CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP025113	Bradyrhizobium sp. SK17 strain CBNU chromosome, complete genome	3 crisprs	WYL,csa3,DEDDh,cas3,RT	0	0	5	0
NZ_CP025114	Bradyrhizobium sp. SK17 strain CBNU plasmid unnamed, complete sequence	0 crisprs	csa3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025113_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025113_1

584243-584322

Orphan

Consensus_repeat	Method
GAGCCCGGAATCCATCGGGCAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025113_1

>merge|NZ_CP025113|1|584243-584322|CRISPRCasFinder
GAGCCCGGAATCCATCGGGCAACTTCCACCCTCGTCATTCCGGGGCTCGCGAAGCGAGAGCCCGGAATCCATCGGGCCAC

>NZ_CP025113|1|1|584243-584322|CRISPRCasFinder
GAGCCCGGAATCCATCGGGCAAC	TTCCACCCTCGTCATTCCGGGGCTCGCGAAGCGA
GAGCCCGGAATCCATCGGGCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025113.1\|WP_100950628.1\|585389_586202_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
NZ_CP025113.1\|WP_024581770.1\|573635_574103_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_100950622.1\|579620_581069_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381284
NZ_CP025113.1\|WP_100950630.1\|586295_587465_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP025113.1\|WP_024581753.1\|593323_593524_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_076864213.1\|581175_581526_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100007
NZ_CP025113.1\|WP_029879210.1\|579168_579516_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP025113.1\|WP_051404294.1\|581656_582724_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|239608
NZ_CP025113.1\|WP_100950642.1\|593523_594627_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_100950620.1\|577908_579093_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_CP025113.1\|WP_100950632.1\|587851_588157_+\|DUF5132-domain-containing-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_024581762.1\|583845_584208_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP025113.1\|WP_100950636.1\|588981_591099_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319848
NZ_CP025113.1\|WP_100950624.1\|582830_583739_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP025113.1\|WP_100950618.1\|574380_576039_+\|FAD-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|183782
NZ_CP025113.1\|WP_080891013.1\|576243_577839_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP025113.1\|WP_100950626.1\|584466_585264_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225360
NZ_CP025113.1\|WP_100950638.1\|591095_591935_+\|EcsC-family-protein	unknown	unknown	gnl\|CDD\|378945
NZ_CP025113.1\|WP_100950634.1\|588397_588955_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_157817063.1\|591965_593198_+\|DUF445-family-protein	unknown	unknown	gnl\|CDD\|377281

Protein	Function_ID	Function_description	E-value
NZ_CP025113.1\|WP_100950622.1\|579620_581069_+\|hypothetical-protein	gnl\|CDD\|381284	cd14775, TrHb2_O-like, Truncated hemoglobins, group 2 (O); uncharacterized subgroup. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P).	2.87968e-56
NZ_CP025113.1\|WP_100950630.1\|586295_587465_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.61658e-49
NZ_CP025113.1\|WP_076864213.1\|581175_581526_+\|RidA-family-protein	gnl\|CDD\|100007	cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	3.50407e-54
NZ_CP025113.1\|WP_100950618.1\|574380_576039_+\|FAD-binding-dehydrogenase	gnl\|CDD\|183782	PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed.	0
NZ_CP025113.1\|WP_029879210.1\|579168_579516_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	2.33353e-27
NZ_CP025113.1\|WP_051404294.1\|581656_582724_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|239608	cd03532, Rieske_RO_Alpha_VanA_DdmC, Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degradation pathway of lignin-derived compounds such as ferulic acid and vanillin by soil microbes. DDmC is the oxygenase component of a three-component dicamba O-demethylase found in Pseudomonas maltophila, that catalyzes the conversion of a widely used herbicide called herbicide dicamba (2-methoxy-3,6-dichlorobenzoic acid) to DCSA (3,6-dichlorosalicylic acid).	6.53287e-54
NZ_CP025113.1\|WP_100950620.1\|577908_579093_+\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.71685e-14
NZ_CP025113.1\|WP_024581762.1\|583845_584208_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	3.23284e-09
NZ_CP025113.1\|WP_100950636.1\|588981_591099_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319848	cd07550, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP025113.1\|WP_100950624.1\|582830_583739_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.08191e-46
NZ_CP025113.1\|WP_100950628.1\|585389_586202_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	7.80363e-52
NZ_CP025113.1\|WP_080891013.1\|576243_577839_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	2.55116e-119
NZ_CP025113.1\|WP_100950626.1\|584466_585264_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	8.73863e-13
NZ_CP025113.1\|WP_100950638.1\|591095_591935_+\|EcsC-family-protein	gnl\|CDD\|378945	pfam12787, EcsC, EcsC protein family. Proteins in this family are related to EcsC from B. subtilis. This protein is found in an operon with EcsA and EcsB which are components of an ABC transport system. The function of this protein is unknown.	3.13417e-28
NZ_CP025113.1\|WP_157817063.1\|591965_593198_+\|DUF445-family-protein	gnl\|CDD\|377281	pfam04286, DUF445, Protein of unknown function (DUF445). Predicted to be a membrane protein.	1.48449e-109

>NZ_CP025113.1|WP_024581762.1|583845_584208_+|nuclear-transport-factor-2-family-protein
MTDHATVARNYIALWNERTPSRRREMLSANWTSDARYVDPLMAGDGHEGVDALIAGVQQKFPDFTFKLIGEPNGFGDHVRFSWGLGPDGVDSPIKGTDFAMLKDGRIRSITGFLDQVPGA
>NZ_CP025113.1|WP_100950624.1|582830_583739_+|LysR-family-transcriptional-regulator
MEWRDWELFCEVVEHGGFTAAARVLGHPKSSLSAAVQRLEANLGLRLIERTTRHLRLTDSGETIYRKVRPLFAALHDTHSEALAMSSAVAGTLRIKAPYEFGAHHAGPVACAVMGRYPELAIRIDVEHDIVNPIAENYDIVFAMLEAPLPSAGIVIRRVFTLERGLFAAPALLETSGEPRTLDELRKLPLLTGPSDPPWAITAPGGAVEHLSVDRARLTSSNAHVRLQAALAGHGVLRVTASYTRAAVAAGQLRRLLPDHACEPLNVHALLPARQFVPAKVRCFLDAMEAHARGDPEAYIKP
>NZ_CP025113.1|WP_051404294.1|581656_582724_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MADDDGIFLRNAWYVAALNHELIDGKKLARTILERPIVIYRGASGKVVALDDRCCHRAAPLSMGRVEGDDIRCMYHGMKFAADGKCIQIPGQDAIPAKLGVRSYPVVERYNMIFIWTGDPEKADPKLILDYPPLEDPTWRGLPGYMHYKANWLLIVDNLSDFAHLAFVHTNTLGGSEEYAYKTKPVAIEKLDDGFRVERWHMGADAPPYHKKVISNRDDMVDRRNVGRMIVPGIFTLDTMFAPAGQGAEKGVQVPGTRQYRNAQFMTPETRSSTHFFWNYLHDFDIGDPNIALSLRYSLEEAFNEDKDFIEAQQKVLDADPDYQLLAIGADAPLTYFRWLFARRLDAEKGTARAA
>NZ_CP025113.1|WP_076864213.1|581175_581526_+|RidA-family-protein
MSIQRFETGPRMSQAVVHGNTVYLAGVVAGKAAGGSVTDQTKDILSIIDGHLAKAGTDKSKLLSATIYITDMKTFPEMNAVWDQWVSQGNTPARATVEAKLAAPQYNVEIMVVAAK
>NZ_CP025113.1|WP_100950622.1|579620_581069_+|hypothetical-protein
MTDSSSARGPHDEQQPRKRIIVRRNGPYEPEPGIAIVDHLGVPVATEAPARLCRCGQSRTKPFCDDSHAARGFTDAKDARRVPDKLDVYAGQQAHVFDNRGSCAHSGFCTDRLNSVFHVGEEPFVAPSGARLDDLINAVRRCPSGALGIGIGPAREANLSDVSRPPQIEVSKDGPYRVTGDVELIDEDGAPIARNAGASREHASLCRCGASLNKPFCSGMHWNVAFHDPVPDPMREPTLFEWAGGYPALLDMTRIFYSRYVPEDPLLGPLFAEMSPDHPERVAAWLSEVFGGPRFYTERYGGYRRMVSQHIGKEIRPEQRALWATYMVQSADDAGLPSDPEFRAAFVAYIEWGSRIAVENSGAGAKPPPNMPVPRWWWVCNATPAARPPAIADDAQDTNDISVTLPGPGETVRFEPHIRPLFRPMDRNSMLFAFDLWNEADVTRHAPQILARLEAGTMPCDGAWPAERIALFARWAEAIAPR
>NZ_CP025113.1|WP_029879210.1|579168_579516_-|helix-turn-helix-transcriptional-regulator
MIRKTKRKYGCPVEFSIDQLSGKWKTVILSRLKLRPMRYGELRHDIPQLSDKVLTERLRDLCNSGFVKQERGGGSSRYCLTKRGEMLKPMLQALYDWGEANADTFGVRFASAEAE
>NZ_CP025113.1|WP_100950620.1|577908_579093_+|MFS-transporter
MPKSSAQFLFLGTMLAAAGYGATFLLSAYFRANGGSDLDTGTTLGAAMIGTFVGVPLVGWFSGRFDAARMSAIAACAVGCGFLLLAASAGGTLAMSLTSGFLIGLGWGMFYVGAPMSLSERVTDRDRGFWFTRFGAFQMAGIGGGPLVLNLAVDQAGLSIAATFRLVGIACLVAGLSLWMFSTMAPGARRSSSLRSWVRPISVIARSPSVRPILMVGFGACAFSGLLTFQSSLVAGTSAKASTFFAVYAITVVAARLLFARILASLPQRRLAEGLLVSMTLGVVAMFGVGIHPAFQILSAVLTGIGYGLVYTVIQTWAVNDTDARYRHAALTWFVLSYFIGIFGFPVIGGWLLVNLGRNAFLGALLAAALSELAILYSGSEKASGGVRTNSTTA
>NZ_CP025113.1|WP_080891013.1|576243_577839_-|PLP-dependent-aminotransferase-family-protein
MSERATFPKLPMRRAMRRESAAAGFRPAIDSSLPVPAVRQLYLQLRDAIVGGALRAGDRLPSTRTASAEWSLSRGLVAEAYDVLIAEGYAIGKHGSGTYVTDDLPLPKIEGNSSRNARSSASRRRISAAARLAMSFETHPGQVAFATGRVIHDMRTAVLLKRLAHRHIDYASDGYRDAQGEPALREAVAAYLTASRGVRCDPRQVFITSGTQQALDLAIRVLMSPGETALIENPCYPPARQAFLLNGARLVGAPVDSKGMITETLASSDGLAPVVIYVTPSHQYPSGSALPLTRRLQLLAFAQRQGSWIIEDDYDSEFRYEGHPIASLQGLDTGGCVIYAGSFSKALLPGFRVGYLVVPDDLVAAFRAVRPIVDRFPAPLHQLVVADFLSEGYFPAHLRRLRESSRASRDLLFDLLKERLSEHLVALLPEQGVHLTARSTGSWRDDCALARAALDGGVVVIPTSPMHIGAPAEPRLLLGFSGLTAAETDIATRRLAEVFRSSAKTAKLRPDESKQSKRDRRQARSRPLKSV
>NZ_CP025113.1|WP_100950618.1|574380_576039_+|FAD-binding-dehydrogenase
MADDADVIVIGAGLAGLVAATEIADAGKRVIVLDQEGEQSLGGQAFWSFGGLFLVDSPEQRRLGIKDSADLALQDWMGTAGFDRAEDHWPRKWAEAYVGFAAGEKRDWLRAMGHRIFPVVGWAERGGYDAMGHGNSVPRFHVTWGTGPGIVEPFERRARAAANSGRLVFKFRHRVDALSVSNGTVDGVSGAILEPSSVERGKSSSRKVDGDFSLRAQAVIVASGGIGGNHDLVRQNWPQRLGEPPKFMISGVPEHVDGRMIGITEQAGGRLINRDRMWHYVEGIQNWNPIWPRHGIRILPGPSSMWFDATGKRLPAPLFPGSDTLGQLHYIMSTGYDYSWFILTQSIIKKEFALSGSEQNPDLTGKSWRMTIKRATNKGAPAPVEAFKQHGADFIVRDNLADLVGAMNKLAGNDLLKLDAIKAQIEARDREITNPYVKDAQVMNLHNARRYIGDRLIRTAKPHRILDPDHGPLIAVKLNILTRKTLGGFETDLESRVFGNDHQIIRGLYAAGEAAGFGGGGMHGYRSLEGTFLGGCLFSGRNAGRAAAKAVG
>NZ_CP025113.1|WP_024581770.1|573635_574103_-|hypothetical-protein
MKLMTGLLAAVLLLAGMGASQAVVRIADDRGGKIGVYVDKYQDLRTSGETVIIDGLCASACTIVLGKVPHDRICVTSHASLGFHAAWDYGDNGRPVPNPEATHMLYLMYPPAVRKWINDRGGLTRNMIFLRGKQLQALYKPCYLNAQASAPKPAR
>NZ_CP025113.1|WP_100950626.1|584466_585264_+|helix-turn-helix-transcriptional-regulator
MKADFAFTTSVVSDITPALLAIGRDGFPQALIGALRRVAGVGHCMVFSFTGPRSASCLLDVGNIPTGRDLGIAYSEHFHQSDPNRDAVFEGQAQATPIMLPTFARRMYSDGYRKIFFDDSDIVDKFAAAIWTGDTCFYVNFYQITAQGRFNREQIARLSAVAPALTAAVARHFQCETAADVDPVERLTGLFATAEPLARLTGREREVCLRILSGLSSEAIAADLGIGLHSALTYRKRAYDKLGISSQNELFAIALRLMASVRSLN
>NZ_CP025113.1|WP_100950628.1|585389_586202_+|haloacid-dehalogenase-type-II
MCVSGGAWSLVRRSSWKRAAQVQAFTQFRNVDDIKALAFDVQGTCVDFYQPVLRAGAAINRDKGLAIDWTRLLAEWRDLYRVALDAVIAGQRPWLRVDRIYREALDLLLERQGLGEAFTPQERDELNNVWTRLDAWPDTVAGLARLRRRFTTATLSNAGMAAVVAVVKHAGLPFDAVLTAELAHSYKPAPSVYQLAVDFLGYRPDQIVMVACHKYDLRAARAFGMRTAFVARPLEFGPDVTPDVTAEDWLDLHVDSFTALADALGAGSPA
>NZ_CP025113.1|WP_100950630.1|586295_587465_+|cytochrome-P450
MSTAPRFDIDVPAFWQDPYPTLARMRKEAPIAFVPQLGSTLLCNRDDIFVSEKQIDVFSSHQPEGLMNRLMGHNMMRKDGDAHMNERKAIFPAISPKTVRSHWTAQFAGHANRILDELEPDGVVDFVQAFALPFSAECLKSITGLTNMRFQDMNAWSQNMIDGIANYVGDPAIEARCHAATSGIDAAIDDMVPVLRKTPDLSLLGVLLQTDMPMDSIRANIKLAISGGQNEPRDAIAGSVWALLTHPDQLALATSGTVPWLQAFEEYARWISPIGMSPRRIAKPWTIRDIAFETDERVFLMFGSANRDEKHFDRPDIFEVRRDASKSIAFGAGPHFCAGAWASRAMVADVALPAIFGRLKGLRLIDDRPPRIGGWAFRGLLDLPVTWDR
>NZ_CP025113.1|WP_100950632.1|587851_588157_+|DUF5132-domain-containing-protein
MNKTVAVVAVVAVGAAVFEAALLPGLALGVAAVAAPKYLPKLAGALNPLFKSTVRGTYKFAQKSREMFAEAQEQVNDIVAEVKSENQADTKAASSRTSSAA
>NZ_CP025113.1|WP_100950634.1|588397_588955_+|hypothetical-protein
MTKMKLQIAHQVPGRIRMKVPSAKENPELLEQIKQTFSVIPGIEEVTINPTTGSVVLHYDTDRHDEFHGRLEHHTGGHYRPPTNEIDALANKIEQEAEYLAEHSHTAKVIVDFFRDFDHGIKVASGNVIDLKIVLAAGIAGFTVFEVGATAATPVWVTLAVFALNHMIQANMAAAEQAEPARATA
>NZ_CP025113.1|WP_100950636.1|588981_591099_+|heavy-metal-translocating-P-type-ATPase
MDFSFCHSMPGRIRLSIPALGQNRKLGEACLGWLRAQDGIRTARINYDCASLVLEYDPAHEQRLLALLSGFKAMSLADFKALCARAAPTADMPRAGAPEVSKRSPLTLPTLSLFMAFSANPVITAINMPLMLWNAIPIAKRAWKVWANESRLNIDVLDTLAISASVLQGNPLAGCIVTWLIKLGDWIRDLTAAGSRKAINELLEFQSKTAWVLREGEVVSIPAAELQNGDIVVVYPGEMIPVDGEIIEGSATIDQKTITGEGLPVHRSKGEAAFAATVIREGQITLRALRVGSATTAGQIVRLIESAPIGDTRMQNHAERFADRLVAPTLALATGTAMVSGDFNRFLSLVIVDYGTGIRVAAPTSVLSSMTLAARTGMIIKSGGHMEKLAGIDTMVFDKTGTLTHGTPAVIDVISYQKYITPNHLLGLAAAAETKLQHPVAEALRSRARQLAVNIPPCNETTYRLGLGVEGQVNGYYVHVGNQRFMRQSEIIVDAAVHDRAALDERGYSSLYIAVDGKLAGLVPYSDEIREESRPVIQRLHELGVKNSIMLTGDNAVVARAVCNRLGLTEHFADMLPADKAGIIQELQRQGRRVAMVGDGINDSPALSFADVGIAMKHGAEVTHESADVILMEDSLWKLVKAVEISQGAVQLIKQNYGIVAALNTLALGLALPGGLITPEVTAIISNGSAILASLNGIRPILRYQ
>NZ_CP025113.1|WP_100950638.1|591095_591935_+|EcsC-family-protein
MSQDVTQLVLLPPGDHAALQAAVKTLESSNLAARIADYAGVPVNRVLNLLPKAANRQLSGLVRTAVMKGLEVAVDTLDEKPPPAPAVTFSSFLAGVTGGVSGLFGFGALAVELPLTTTLMLRAIAEIARHQGEDLSKIEARLACLEVFAYGTKRTDETIDVGYYAARALISKYTSDAAAYILERGAVDASAPVISNLVSEIVSRFGLVVSDKAAAGAVPIIGAAFGSTVNVIFMDHFQKIAKGHFTVRRLERLHGSAGVRQHYAAIAARLAPQRGVATA
>NZ_CP025113.1|WP_157817063.1|591965_593198_+|DUF445-family-protein
MLPPEDTRLRDLRRMRTLATGLLVFMLLVFLATSMAQPHWPWLAYPRAFAEAGMIGACADWFAVVALFRHPLGIPIPHTAIVPQSKQRIAVALGRFIANNFLSPRVVGDRIRDVDIAGWAAQWIERPSHARSAAQRTVSAVHQAMQTTPSADLNAFLTRRTRQGIAAIPAAPLASRVLSLLWAHGNAQALVERLINSASVALANNKETIRKKVSQRSYRFVPKWVDGMVADRVISGVSQTLDEMREPDHPWRVELKAEIERLIDRLATDPEYLAKGEELKQQMLDNPAVIGQIDAMWHAIEVRLNSAATSAAIADAIETALMSVAARIRDDAEMRDRINRWLRVAALRAVASRRQEIAAFIRKVVENWDTETLIMRIELQVGRDLQFIRINGTVVGGLVGLLIFSVSRWL
>NZ_CP025113.1|WP_024581753.1|593323_593524_-|hypothetical-protein
MHMTTLPALRTPTALEPRLERLEFADRERGLTRRHFIFACLGLAASQVVRLVDKLEQLPLLRIRFP
>NZ_CP025113.1|WP_100950642.1|593523_594627_-|hypothetical-protein
MIETFRVGRFAMRYGHFVPRLYNYCRSLGFQRQHMLPSRAFCSDESQGYPVMLLAQHFGTFPFDHGRVGGKVAINRHGPYAHHGEDLVLIQASHVGYNPDDGRFGVYQRHRTDGCRFGDCCGKLCGVLRWYQDEHAHACRQVQCVRIDGEPAFQIDNQYLDDSRGEGLFLRLDRMVEMPLQPLKVLSTSKLFRAGPAIRERLGESRFHEEPAPIGAALSPELFHFRRAPAEGPEGHDILEAALGPVMPALVTSPHPALDAARYVTQAEFDRTYRSIRREPAFQGKNVLFVSGLNIDVSPREGFPFPFTKFVPWAAYARLRDGRSFLLEQEQLAETLRGMPGDNPDCLSFDGTIEQMTAAPEIRIPIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025113_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025113_2

2456688-2456799

Orphan

Consensus_repeat	Method
TTCCGAAAGGATCATGCTCAAACAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025113_2

>merge|NZ_CP025113|2|2456688-2456799|CRISPRCasFinder
TTCCGAAAGGATCATGCTCAAACAAGAAGCTGAAGCGCGAACTCATTGCGCTTTAGAGCATGATCCGGAAAAGTGGAAAGCCGGTCTTCCGAAAAGATCATGCTCAAACAAG

>NZ_CP025113|2|2|2456688-2456799|CRISPRCasFinder
TTCCGAAAGGATCATGCTCAAACAAG	AAGCTGAAGCGCGAACTCATTGCGCTTTAGAGCATGATCCGGAAAAGTGGAAAGCCGGTC
TTCCGAAAAGATCATGCTCAAACAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025113.1\|WP_100951954.1\|2455612_2456626_-\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234636
NZ_CP025113.1\|WP_024579183.1\|2455159_2455450_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_024579173.1\|2464510_2464936_+\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318
NZ_CP025113.1\|WP_100951955.1\|2456865_2457618_+\|adenosylcobinamide-GDP-ribazoletransferase	unknown	unknown	gnl\|CDD\|234697
NZ_CP025113.1\|WP_100956250.1\|2465017_2465383_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_100951958.1\|2463938_2464355_+\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318
NZ_CP025113.1\|WP_100951956.1\|2462154_2462526_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP025113.1\|WP_024579188.1\|2451767_2452178_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319899
NZ_CP025113.1\|WP_024579190.1\|2450677_2451088_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|379266
NZ_CP025113.1\|WP_024579178.1\|2459179_2460850_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP025113.1\|WP_024579186.1\|2452424_2453177_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP025113.1\|WP_024579185.1\|2453308_2454214_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176112
NZ_CP025113.1\|WP_100956246.1\|2458216_2459005_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP025113.1\|WP_100956248.1\|2461354_2462008_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_CP025113.1\|WP_024579180.1\|2457625_2458192_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP025113.1\|WP_162487048.1\|2454623_2455046_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_024579189.1\|2451153_2451690_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176860
NZ_CP025113.1\|WP_100951957.1\|2462606_2463815_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP025113.1\|WP_024579187.1\|2452132_2452402_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_100951953.1\|2449050_2450328_+\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|227277

Protein	Function_ID	Function_description	E-value
NZ_CP025113.1\|WP_100951954.1\|2455612_2456626_-\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	gnl\|CDD\|234636	PRK00105, cobT, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase; Reviewed.	3.19783e-130
NZ_CP025113.1\|WP_024579189.1\|2451153_2451690_+\|SRPBCC-family-protein	gnl\|CDD\|176860	cd07818, SRPBCC_1, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	4.78254e-72
NZ_CP025113.1\|WP_024579173.1\|2464510_2464936_+\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	2.35061e-38
NZ_CP025113.1\|WP_100951955.1\|2456865_2457618_+\|adenosylcobinamide-GDP-ribazoletransferase	gnl\|CDD\|234697	PRK00235, cobS, cobalamin synthase; Reviewed.	6.59456e-53
NZ_CP025113.1\|WP_100951958.1\|2463938_2464355_+\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	2.95712e-40
NZ_CP025113.1\|WP_100951956.1\|2462154_2462526_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	7.06575e-06
NZ_CP025113.1\|WP_024579188.1\|2451767_2452178_+\|VOC-family-protein	gnl\|CDD\|319899	cd06588, PhnB_like, Escherichia coli PhnB and similar proteins. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to bleomycin resistance proteins, glyoxalase I, and type I extradiol dioxygenases.	1.45861e-44
NZ_CP025113.1\|WP_024579190.1\|2450677_2451088_+\|DoxX-family-protein	gnl\|CDD\|379266	pfam13564, DoxX_2, DoxX-like family. This family of uncharacterized proteins are related to DoxX pfam07681.	1.84801e-13
NZ_CP025113.1\|WP_024579186.1\|2452424_2453177_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	4.87165e-07
NZ_CP025113.1\|WP_024579185.1\|2453308_2454214_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176112	cd08420, PBP2_CysL_like, C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.94159e-57
NZ_CP025113.1\|WP_100956248.1\|2461354_2462008_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	3.64492e-40
NZ_CP025113.1\|WP_024579180.1\|2457625_2458192_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	2.60175e-37
NZ_CP025113.1\|WP_100956246.1\|2458216_2459005_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	8.16528e-88
NZ_CP025113.1\|WP_024579178.1\|2459179_2460850_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	5.15409e-29
NZ_CP025113.1\|WP_100951957.1\|2462606_2463815_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.28658e-65
NZ_CP025113.1\|WP_100951953.1\|2449050_2450328_+\|RNA-polymerase-sigma-factor	gnl\|CDD\|227277	COG4941, COG4941, Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription].	0

>NZ_CP025113.1|WP_100951954.1|2455612_2456626_-|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase
MQFNTLDDIRSFCRELPAGDEAAATAASVRQQNLTKPPGSLGRLEEVTIWLARWQRRQIPRLDQVTIAVFAGNHGIAERGVSAYPSEVTAQMVANFAAGGAAINQIARLAGAELRVEPLELARPTRDFTMAPAMDGADFLVALDTGWRAVPEQCDLLVVGEMGIANTTVAATLCAALMGGRGARWAGRGTGVDDAGLLRKRTTIDTALKMHRNLLDDPLAVAVALGGRELAAIFGAVLAARARSIPVLLDGFVATSAVLPLARLAPDGLAHCRAGHVSAELGHRELLRDLALAPLLDLEMRLGEASGAGIAILLLRAALACHGGMATFAEAGVSGAD
>NZ_CP025113.1|WP_024579183.1|2455159_2455450_-|hypothetical-protein
MSGVLINLIIQIISGAVGGNVAAGAAKNIDLGTLGNTIAGAIGGGAGGQLLGMLIPLLANSGATPDIGSIIGQVAGGGVAGAVLTAIVGALKNRTA
>NZ_CP025113.1|WP_162487048.1|2454623_2455046_-|hypothetical-protein
MKTLVAAAALCATVSCAQADVRILASPGGQVGPFIDLFDKVRESGERVVIDGPCLSACTLVLSMVPGDRICVTRRAVLGFHAARSIDRRGRTYAEPEASEAVLEAYPAPVRGWIIRRGGLTSRLLLLRGRELAAIYPRCR
>NZ_CP025113.1|WP_024579185.1|2453308_2454214_-|LysR-family-transcriptional-regulator
MSLIRDQRLRVFHAVALRKSFTDAGHDLHLTQQAISFHIRSIEQELDVPLFIRSHHSVQLTKAGAILFAHAERILALYDEASRALAELREESTRRLRIAATNSISKYAMPTAIRIFQSRHPKVQVVLEIGNSTQVIEYLNQGAVDAALVSDGVPLSSNYRVTPLWREQIVFVVSPEHPWVSRDDLTIDDLLATPVIMREKGSGTRAILERELAALGLSFDRLKIALIVGSPEAVKQAAQAGVGVGILSTLRARHSLSSDDLILKRIDGFDLTRDFYVVRPQNGSAATLLNEFVPIVQDAIA
>NZ_CP025113.1|WP_024579186.1|2452424_2453177_-|sulfite-exporter-TauE/SafE-family-protein
MYDAVHLATFEQYCLVAALSFIAAIVGGVAGYGTGLILPPVLLPIVGSEAVVPIISLSALLTNASRLIALRDKFDVRNAIMLASCALPTCIGGAYVYTTLGGKTVTIVIGLALIVLVPLRRLASKAQWRLTTPGVAVAGSGYGLLVGATSGSGVVLLSILLAAGLRGSAVIATDAGISLFLGLAKTAVFQTAGALPASAWIMAILIGCCATPGAFLAKRLSAHLPIHVHTDILDGVVILGGALLMIQAMW
>NZ_CP025113.1|WP_024579187.1|2452132_2452402_-|hypothetical-protein
MDRTTIKHSKDEARSRSAACTLAQLMVIYFLLQLLAIAATRRFDPDAVQSLLAWDGMTPISRPDLFDGGPVDPARHICAGQFTIQGMPN
>NZ_CP025113.1|WP_024579188.1|2451767_2452178_+|VOC-family-protein
MQVNPYLSYDGNCGAALKFYEKVLGARIEETFPYGEGNAEMQTPPGWKDKVMHARLTIDGEIIMASDAPPGHFQKPQGFHVALQVEDPTEAERRFTALSEGGAVTMPFGKTFFSNGFGMCVDQFGIPWMVNCPAQM
>NZ_CP025113.1|WP_024579189.1|2451153_2451690_+|SRPBCC-family-protein
MFETIAIIAIILAIAIAVILILAATKPSTFRVTRATSINAPAERIFGLIDDFRQWTVWSPYENRDPDMRRIYSGTERGQGAAYAWEGNKNVGAGRMEILQSAAPSKIVIKLDFLKPFEGHNTAEFTMLPQGDATSVTWTMYGPAVFMSKVMQVFMNLDHMIGRDFEVGLANLKKLTEK
>NZ_CP025113.1|WP_024579190.1|2450677_2451088_+|DoxX-family-protein
MPTIVDTEVSKSARITGRVISGVVVLFLLFDGAIKLVPLPVVTETLDRMGWGASDTLARSLGIITIVCTLLYSVPPTSILGAILLTGYLGGAIASHVRIDSPLFSHTLFGLYLGLMVWGGLYLRDGNLRALLPFRR
>NZ_CP025113.1|WP_100951953.1|2449050_2450328_+|RNA-polymerase-sigma-factor
MSVTDTAWIDAALTSARPQAVGALLRYFRNLDTAEEAFQNACLRALKSWPQNGPPRDPAAWLIMVGRNVAIDDIRRSKKQEALPDDDRSISDLDDAEEEIAERLDGSHYRDDILRLLFICCHKDLPATQQIALALRIVSGLTVKQIARAFLVSEAAMEQRITRAKARVADANVPFETPGAVERSERLASVAAMIYLIFNEGYSASGDTAEIRSPLCEEAIRLARLLLRLFQSEPEIMGLTALLLLQHARAAARFDADGQVILLDDQDRSLWNQKLIAEGLALIDKAMRHRQSGPYQVQAAIAALHARAEKPEDTDWTQIDLLYGALELMQPSPVITLNRAVAVSKVQGPEAALEMIEPLAPRLANYFHYFGVRGAFLMQLGRNEEARVAFDRAIALANTTAEAAHIRMHIDRLMRDSQPRNAKAK
>NZ_CP025113.1|WP_100951955.1|2456865_2457618_+|adenosylcobinamide-GDP-ribazoletransferase
MNQWLDDLRIATAFLTRLPMPHPDGAQPESFARAQRLFPLVGAGIGAAVGLFCLLLRAIGVPDLAAAALALGGAALLTGALHEDGLADVADGFGGGRDVAAKLEIMRDSRLGTYGALALVVSFAAKLAAIAAIPDGLVVQSLIAAHALGRGVLPWIAISLPYARKDGLAANAGRPDGTIAAVAAGIALVIAVLALPLGSALLAAIAAGASAVIMMQLARRQIGGQTGDVLGGAEQVAESAILVLLAARLG
>NZ_CP025113.1|WP_024579180.1|2457625_2458192_+|histidine-phosphatase-family-protein
MDRETYLWLIRHAPVDGPRGVIHAPDAPADLDDAATFAALQARLPSGARTICSPARRTRETAARLGLTATEDDAFREQDFGTWTGRRHSEIEQELGAEAYRAFWQSPGINRPPGGESFADQIARARVGLARLPPGDVVLVVHSGTIRAILAIALELAPEHALRFVIGPLSLTRVDRLGKAWRVVAVNG
>NZ_CP025113.1|WP_100956246.1|2458216_2459005_-|SDR-family-oxidoreductase
MTSSAQKVALVTGAARGIGLAAAKRFLADGWRVALLDIEGELLNAAVAALRQPDTTLALTCDVSDADGVTKAMATITNRFGRLDALVNNAGTAVFAPVLETSDADWSRIMAVNLTGPFLCTKAAAPLMREHGGGAIVNITSISAVRASTLRSAYGTSKAGLAHLTKQLAVELASLGIRVNGVAPGPVETAMAKAVHTPEIRADYHDAIPLNRYGLEEELAEAIFFLCSDRASYITGQILAVDGGFDAAGIGLPTLRGERRNG
>NZ_CP025113.1|WP_024579178.1|2459179_2460850_-|methyl-accepting-chemotaxis-protein
MFTFSNKANIENALAQAAAIGKSQAVIEFKLDGTIVTANENFLNAMGYALDEIRGKHHSMFVDPAMRDSHDYRAFWASLNRGEHQAAQYKRIAKGGREIWIQASYNPITDKNGKPVGVIKFATDITAQKIHSMEDSGKIAAINRAQAVIEFNMDGTIVTANENFLGAMGYALAEIQGKHHSMFMPPADRDSAGYREFWARLNRGEFESGEFKRHAKGGREIWILASYNPILDERGKPFKVVKFATDVTQQKLKAADNDGQIDAIGKSQAVIEFNMDGTIRNANPNFLAAMGYTLAEIQGRHHSMFVEPVEASSSAYREFWGALNRGEFQAAEYKRIAKGGREIWIQASYNPILDLNGKPYKVVKYATDITAQAIGRKKADSARGLIEAVAAGSEEMSASIREISETMTKSKQNAAVATGRVEAADGEAQRLNAAAQAMSGIVEMISSITGQINLLALNATIESARAGEAGRGFAVVASEVKSLANQAKQATDTISSEIDALNSIAAAVASSLSEIKAAIAGVNEYITSTAAAVEEQSIVTQDMSTNMQRASAELAA
>NZ_CP025113.1|WP_100956248.1|2461354_2462008_+|glutathione-S-transferase-family-protein
MSLTLHYHPLSSFCWKALVALYENGAPFTPNMVNLGDPAERAALLALWPIGRFPVLRDETRGETVPESSIVIEYLDRHYPGTVRLLPEDPDLALRTRLRDRFLDLYVHLPVQKIVGDRLRPAGSKDPHGVAEARTQLRSSYAILDRQLVHGGWMMGEQFSLADCAAAPALFYGNKVEPIGEDHRHLAAYLERLTARPSFARVLEAAEPYFGMFPKEN
>NZ_CP025113.1|WP_100951956.1|2462154_2462526_+|nuclear-transport-factor-2-family-protein
MAATGNRAEIIRKLFAAYLANDRASVEAAFAEDFRFSTPYGENIDKSRYFAECWRDSDWIGRHEIERIMVDGPEAFVTYRCVARDGKSFRNTEFFAFDGDKVSRIDVYFGPSHQDGALVRQER
>NZ_CP025113.1|WP_100951957.1|2462606_2463815_+|serine-hydrolase
MSVLSENGNLSRPRLGRMHEVLAHHVGAGDVPGVVALVSRRGEIHVDVLGRMALDGPPMQRDTIFRIASMTKPVTAVAAMILVEECRLRLDDPIDRWLPELADRKVLRTIESGIDDTVPAQRAITLRDLLTFRLGLGMIPAFPARHPIQIAIADAGFAPGPVFPTFPPDELLRRYGTLPLAYQPGERWLYNTGSEILGVLIARVAGMSFAGFLQERIFTPLGMTDTAFHVPPDKLKRLATCYTRDAATGKLKVFDEPASGKYAAPPVFENGGAGLVSTADDFNAFAQMMLNGGRLGTERILSRPAVELMTSDQLALSDKQGSEFLLGAGRGWGFGLSVVTARDDLCQVPGRYGWDGGYGTSWYSDPREEMTGILLTQRMLDSPQPPQVFSDFWTLAYQAIDD
>NZ_CP025113.1|WP_100951958.1|2463938_2464355_+|YciI-family-protein
MKFMVIVKANSDTEAGVMPSTEMLAAMGQFNEEMVKAGVMQAGEGLHPTSKGARVKYAGGQSSVSRGPFSLSGDLVAGFWLIETKSLDEAIDWMKRAPFDGGSEIEIRQVFAAEDFGEALTPKLREQEERLRAQAVKR
>NZ_CP025113.1|WP_024579173.1|2464510_2464936_+|YciI-family-protein
MRFMMLMIPQGYESAPAKLELDPERVAAMMRYNQALKDAGVLITLEGLHPPAAGARVKFDTGVPVVIDGPFTEAKEVIGGFWMIDVASRAEAIEWASKCPASANEMIEIRQVQEMTDFSEEVQQAAASFEHPQGGWGKALR
>NZ_CP025113.1|WP_100956250.1|2465017_2465383_+|hypothetical-protein
MSSNTFLAVYLGGGKDGARMAAWNALPEAERRAREQQGMAAWGAWVEQHHDVIVEMGGPLGKTKKVGSGGTTDIANLMTGFTVVRAPSHEAAAKLFENHPHFAIFPGEAVEIMPVLPIPGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025113_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025113_3

6920997-6921118

Orphan

Consensus_repeat	Method
GGGGCAGTGATAGCGACGCGGGCATGCAATGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025113_3

>merge|NZ_CP025113|3|6920997-6921118|CRISPRCasFinder
GGGGCAGTGATAGCGACGCGGGCATGCAATGCCCGCGGGCACCGAGACGACTGCAGTCGCGAGACCGGTTCAACAAGGCACCCGCGTTCGGGGCAGTGATAGCGACGCCGGCATGCAATGCC

>NZ_CP025113|3|3|6920997-6921118|CRISPRCasFinder
GGGGCAGTGATAGCGACGCGGGCATGCAATGCC	CGCGGGCACCGAGACGACTGCAGTCGCGAGACCGGTTCAACAAGGCACCCGCGTTC
GGGGCAGTGATAGCGACGCCGGCATGCAATGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025113.1\|WP_100554856.1\|6917756_6918389_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226430
NZ_CP025113.1\|WP_029879509.1\|6912120_6912837_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP025113.1\|WP_024582712.1\|6911381_6912011_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP025113.1\|WP_024585007.1\|6929928_6930198_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_024582713.1\|6910985_6911279_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025113.1\|WP_024585010.1\|6932201_6933266_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP025113.1\|WP_024585009.1\|6931358_6932198_-\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP025113.1\|WP_024585005.1\|6927429_6928467_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270265
NZ_CP025113.1\|WP_029880252.1\|6930335_6931079_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP025113.1\|WP_100955361.1\|6912817_6914662_-\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|213186
NZ_CP025113.1\|WP_100952424.1\|6919333_6920833_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP025113.1\|WP_024585004.1\|6925206_6927306_-\|molybdopterin-oxidoreductase-family-protein	unknown	unknown	gnl\|CDD\|239167
NZ_CP025113.1\|WP_024585006.1\|6928780_6929857_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP025113.1\|WP_100955362.1\|6915532_6916690_-\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380641
NZ_CP025113.1\|WP_100554857.1\|6916950_6917667_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377050
NZ_CP025113.1\|WP_024585003.1\|6924349_6925129_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235664
NZ_CP025113.1\|WP_100952425.1\|6918470_6919334_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP025113.1\|WP_024585011.1\|6933262_6934048_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224098
NZ_CP025113.1\|WP_100554859.1\|6914661_6915525_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP025113.1\|WP_145987247.1\|6923026_6924298_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP025113.1\|WP_100554856.1\|6917756_6918389_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226430	COG3916, LasI, N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism].	1.87766e-80
NZ_CP025113.1\|WP_029879509.1\|6912120_6912837_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	2.47527e-109
NZ_CP025113.1\|WP_024582712.1\|6911381_6912011_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	5.21636e-30
NZ_CP025113.1\|WP_029880252.1\|6930335_6931079_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	2.86476e-46
NZ_CP025113.1\|WP_024585010.1\|6932201_6933266_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.21595e-142
NZ_CP025113.1\|WP_024585009.1\|6931358_6932198_-\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.28638e-83
NZ_CP025113.1\|WP_024585005.1\|6927429_6928467_-\|extracellular-solute-binding-protein	gnl\|CDD\|270265	cd13547, PBP2_Fbp_like_2, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.06296e-62
NZ_CP025113.1\|WP_100955361.1\|6912817_6914662_-\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	6.23659e-101
NZ_CP025113.1\|WP_100952424.1\|6919333_6920833_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.37279e-17
NZ_CP025113.1\|WP_024585004.1\|6925206_6927306_-\|molybdopterin-oxidoreductase-family-protein	gnl\|CDD\|239167	cd02766, MopB_3, The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP025113.1\|WP_024585006.1\|6928780_6929857_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	1.95006e-33
NZ_CP025113.1\|WP_100955362.1\|6915532_6916690_-\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380641	cd19986, PBP1_ABC_HAAT-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids or peptides. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in the uptake of amino acids or peptides. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.	9.29353e-110
NZ_CP025113.1\|WP_100554857.1\|6916950_6917667_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|377050	pfam03472, Autoind_bind, Autoinducer binding domain. This domain is found a a large family of transcriptional regulators. This domain specifically binds to autoinducer molecules.	1.18388e-29
NZ_CP025113.1\|WP_024585003.1\|6924349_6925129_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	3.99052e-141
NZ_CP025113.1\|WP_100952425.1\|6918470_6919334_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	6.78934e-60
NZ_CP025113.1\|WP_024585011.1\|6933262_6934048_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	9.92499e-47
NZ_CP025113.1\|WP_100554859.1\|6914661_6915525_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.54625e-71

>NZ_CP025113.1|WP_100952424.1|6919333_6920833_-|IS21-family-transposase
MLVVETIARIRREHFIKGKTIKEIARDLKVSRNTVRKVLRSGETSFEYERSVQPRPKLGRWAVELDGLLAANAAKSAREQLTLIRIFEELRGRGYDGGYDAVRRYARRWSKERGQSTAAAYVPLSFAPGEAYQFDWSHEVVLLSGTTVMVKAAHVRLCHSRMLFVRAYPRETQEMVFDAHDRAFALFKGTCTRGIYDNMKTAVETIFVGKGRLYNRRFLQMCSHYLVDPVACTPASGWEKGQVENQVGLVRERFFTPRLRFKNLDELNAWLLDKCIAYAKAHRHPELVDQTIWEAFEAERPKLVPYAGRFDGFHAVTASVSKTCLVRFDNNKYSVAASAVGRPVEVQAYADRIVIRQDGRIVAEHPRSFGRGDTVYDPWHYVPVLARKPGALRNGAPFKDWVLPAAIERIRRKLASTEDGNRQMVDILNAVLTDGLPAVEAACAEALGHGVHSADVVLNILARQREPASPANIMTPAALTLRHAPIADCARYDNLRRTI
>NZ_CP025113.1|WP_100952425.1|6918470_6919334_-|ATP-binding-protein
MERTQIFDLMGELKLYGMKAAFDEIMATAVKRQHEPQRIVGDLLNAEINEKQARSIKYQLTIAKLPLAKDIADFQFDGTPINQTLVNDLAGGGFIAQQRNVVLVGGTGTGKTHLAIAIARSCIRSGARGRFFNVVDLVNRLETETRNGRQGRLAEHLTRMDFIVLDELGYLPFALSGGQLLFHLVSRLYERASVIVTTNLAFGEWPSVFGDAKMTTALLDRLTHHCDIVETGNDSWRFKSRDDDHATRARLASAIPASSDETSATSKARRTKGSKLDADEGSNLQAD
>NZ_CP025113.1|WP_100554856.1|6917756_6918389_+|GNAT-family-N-acetyltransferase
MIQLITEQRYGAFVEALSSMHRLRYRVFKERLEWEVHTTGDMEIDSFDALHPSYLLQRGSDGEVRGCVRLLPSVGPTMLRDTFPMLLAGRSAPSSRAIWESSRFALEIPGEVPTGRHGISRATYELFAAMIEFGLSRQLSDIVTVTDARMERILRRAGWPLRRIGDPRTLGKTTAVAGYLEISNQSLATLRQIGDLAECALWEPVAAATV
>NZ_CP025113.1|WP_100554857.1|6916950_6917667_+|LuxR-family-transcriptional-regulator
MHRVFQDFIDRLSDAGRIEDFADAMTAICAAFELSHFAYLAMPAAGETKPRLISTYPRAWTSYYLARRYQRIDPVITEAFSRTEPFEWGLGHSADRYPPASIFLLEEAAAYGIRAGFTVPIHDGHGPPAALTFASDQRITFLNAQSRAIQLIAMYFHAHVRRGVISERVVDGKALSPREVECLEWASQGKSAWEIGSILGISRHTVASHLDSAKEKLGVRTVVQAATRLLAAKQEKRN
>NZ_CP025113.1|WP_100955362.1|6915532_6916690_-|amino-acid-ABC-transporter-substrate-binding-protein
MRSRLATILARLLLMAATLSLMPSVSLAQAQRDPVLVGVVVPLTGPLAAYGSPFSDAVQIAVDEVNAAGGINGRPIKLQIEDSQASNTVAINALNRLLQSKPVAMFGPALGTQILAMFPTIEREHLPTFAGPSTRRVTQQNVKYFFRATSHDGVTKQLVTRFMLEDLKKSRVGIIHVANEWGYSGRDNVTGYLEQFRQLKPVSVASYQPTDRDLTAQLLQMKSDGADVIFTQGHPVDEALVVRQMRQLNIEIPHVGSASLCATALRHLLTHDELAGRYCEGPDILPELNPNPKVQEFIRKYVAKTRMSPDVNETFYYDVAHMLAEVMKKYGVDRESITKGMREMPYEGIIGTYRADGEGNLWHRAVIMKFLPDGSAKIVRASESE
>NZ_CP025113.1|WP_100554859.1|6914661_6915525_-|branched-chain-amino-acid-ABC-transporter-permease
MTQVIATGFAMGCIYALVGFGFILIYNATHGLNFAHGEFVMFSAYVFYSAFTAGLPIWAAAAVALAIMTAFGAVYYLVLFEPLRKRPMVAFIIATIGVSIMLRNLALIVWGPNPLKMPSFLAMSTIRVGDIALTPENLFIILATFVALVVQYILFFGTDLGRRIRATAQNPEMSELLGIRLNRTIVITFMVSTLLAGIAGVLVAPIFLIDPDMGGGLILKAFIGVIVGGFGSIPGAVVGGLLVGVMEILIAVFVSSTFRDTIVFGLLILLLLTFPRGIFGGPAEDRV
>NZ_CP025113.1|WP_100955361.1|6912817_6914662_-|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease
MTRYLLIALAALAICVLPWLGLPDYYVRLINLTIVFGLLSVSLNIVMGYAGQISLGHAGFFGIGAYTSALLTSGSSGLAFWPCFGLAGVLAGLVGVCVGLPTLRLRGHYLALATLGFGEIMRQLFLNWRAVTHGMDGVGNIPAPSVGGFAFDTNERFFYLGLGVLLAVLLLVSRFDKSIFGLKLRAIRDAELAAGASGVNVTLGKVGALGVSAAIAGLAGSLYAHLLAYISPDVFSFDLTAQLLAMVVIGGAGTVFGPVLGAAAIIFMPEVLRVSDVYYQLIFGAGIVAMILFLPMGLGGWLRDRFPGLSAGRSRPPVAEPAIVASVQGIERASLSIVPSVDEPPKPCPGPLLVARSVSRQFGGLKAVDDLNLEVRAGTVHALIGPNGSGKSTFINMASGIYRVSSGSIEFDGRTIAQDRVWDVADHGLVRTFQNLRLFSSLTVEQNVMVGANVDLRGGLGGVLLGGKASQADVDVLRDQAELAMRFAGVLDLRDRVVKTLPHEVQRMVEIARAVARRPRMIMLDEPAAGLNPNEAERLVERIRRLRQIGITVLIVEHNMPLVMRVADRITVLNFGRKIAEGSPQDIRNDPFVVEAYLGKKLSRRLEQHVSARN
>NZ_CP025113.1|WP_029879509.1|6912120_6912837_-|ABC-transporter-ATP-binding-protein
MSLLAIDGLSTGYGDASDVLHDVSLHVEAGEFVTLIGANGAGKSTALRAIMGLLRPRLGSIRFDGRPVDGLATADIVRLGASMVPEGRGVIPGLSVNDNLRIAATPWKGSGSELLKEIDKIFSLFPVLAQRRNQSAWSLSGGQQQMLAIGRALVARPKLVLLDEPSLGLAPNLVEQVFETLGEINRDGVSILLVEQNALLALEVSHRGYVFELGRVVASAAAADLLADERVSSAYLGG
>NZ_CP025113.1|WP_024582712.1|6911381_6912011_-|flavin-reductase-family-protein
MTAIMSQSSGDDFEQFDLAALSRAERYKILTGAVIPRPIAFVTSLGANGLVNAAPFSQFVILAVDPGLLGFSVGPRAGKSHPKDTLANVKETGEFVINMVPEGWEEAVQRASDEHPPEVSEVDLLGFKTIASAKIRTPRLLGSKIQFECILDQIVNFGDAPNSLVVGRVIAMHVKAGLTVDCKIDPKAYSPVARIGGRNYVRLGDVMKA
>NZ_CP025113.1|WP_024582713.1|6910985_6911279_+|hypothetical-protein
MQIVVTPDGVELRRPDNFREFEALVSGDQLQLPDVLEPDGEQHLWVQEEWLRSALTQANLAAGWQQKYQAMLDYARSKGWVREQPLSVRAHIVRTET
>NZ_CP025113.1|WP_145987247.1|6923026_6924298_+|hypothetical-protein
MKSGQCGYYFEPPTWARQEGCPVHAEALGQDQAIAVDRAENILLPAFDSWRSNGLTDMVPASPALGTFDWLVSVFKAHQKWAEIDFKTQRLYGQGLALFASHELSDGSRAGSKQLADFTKGFVDAIYANLLVVEHKDKWGKIVKRERRRFANAAMTACRRAWYVGQRAQEATVPPVNPFARMGLKSRGPGQSVRETPTATWEELVLFRRAASRLGYHSVATAALLSWEWLQREEHIFGAFENAHYRPKERPDSVKIVHPKNGEEAWWPLFDERRHSLFPELMAELDALKDRIAFGLVFRRDHAHRKSSDLVPWITERKDLRYLRHVVKKIIIAAGLRKELSFTSFRHGGFTEGADSDLTDAELRTAGRHRSRHQLPTYAKRTQKQLIAAAKKRREERTRTGALLGGTLTPISPIDSVKDTSDL
>NZ_CP025113.1|WP_024585003.1|6924349_6925129_-|enoyl-CoA-hydratase/isomerase-family-protein
MTDNSVLLEKRGQALWITINRPDKRNALNAGVIAGIAKGYRDAHDDKDVRVIVLTGAGDKAFCAGADLQNSGAAFSMDFSRPNVDYADLLRLSQNATKPAIARVGGVCMAGGMGLLCMTDMAVAADHVIFGLPEVKVGVFPMQVLSLLQSIAPPRLVNEWALTGEPFDASAAQAAGLLNHVVPAAELDAKVDWLIGRIVDKSPTAIRRGKYAMRAIASMSFDESIAYTESQIALLAMTEDAKEGLKAFGEKRKPSWTGR
>NZ_CP025113.1|WP_024585004.1|6925206_6927306_-|molybdopterin-oxidoreductase-family-protein
MNQHAKVDIRHSTCPHDCPSACALDVEVIEGRSIGRVRGSKLQTYTAGVVCAKVARYAERIHHAERLMYPLRRTGAKGSGQFVRISWDEALDEIAARFDAAEREFGAESVWPYYYAGTMGLVMRDGLNRLSHVKKYSRFYGTICSTIARIGFAVGTGKVAGVDPREMGVSDLVVIWGTNPVNTQVNVMTHASRARKERGAKIAAIDVYNNETMKQADIKILLRPGTDGAFACAVMHVLFREGLADRDYLARYTDCPDELEAHLKTRTPEWASAISGVPVEEIEAFAQLVGTTKRSFFRLGYGFTRSRNGAAQMHAALCIPAVTGAWQYEGGGAFFNNAGIWRFDESIIEGHDAIDPATRVLDQSKIGRVLTGDAEALKGGGPVKAMLIQNTNPMTVAPEQALVRQGFAREDLFVAVHEQFMTETAQMADIVLPATMFMEHDDLYYGGGHQHISVGPKLIDPPGECRSNHEVMQGLGRRLNAVHPGFDMTARELIDATLKKSGHGDIEKLEADIWRDLQPDFRTSHYLDGFAHPDKKFHFRVDWGKVPVGSGGLMGAWDKMPSLPDHWTIIEEADAQHPFRLATSPSRSFLNTSFNETPSSQAREGAPTVMIHPDDAAGLSIADGDAVTLGNMRGETTLTAKLFDGVRRGVLIAESIHPNKSHIGGRGINMLTGAEAVAPVGGAAFHDNKVWIRKAPAAA
>NZ_CP025113.1|WP_024585005.1|6927429_6928467_-|extracellular-solute-binding-protein
MLKGSGAVLAGAALSTRVMAAAPPAEPVTPALIEAAKKEGEVVYYTSTDLPVAEKLAKAFEAKYPYISVRVERTGAERVFQRVGQEYSSNIHAVDVVNSSDAAHFIVWKRDGILAPYVPEEVAKYYPEEHRDPDGQFASFRVWLSIIAYNTNLVKAEEAPKSFADLLDPKWKGKIVKAHPGYSGTIMTATYQMQRDLGWSFFEQLAKQNIMQVQSSTDPPKKLDLGERAVMADGNEYNIFQMKEMSRPVEPVYATEGSPLIVGPNGIFKDCPHPNAARLFQSFALGREGQQLNIEIGGLRSVHAQVKEKAGRRPLKDIKTMKDDPAAVEREGESIKARYSRIFRV
>NZ_CP025113.1|WP_024585006.1|6928780_6929857_+|amidohydrolase
MATRRDVLKAAAGIVFCSCGLMHNANAQQSRQKLPVTVNGKRVKTIDIHAHCHFREAGALLGADAARFQLPPVNGAAEAFIAIDKRLAAMDAQAVDMEVLSINPFWYDRDRDLAAKIVKIQNEKLAELCAAKPDRFAAFASLTLQAPDLAAQELETAIKKQGLKGAAIGGVVDGVEFSDPKFHPVWARAEELGVPLFIHPQGMPELNKRLSGNGWLGNTIANPLETTIALSHLIFEGTLDRFPGLKIIAAHGGGYLPSDRSDHACLVGPKGCNPEIKLRKAPTEYLKQIYFDSLIFTPEAIRHLAAQVGAGQIVLGSDYPYPWQLAPVDHIFACSSLSDDEKANILGRTAAKLLDIVA
>NZ_CP025113.1|WP_024585007.1|6929928_6930198_-|hypothetical-protein
MQGSFDKRQQDPESNYQSFSIKLIALPVLVVIALIGMLVSHPAAVKWISDAAQAEFALTNSVDTDPAPAIAEPAPVAQPGNQIRTVKAY
>NZ_CP025113.1|WP_029880252.1|6930335_6931079_-|Crp/Fnr-family-transcriptional-regulator
MTGAPPIERTAGASSFSSNKLSVLRKHPYFADLEPEAFDQLCRYAKHITLKRGTMIFSKGDPGTSLIAVISGTVKISISSPEGRNAILNLIEAGEIFGEIALLDGLSRTADATANTNCELFVIDRREFIPFVRSQPSLAMKFIELLCERLRRTSDQVEQVILQDLPGRLASALLRLSDKHKREPQGRTISITQQEISEMVGMTRESINKQLRAWATRGWVRLEHGAIVVLKPGSLQELVDAGADDGE
>NZ_CP025113.1|WP_024585009.1|6931358_6932198_-|phosphodiesterase
MSSKPILIAQISDLHIKPPDALAYGRVDTAKALESCVAALNAFAPAPDFVVISGDLVDTPSVEEYDHLKRLLAPLRVPFAGVPGNHDSRAWMRAAFPSAPYAHATGPLDQKIEVDGIDLLLLDSSVAGKPHGALEASTLQWLDAALATAVDRPALLFLHHPPFKGGIWHMDRQDLFNAEELARIVRRHPRVQLIGCGHVHRAMLTTFAGIPVTLCPAPNHAVDLDLGQLREPSFRVEPPAFHLHTWFPGEGFGQLVTHQVPIGQFDGPHPFFGPDGKLL
>NZ_CP025113.1|WP_024585010.1|6932201_6933266_-|ABC-transporter-ATP-binding-protein
MSTSGHGAAVRIEACGKTFADGTRALDPATLDIARGETLVLLGPSGCGKTTMLRIIAGLELPDVGGKVLFDGKDMTSVPIERRNVGMVFQSYALFPNMTVADNIAYGLKIRGVASSERAARVAELVALTNITGLENRRIDQLSGGQRQRVALARAVAIRPGILLLDEPLTALDAALRDRLRSELNRLLRALGITTIYVTHDQAEAMELGDRIVVMRKGAIAQIGTPREVYFMPKDRFVAEFIGAANIVEAPIENGILILPGGRLPIEGGTTTANATVMIRPETIRVTETGAGALAGIVDAVSFIGDRQRLVVSGVSSKPLNVDAPNTIRAEVGDRIGLSIAPDALRVLPSEPRD
>NZ_CP025113.1|WP_024585011.1|6933262_6934048_-|ABC-transporter-permease-subunit
MRDRLIFAGQFIFTLLVAAFLVVPAGLSISAGVTVNYFRGIQSGVTLQWVAQVWELYAGTILLSFVIAFATLAVTLLVGVPAAYALHTRGGRLARIVEEIITLPLAIPGLAIALALLLSYGSFGNFRRSWLFILVGHVIFTMPFMVRSVMAVFATVDIKTLDEGAASLGASPWRRFRDVIVPNALPGILAGALMVVTLSLGEFNLTWMLHTPLTKTLPIGLADSYASMRLEVASAYTLIFFVMIIPLLVAMQLLADKDRKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1773179 : 1783489

uncultured_Mediterranean_phage(100.0%)

integrase

attL 1772788:1772808|attR 1783966:1783986

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1772788:1772808	attL	NA	NA	NA	NA
WP_100951625.1\|1773179_1774187_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	3.5e-11	32.6
WP_168226283.1\|1774183_1775098_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_100951626.1\|1775091_1776318_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_100951627.1\|1776410_1776623_+	hypothetical protein	NA	NA	NA	NA
WP_100951628.1\|1776707_1777010_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_100956146.1\|1777137_1777251_-	DUF736 family protein	NA	NA	NA	NA
WP_043854942.1\|1777406_1777703_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_063928869.1\|1778181_1778658_-	hypothetical protein	NA	NA	NA	NA
WP_043854944.1\|1778626_1780513_-\|integrase	integrase	NA	NA	NA	NA
WP_157817097.1\|1780515_1782396_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_043854945.1\|1782328_1783489_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1783966:1783986	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3877561 : 3886903

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100952810.1\|3877561_3878308_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.0e-11	28.8
WP_024579370.1\|3878291_3878996_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.8e-13	25.7
WP_100952812.1\|3879371_3880028_-	aldolase	A0A077SK32	Escherichia_phage	7.5e-47	48.3
WP_100952814.1\|3880143_3881055_+	NAD-binding protein	A0A077SLF7	Escherichia_phage	9.1e-67	48.5
WP_100952816.1\|3881067_3881850_+	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_100952818.1\|3881846_3883136_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.7e-72	41.0
WP_024579375.1\|3883307_3884999_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-06	27.8
WP_100952820.1\|3885196_3886903_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-12	60.8

DBSCAN-SWA_3

4131235 : 4138297

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100953091.1\|4131235_4132480_+	glycosyltransferase family 92 protein	A0A1V0SD50	Indivirus	1.2e-13	27.0
WP_100956496.1\|4132587_4133142_-	hypothetical protein	NA	NA	NA	NA
WP_024579583.1\|4133322_4134390_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.3e-92	52.0
WP_100953093.1\|4134379_4135291_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.5e-96	58.7
WP_024579585.1\|4135399_4135954_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	5.7e-48	53.1
WP_100953095.1\|4135953_4136865_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	8.3e-28	34.5
WP_100953097.1\|4136989_4138297_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.8e-82	40.8

DBSCAN-SWA_4

5177586 : 5186694

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100954067.1\|5177586_5178609_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.1e-23	41.2
WP_024578320.1\|5178605_5179427_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.8e-29	34.6
WP_100954069.1\|5179449_5180352_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-43	50.9
WP_021081213.1\|5180500_5180734_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.2e-08	63.6
WP_100954071.1\|5180910_5181441_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_024578317.1\|5181437_5182238_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.4e-55	51.6
WP_100954073.1\|5182429_5183761_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.4e-100	52.9
WP_100954075.1\|5183777_5184371_+	hypothetical protein	NA	NA	NA	NA
WP_100954077.1\|5184434_5185202_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.8e-37	36.6
WP_100954079.1\|5185295_5185673_-	response regulator	NA	NA	NA	NA
WP_100956620.1\|5186076_5186694_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.8e-29	49.4

DBSCAN-SWA_5

6853082 : 6860517

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100955339.1\|6853082_6854387_-	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	1.6e-24	26.9
WP_100955340.1\|6854573_6855623_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	9.5e-52	36.4
WP_100955341.1\|6855622_6856681_-	NAD-dependent epimerase/dehydratase family protein	M1I5F1	Acanthocystis_turfacea_Chlorella_virus	7.4e-28	27.1
WP_100955342.1\|6856683_6857616_-	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	2.5e-19	27.4
WP_100955343.1\|6857629_6858577_-	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	6.2e-18	29.1
WP_100955344.1\|6858600_6860517_-	asparagine synthase (glutamine-hydrolyzing)	A0A0G2Y369	Acanthamoeba_polyphaga_mimivirus	2.5e-26	28.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025114

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11354 : 35348

Leptospira_phage(66.67%)

integrase,transposase

attL 27268:27290|attR 33833:33855

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100957021.1\|11354_12302_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-09	24.0
WP_100957023.1\|12422_14141_-	AAA family ATPase	NA	NA	NA	NA
WP_100957025.1\|14302_14644_+	type II toxin-antitoxin system PrlF family antitoxin	NA	NA	NA	NA
WP_100957027.1\|14640_15144_+	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_100957029.1\|15163_16066_+	hypothetical protein	NA	NA	NA	NA
WP_100957031.1\|16261_16450_+	hypothetical protein	NA	NA	NA	NA
WP_100957021.1\|16728_17676_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-09	24.0
WP_100957033.1\|17963_18446_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_100957035.1\|18540_18990_+	mercury transporter MerT	NA	NA	NA	NA
WP_100957037.1\|19005_19305_+	mercury transporter	NA	NA	NA	NA
WP_100957039.1\|19557_20991_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	3.0e-40	28.0
WP_100957041.1\|21020_21797_+	mercuric reductase	NA	NA	NA	NA
WP_157817360.1\|21844_22273_-	hypothetical protein	NA	NA	NA	NA
WP_100957045.1\|22280_24179_-\|integrase	integrase	NA	NA	NA	NA
WP_100957047.1\|24182_26027_-	hypothetical protein	NA	NA	NA	NA
WP_100957251.1\|26013_27174_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
27268:27290	attL	NA	NA	NA	NA
WP_063928869.1\|28414_28891_-	hypothetical protein	NA	NA	NA	NA
WP_043854944.1\|28859_30746_-\|integrase	integrase	NA	NA	NA	NA
WP_157817097.1\|30748_32629_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_043854945.1\|32561_33722_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_024585279.1\|34313_35348_+\|transposase	IS110 family transposase	NA	NA	NA	NA
33833:33855	attR	NA	NA	NA	NA

DBSCAN-SWA_2

191052 : 231110

Leptospira_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100554962.1\|191052_192194_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.5e-38	37.6
WP_100554963.1\|192944_193784_-	universal stress protein	NA	NA	NA	NA
WP_145987136.1\|193854_194493_-	hypothetical protein	NA	NA	NA	NA
WP_100957189.1\|194509_197665_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_080890809.1\|197668_198820_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_043854939.1\|198915_199551_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_024585216.1\|200320_201145_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_019200212.1\|202021_202651_-	carbon monoxide dehydrogenase subunit G	NA	NA	NA	NA
WP_019200213.1\|202650_203493_-	XdhC family protein	NA	NA	NA	NA
WP_019200214.1\|203497_204703_-	VWA domain-containing protein	NA	NA	NA	NA
WP_019200215.1\|204704_205592_-	MoxR family ATPase	NA	NA	NA	NA
WP_024585215.1\|205743_208173_-	carbon-monoxide dehydrogenase large subunit	NA	NA	NA	NA
WP_019200217.1\|208169_208670_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	6.2e-17	36.7
WP_019200218.1\|208691_209558_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_019200219.1\|209728_210937_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_080890817.1\|211060_211642_-	ParA family protein	NA	NA	NA	NA
WP_100957191.1\|212328_213564_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_151650824.1\|214757_215885_-	hypothetical protein	NA	NA	NA	NA
WP_145987137.1\|215836_216367_-	hypothetical protein	NA	NA	NA	NA
WP_024585213.1\|216473_216746_-	hypothetical protein	NA	NA	NA	NA
WP_157817366.1\|216886_217738_-	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_024585211.1\|218143_219214_-	maleylacetate reductase	NA	NA	NA	NA
WP_024585210.1\|219227_219806_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157817367.1\|219941_220787_+	amidohydrolase family protein	NA	NA	NA	NA
WP_024585208.1\|220806_221358_+	TRAP transporter small permease	NA	NA	NA	NA
WP_024585207.1\|221354_222683_+	TRAP transporter large permease	NA	NA	NA	NA
WP_029880289.1\|222723_223764_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_024585205.1\|223814_224543_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_024585204.1\|224539_225166_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_024585203.1\|225251_226430_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_024585202.1\|226516_227629_-	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_051404400.1\|227709_227949_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157817368.1\|228697_229360_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.2e-05	28.7
WP_100957199.1\|229571_231110_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.5e-125	45.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025113

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025114

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection