRVVSNFIVQALKGDDITIYGDGSQTRSFCYVDDLIDGFLCFSAKPKDCTGPINLGNPAEIPVRQLADIVIRMTGSRSRIVHLPAAIDDPQQRRPDISRANELLKWQPRVPLEIGLERTIVYFDALLAGRKVAEAV
>NZ_CP018000.1|WP_006698572.1|1665663_1666647_+|UDP-glucose-4-epimerase-GalE
MPRTILVTGGAGFIGSHICKALAQSGFKPIAYDNLSTGHADSVRWGPFIEGDILDRGLLKATLQEFSPAFVIHCAANAYVGESVEDPRKYYRNNVGGSLSLLDACLDQNIGGLVFSSSCATYGVPPQLPIREETAQTPVNPYGRTKLIFEMALDDYAAAYGLRFVALRYFNAAGADPDGELCERHEPETHLIPRALMAAAARLPQLDVFGADYDTSDGTCIRDYIHVSDLADAHVAAVNYLADGGETLRVNLGSGHGTSVGDIIRAIHRVTGQEVPVHFGARRAGDPPALFADIERARQTLGFAPRRSDIDTIIRTAGPGFGLEVLS
>NZ_CP018000.1|WP_044459840.1|1666643_1668575_+|glycosyltransferase
MTMRSTPSVASPRAAAGVLRMLPIFTGWNRLAYLLGIGGWLVTLAYFWIWWLDRDRVIDWPYYSVVTLALAWITLLPSYFIFIFLNARVVDRRSPLPRGRVAMVVTKAPSEPFAVVEKTLLAMLEQKGLEFDVWLADEAPDAETLKWCGAHGVFVSTRQGIAEYHRKTWPRRTRCKEGNLAYFYDRYGYERYDFVAQFDADHVPEPDYLSEVIRPFADPRIGYVSAPSICDANANESWAARGRLYAEASLHGALQLGYNNGWAPLCIGSHYAVRTKALREVGGLGPELAEDHSTTLLMNAGGWRGVHAVNAIAHGDGPVTFADLIVQEFQWSRSLMTILLQYSRHYVPKLPARLKFQFLFSQLWYPLFSGFMALMFVLPAVALVRGHVLVNASYPAFLAHFLPVSLIMIVFAFFWRATGAFRPHDAKLFSWEAMVFLFLRWPWSLMGVLAAIRDTIRGDFVDFRITPKGTQAKPPLPLRVVAPYMVLAALSLLAMVLAPRQNGAEGFFIFAAINVAIYAGLSVFLLIRHAGENGLPKLPALRGDASAAACSLLLVAGSAAELSSHAIGGLEALSHGQPYVSFTETRFTVAGAGAEGARSVRLKLRIALPGLRGPEEMQAEPIVAPPPAVATGEIMLADNRVGQ
>NZ_CP018000.1|WP_004438628.1|1668589_1669093_+|DUF995-domain-containing-protein
MKTTISTCGFSAFVLCLAVVAPSVVHAAGGTKTPKPLRTSEVVEMYFDKTWKWDTGGGRFIADGRKFIAATEEKGKKSIGEGRWTVDANGTLCMRATWKAEAGSGKADTCFDHGRIGNVLYQRKQGGQWYVFRHNPPRPGDEFLKLVRKDDVTPQIAAYDKAMTATR
>NZ_CP018000.1|WP_044459841.1|1669106_1670069_+|glycosyl-hydrolase-family-5
MQITRRTLLFASGAAAAFTAGMYPVLKLDAQGVAPMTSTGMKTLADKRPTLHADGIRFGAYDPHGDFTGQSGVATEHLFLPWEDVDLDSLALADAYALERKRNVMITVEPWSWDVNWRLSSDELRRKVLSGDYDKNMQAIAARMSAMKSPLILRWGQEMEDTTGRFSWSGWNPRDYITAYKRVVDMTRKAVPGVKVMWSPKGLQGLRAYYPGDNYADLVGLSVFGLEDYDKIEYGAPKTFTDLLRKGYGLVETFDKPVWVAELGYEGSDSYVRPWMNDVTLKQADFPKLEEVVYFNDKDVHAWPHNLGRPDWRVVRPAKV
>NZ_CP018000.1|WP_044459842.1|1670121_1671303_-|AGE-family-epimerase/isomerase
MTVQFPSIAQTLAEEIGTLRKWLDEDALPLWWEAGSARPDGGFYERLAQDAKPVFSDDRRARVQPRQAYCYAAAGQHGWHGPWKDAVLHGLSWFEKVYRLENGLYGNLADQTGKLIDPSFDLYNQAFALFAAAQTAAILPERRNEMRSRALEILAILERDYRHPIAGFEEANPPRTPLCSNPHMHLFEAMLAWEEQDRDGPWSALADEIAGLALSRFIDDGNGGLREFFAHDWTPYEGEKGRIMEPGHQFEWAWLLVRWGSLRGNEEAIRKAKRLFEIGEDHGICPRRKVAVMSLYDDFSLRDGLARLWPQTEWLKAAVRLASVTDGEERQRYLASGLSAVGALQPFLDTPVKGLWFDKWPADRPMLDEPAPASTFYHIVCAIYEAEAVLAAG
>NZ_CP018000.1|WP_044459945.1|1671676_1672630_+|cellulose-biosynthesis-protein-BcsN
MAVLSGCNTPAGVRSFGGTQLLSPSEALIFPPPGGPEIVTVVSRTYSNAVAQQVILRSEAATPGQNYLKAEFFGPQQAGDTDLDSLAFTGFRASSLAREIRAEFPGETIAMSANYLQNSYGAFSYAAGKGRGEDTCLYGWQDIRSPESMRQDFRNLGRIKVRLRLCQSGASIERLLAVMYNYTITGTYASPSWNPYGTPQAVDKNLGRPGNPVYPIKSEEVPMRPGGEVTASVPVRPVRRTAATAPVQPEQQPLPPVAAVNIPSPVSAGASGQPAVTAPRAAGGGAVTGQQQSSRVPQVSIPSPSCLSGSGAGQGCR
>NZ_CP018000.1|WP_022563664.1|1672697_1674887_+|UDP-forming-cellulose-synthase-catalytic-subunit
MNKAITIIVWLLVSLCVLAIITMPVSLQTHLVATAISLILLATIKGFNGQGVWRLVALGFGTAIVLRYVYWRTTSTLPPVNQLENFIPGFLLYLAEMYSVVMLALSLVIVSMPLPSRKTRPGSPTYRPTVDVFVPSYNEDAELLANTLAAAKNMDYPADRFTVWLLDDGGSVQKRNAANIVEAQAAQRRHEELKKLCEDLDVRYLTRERNVHAKAGNLNNGLAHSTGELVTVFDADHAPARDFLLETVGYFEEDPRLFLVQTPHFFVNPDPIERNLRTFETMPSENEMFYGIIQRGLDKWNGAFFCGSAAVLRREALQDTEGFSGVSITEDCETALALHSRGWNSIYVDKPLIAGLQPATFASFIGQRSRWAQGMMQILIFRQPLFKRGLTFTQRLCYMSSTLFWLFPFPRTIFLFAPLFYLFFDLQIFVASGGEFLAYTAAYMLVNLMMQNYLYGSFRWPWISELYEYVQTVHLLPAVVSVIFNPGKPTFKVTAKDESIAEARLSEISRPFFVIFGLLVVAMIFAVWRIYSEPYKADVTLVVGGWNLLNLIFAGCALGVVSERGDKSASRRITVKRRCEVKLEGSDTWVPASIDNVSVHGLLINLFDNATTVQKGETAIVRVKPHSEGVPETMPLNIVRTVRGEGFISIGCTFSPQRAVDHRLIADLIFANSEQWSEFQRVRRRNPGLIRGTATFLAISLFQTQRGLFYLARALRPGSKAVKPAGAVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP018001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

23446 : 52406

Leptospira_phage(28.57%)

integrase,transposase

attL 25688:25702|attR 35026:35040

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082055532.1\|23446_24487_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_044460332.1\|24785_25952_+	DUF1612 and helix-turn-helix domain-containing protein	NA	NA	NA	NA
25688:25702	attL	NA	NA	NA	NA
WP_152625462.1\|26283_28740_+	hypothetical protein	NA	NA	NA	NA
WP_157814270.1\|28997_29348_+\|transposase	transposase	NA	NA	NA	NA
WP_100911634.1\|29546_30776_+\|integrase	tyrosine-type recombinase/integrase	A7XX23	Thermus_virus	3.6e-10	27.4
WP_100911635.1\|30769_31684_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_100911636.1\|31680_32670_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	6.1e-08	29.3
WP_157814271.1\|32818_33082_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_100911638.1\|33156_34746_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.1e-70	33.6
WP_100911796.1\|35496_36942_+	hypothetical protein	NA	NA	NA	NA
35026:35040	attR	NA	NA	NA	NA
WP_100911639.1\|36964_37444_+	TIR domain-containing protein	NA	NA	NA	NA
WP_100911640.1\|37476_37965_+	TIR domain-containing protein	NA	NA	NA	NA
WP_100911641.1\|37967_38477_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_100911642.1\|38926_39349_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_100911643.1\|39592_40474_-	hypothetical protein	NA	NA	NA	NA
WP_100911644.1\|40479_41088_-	His-Xaa-Ser repeat protein HxsA	NA	NA	NA	NA
WP_100911645.1\|41084_42173_-	His-Xaa-Ser system radical SAM maturase HxsC	S5WIP3	Leptospira_phage	1.9e-42	33.3
WP_100911646.1\|42169_43579_-	His-Xaa-Ser system radical SAM maturase HxsB	S5VT21	Leptospira_phage	1.2e-28	25.5
WP_100911797.1\|43559_43808_-	hypothetical protein	NA	NA	NA	NA
WP_100911798.1\|43913_45050_-	hypothetical protein	NA	NA	NA	NA
WP_100911647.1\|45353_45944_+	hypothetical protein	NA	NA	NA	NA
WP_100911648.1\|46123_47287_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_157814272.1\|47544_48162_+	hypothetical protein	NA	NA	NA	NA
WP_100911650.1\|48479_49605_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.0e-91	62.4
WP_044460062.1\|49752_50319_+	thermonuclease family protein	NA	NA	NA	NA
WP_100911651.1\|51178_52406_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.1e-66	48.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017999

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018000

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP018001

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection