CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017950	Tenericutes bacterium MZ-XQ chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,Cas14u_CAS-V,DinG	0	0	8	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017950_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017950_1

1151322-1151410

Orphan

Consensus_repeat	Method
AAAGCTGAAGGTGAAGCTGAAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017950_1

>merge|NZ_CP017950|1|1151322-1151410|CRISPRCasFinder
ATTCTTAAAGCTGAAGGTGAAGCTGAAGCTGTTATTCTAAGAGCAAATGCTGTTAAAGAACAAAAGATTAGAGAAGCTGAAGGTGAAGC

>NZ_CP017950|1|1|1151322-1151410|CRISPRCasFinder
ATTCTTAAAGCTGAAGGTGAAGC	TGAAGCTGTTATTCTAAGAGCAAATGCTGTTAAAGAACAAAAG
ATTAGAGAAGCTGAAGGTGAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017950.1\|WP_106700436.1\|1154746_1155544_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP017950.1\|WP_106700439.1\|1156889_1158266_-\|dipeptidase-PepV	unknown	unknown	gnl\|CDD\|235988
NZ_CP017950.1\|WP_106700438.1\|1156010_1156877_-\|thymidylate-synthase	unknown	unknown	gnl\|CDD\|234984
NZ_CP017950.1\|WP_106700424.1\|1142735_1144130_-\|PLP-dependent-lyase/thiolase	unknown	unknown	gnl\|CDD\|366004
NZ_CP017950.1\|WP_106701821.1\|1147865_1148447_+\|Holliday-junction-resolvase-RecU	unknown	unknown	gnl\|CDD\|235015
NZ_CP017950.1\|WP_106700441.1\|1159352_1159916_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP017950.1\|WP_106700434.1\|1152786_1154082_-\|pyrimidine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|274244
NZ_CP017950.1\|WP_106700428.1\|1146065_1147739_-\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
NZ_CP017950.1\|WP_106700442.1\|1159923_1160226_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367559
NZ_CP017950.1\|WP_106700425.1\|1144126_1144414_-\|2-amino-4-ketopentanoate-thiolase	unknown	unknown	unknown
NZ_CP017950.1\|WP_106700433.1\|1151660_1152785_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224441
NZ_CP017950.1\|WP_106700440.1\|1158339_1159356_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NZ_CP017950.1\|WP_106700437.1\|1155540_1156014_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|365932
NZ_CP017950.1\|WP_106700432.1\|1150241_1150664_+\|NfeD-family-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP017950.1\|WP_106700435.1\|1154165_1154750_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP017950.1\|WP_106700431.1\|1149863_1150238_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017950.1\|WP_106700427.1\|1145559_1146057_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	unknown	unknown	gnl\|CDD\|376665
NZ_CP017950.1\|WP_106700429.1\|1148428_1149121_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370542
NZ_CP017950.1\|WP_106700430.1\|1149344_1149794_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223407
NZ_CP017950.1\|WP_106700426.1\|1144427_1145477_-\|NADP-binding-protein	unknown	unknown	gnl\|CDD\|226326

Protein	Function_ID	Function_description	E-value
NZ_CP017950.1\|WP_106700439.1\|1156889_1158266_-\|dipeptidase-PepV	gnl\|CDD\|235988	PRK07318, PRK07318, dipeptidase PepV; Reviewed.	0
NZ_CP017950.1\|WP_106700436.1\|1154746_1155544_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	3.982e-40
NZ_CP017950.1\|WP_106701821.1\|1147865_1148447_+\|Holliday-junction-resolvase-RecU	gnl\|CDD\|235015	PRK02234, recU, Holliday junction-specific endonuclease; Reviewed.	5.27849e-93
NZ_CP017950.1\|WP_106700424.1\|1142735_1144130_-\|PLP-dependent-lyase/thiolase	gnl\|CDD\|366004	pfam00291, PALP, Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.	8.22605e-52
NZ_CP017950.1\|WP_106700432.1\|1150241_1150664_+\|NfeD-family-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	1.08557e-17
NZ_CP017950.1\|WP_106700440.1\|1158339_1159356_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	3.67324e-11
NZ_CP017950.1\|WP_106700435.1\|1154165_1154750_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	6.13174e-40
NZ_CP017950.1\|WP_106700442.1\|1159923_1160226_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|367559	pfam03551, PadR, Transcriptional regulator PadR-like family. Members of this family are transcriptional regulators that appear to be related to the pfam01047 family. This family includes PadR, a protein that is involved in negative regulation of phenolic acid metabolism.	1.3184e-16
NZ_CP017950.1\|WP_106700438.1\|1156010_1156877_-\|thymidylate-synthase	gnl\|CDD\|234984	PRK01827, thyA, thymidylate synthase; Reviewed.	0
NZ_CP017950.1\|WP_106700433.1\|1151660_1152785_-\|hypothetical-protein	gnl\|CDD\|224441	COG1524, COG1524, Uncharacterized proteins of the AP superfamily [General function prediction only].	2.14152e-06
NZ_CP017950.1\|WP_106700437.1\|1155540_1156014_-\|dihydrofolate-reductase	gnl\|CDD\|365932	pfam00186, DHFR_1, Dihydrofolate reductase.	7.55006e-52
NZ_CP017950.1\|WP_106700434.1\|1152786_1154082_-\|pyrimidine-nucleoside-phosphorylase	gnl\|CDD\|274244	TIGR02644, Thymidine_phosphorylase, pyrimidine-nucleoside phosphorylase. In general, members of this protein family are designated pyrimidine-nucleoside phosphorylase, enzyme family EC 2.4.2.2, as in Bacillus subtilis, and more narrowly as the enzyme family EC 2.4.2.4, thymidine phosphorylase (alternate name: pyrimidine phosphorylase), as in Escherichia coli. The set of proteins encompassed by this model is designated subfamily rather than equivalog for this reason; the protein name from this model should be used when TIGR02643 does not score above trusted cutoff. [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_CP017950.1\|WP_106700441.1\|1159352_1159916_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.77631e-05
NZ_CP017950.1\|WP_106700427.1\|1145559_1146057_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	gnl\|CDD\|376665	pfam01923, Cob_adeno_trans, Cobalamin adenosyltransferase. Cobalamin adenosyltransferase This family contains the gene products of PduO and EutT which are both cobalamin adenosyltransferases. PduO is a protein with ATP:cob(I)alamin adenosyltransferase activity. The main role of this protein is the conversion of inactive cobalamins to AdoCbl for 1,2-propanediol degradation.The EutT enzyme appears to be an adenosyl transferase, converting CNB12 to AdoB12.	8.80367e-39
NZ_CP017950.1\|WP_106700429.1\|1148428_1149121_-\|hypothetical-protein	gnl\|CDD\|370542	pfam09515, Thia_YuaJ, Thiamine transporter protein (Thia_YuaJ). Members of this protein family have been assigned as thiamine transporters by a phylogenetic analysis of families of genes regulated by the THI element, a broadly conserved RNA secondary structure element through which thiamine pyrophosphate (TPP) levels can regulate transcription of many genes related to thiamine transport, salvage, and de novo biosynthesis. Species with this protein always lack the ThiBPQ ABC transporter. In some species (e.g. Streptococcus mutans and Streptococcus pyogenes), yuaJ is the only THI-regulated gene. Evidence from Bacillus cereus indicates thiamine uptake is coupled to proton translocation.	5.48713e-14
NZ_CP017950.1\|WP_106700428.1\|1146065_1147739_-\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	2.40246e-166
NZ_CP017950.1\|WP_106700430.1\|1149344_1149794_+\|hypothetical-protein	gnl\|CDD\|223407	COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones].	5.48708e-09
NZ_CP017950.1\|WP_106700426.1\|1144427_1145477_-\|NADP-binding-protein	gnl\|CDD\|226326	COG3804, COG3804, Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown].	6.79695e-42

>NZ_CP017950.1|WP_106700432.1|1150241_1150664_+|NfeD-family-protein
MEWLIWVWLGIFVFALAFEFATADMVSIWFSLGATPSFIFALIGLPEWLQILSFIVVTTVLFLFTRPVVMKYFKVNEIKTNVDSVIGQEGYVTTDITPSTVGVVKLRSQEWSAISDETIVTGEKVRVFDVEGVKLIVKKI
>NZ_CP017950.1|WP_106700431.1|1149863_1150238_+|hypothetical-protein
MQITWFNEKPKDCIVTLAKGNLTLNKPATTFFETAYSVMLGYNKDDMKIFIKPLDKEHALRHDIPDNNKYRITVKSSYSRVTNKAFMDEICEMAHIDLSEDVKKYKASWSEKEQILIVDLKEEA
>NZ_CP017950.1|WP_106700430.1|1149344_1149794_+|hypothetical-protein
MPNEVITAILVMFALLLMILIPSFKIVRINEVMFIERLGKFHRMIDQPGIHFIVPLIDRNIETVSLEQIHVKKTLKYKIEDDIKHIEVSYDMQIFEPKTFVYGALDSRETIHQYIIDSMIHQVDKLDIIEETIDYAKTYGFHIRNLNLK
>NZ_CP017950.1|WP_106700429.1|1148428_1149121_-|hypothetical-protein
MNQSIETKKMIATINLLAIAIVLDVVLSSIPGLNLSMPFGGKFFGLSMLPIVLIGLMFGLKYGLISGFIYALYNFGVDYIVYLETLRITLEGWTGESWGAFRIFLLILFDYIIPFMAFGLSGLFKNGLDQRMQFIYAFLLVSAIRLASSTLSGVILWSSSIEYASSQVEAGNESPNIATQIFAFVGNKIWLYSLGYNFIYITTTLATTLVIGLLVYRRLQVLNRDYFLAK
>NZ_CP017950.1|WP_106701821.1|1147865_1148447_+|Holliday-junction-resolvase-RecU
MNYPIKRKKQEKINNRANLGMTLEGDIETTNNYYLNADIAVIHKKPTPIQVVNVSYPARNKAKIVEAYYKTPSTTDFNGIYKGKYIDFDAKETNSKTSMPLKNIHSHQIEHLRHVENHGGIAFLIVHFKQFDEYFMLPAHVLFKYWDLQFDEKKGRKSIPYSAFKNEAFPIQFGFSPRLDYLKVIDKYYFAKK
>NZ_CP017950.1|WP_106700428.1|1146065_1147739_-|ribonuclease-J
MSQIRFFALGGLGENGKNMYVVDVDKDLFILDTGIKYPSAELYGVDEIIPDYRVLIRAKDRIKGIFLSHAHEDHISALPHILKDLNVPVYATNFTMQIVKDLLKEEEFNLEDYKLNTITQNSIIKFGSVRVSFFNTTHSIPESIGIAIHTLDGVIVYTSDFTFDQSGHIQYHTDFKKINELAEKNVLALLMESLGSTLILNGGVNQNLNSKLNSVFANAEGRIIVSLFSSDLKKIQRVVDMCLAHHKKIAIIGRRAQRIVDIAIGDGYLDIPKSSLVNLKFIDDKNKNDDKDIVALVTGNRHEPFFMLQRMCKRIDRLIHISDQDTVILMTPPVPGTEKMAARTLDVLYRSDAKVENIDKRLLTAAHATGEELKMMMNLLKPKYIVPTIGEYRHQYGLKRLAVEIGYDPEEVFILDNGDVLNIKDKDAFVSRNEITVGDILIDGTAVGDVNDYVMKDRELLAEDGALLIVAHVSPKQKKILGEVEIVTKGFVYVQESEEILTKVKELFYKTSEKHLNGKYINWNEFKRDVRNDINRYIYQEIRRSPITIPVIISTEL
>NZ_CP017950.1|WP_106700427.1|1145559_1146057_-|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase
MKIYTKRGDSGETDLLVRRVKKNDFHIEVNGQIDEVMATILVAKQHIKDQKTLDLLDKIHYTFYQMAYEIALDDLKQIKVFETDVLLLEKEIDHMDETLEKLTKFIQLDQNLAQAWLNMCRVKTRALERVLVELDSHKKVNDHTLKYVNRLSDFFFTLGRTYEIR
>NZ_CP017950.1|WP_106700426.1|1144427_1145477_-|NADP-binding-protein
MRTVKVVIWGFGAMGQGMADMLLTKKGVEIVGVCDINPKIVGKKVNDLLESKASCDAVISNDIDHLLDEQKPDVVMLCTDSFVKGAFQKIKKVVEKKVNCITTAEEMAYPYQSHKALSEEMDELAKKHGVTILGTGINPGFVMDFLVLALTGTMKDVSHIDVKRVNSLSPFGPAVMDEQGVGDTLEKYHERIENNDLAGHVGFNQSVHMIFKGLGIHPTRFEQQMKPIITTVDRKSKYGFAKKGTLAGINMTAQGYMGDDQFLNMDHPQQIEPNLEGVHTGDYIDIYGSPDIHMAITPEIEGGLGTIAICVNMIPHVINARPGLKTMLDLPIPRAILGDMRDMIEEELV
>NZ_CP017950.1|WP_106700425.1|1144126_1144414_-|2-amino-4-ketopentanoate-thiolase
MIQKGTYVMVKKIVLKHNERSNNLPEDTKTKDYMMKIKGFLLEDANLNDLVEIETTTKRKVEGILIEVNPSYTHSFGDHVDEIDVMKSIILEETR
>NZ_CP017950.1|WP_106700424.1|1142735_1144130_-|PLP-dependent-lyase/thiolase
MTDYEMMMSKRQAIMKSSLQLDYEQFELEGIAFDYEKMMNDAGYTFEEVQKIQIENHVGQTPLVELKNITEYARKFAKKGFGARIFLKDEALNLSGSFKARRAAISVYHAKKLGYKGVVAATSGNYGAAVAAMAARLKLKCIIVQEVFDSNEKNQPEIVEKARACEAYGAEVIQLSVGPELFYEFLLILEETGYFNASLYSPYGVKGIETLGYEIAEEMLRKEGKYPEVVIATNAGGGNLTGTARGLKYHGANHTRIVGASVDLTGLHMASDHDFNLKSFTTGHTGFGIPFATYPDRSDVPRSAARPLRYMDEYVLVNQGAVFFMTEALSLLEGMERGPAGNTSLAAAFSMAQELPEDFIIVVQESEYTGAGKHFNSQIAFAKSQGITLTFGHPLDEKPGKNLVFPTSGSLIKHKSLDMNQLKMSYLKRYKNHEFSMTELKYLEDELRVNQQTIIEMVGKINES
>NZ_CP017950.1|WP_106700433.1|1151660_1152785_-|hypothetical-protein
MDVKYPDYNNSILNVSHTILDYYKAESKYPVIPELKKVLDLGFKHVALILLDGMGTNILEKHLDDQSFLRKHMIKKITSVFPPTTVAATNAVLTTKPPIVSGYLGWVQYFKKENTNHVVFLNEDFYDTKRTFHNNLRETYMKQDLIYDYIKRANTDVETYELFPDFRPNGYKTFHLELKRLKEITNKNQKSFSYLYWAYPDLLEHETGICSEHVKVELEKLNHDLEMFSQTMNEDTVIIVIADHGLIDVEPIELYKHEELMKMLLRMPSIEPRATNFFVKPFKKHKFKKMFNETYGNDYKLLSKRELIYSGLLGQGEQHPLIDSFLGDFMAISISNKYFKFKEGKLFKAHHAGLLAGEMEVPLIVYHKKNERLK
>NZ_CP017950.1|WP_106700434.1|1152786_1154082_-|pyrimidine-nucleoside-phosphorylase
MHIVDIITKKRDGHALTKQEIEYVISAYTKGDIPDYQISAFLMATYFNQMNDEEATYLALAMRDSGDSIDLSDIKGIKVDKHSTGGVGDKVTLILGPLLASLGAKFAKMSGRGLGHTGGTIDKLESIPGYQVEIKVEDFIKQVQEIGIAVVGQSGDVAPADKKLYALRDVTATVDCIPLIASSIMSKKLASGADAICLDVKVGHGAFMKTEEEAEKLAKLMVEIGKLAGKKVTAILTGMDEPLGHKIGNALEVYEAIETLHGKGPKDLVEVTLTIGEQLLLDANLASNQKEARTMLEAALNDGRAYQKFLELVEAQGGDIDPLKHPENLLSDKTVEVLVPKDGYITEMNALDIGKAAMRLGAGRETKEDQILLDVGIDLHKKIGDQVKKGDVLATLYVRNKGIDEAKSLLLDAITIGQEKTEIVLIKKKIS
>NZ_CP017950.1|WP_106700435.1|1154165_1154750_+|histidine-phosphatase-family-protein
MILAMVRHGQTQYNLKGIIQGRIDNPLNDHGKDQAKKVGAFLNNREHNFDAILSSPLSRALETAFIIKNELKMHHSIHVIQRFVERDFNHLDGKPVEIGMPLVRQKGYTHPGYEDDEKLIHRVVKSALQLEKGYHNKQILCVAHSHVIKALMTYAEPTKYQISNYMLDNGDIIYFEIKNQQVRVLKHEKMTSES
>NZ_CP017950.1|WP_106700436.1|1154746_1155544_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MITTVFLLIAVLFTAMMHVIVESSYYILPLWFLLSLVVSFILTILFVVIQLPLLLKLSYMSKYKNYVYRSVAYFLNRFILRLKLEVEGLENVPKDGRLTIYANHKSYADPVIMMEIINRPTSYTPKMPVYKIPIMHTLLKSVGAFPIDRTSDRNTARAMVDAVKVIKQGVAMVIFPEGGIKDRNDIKMVAMRAGAYRVGMKAEADLLPVSIQGTTDIKHRAPFRSTHIKVTVHEVIKYQDVKDLKTSDLADKVFNIINSSLEKND
>NZ_CP017950.1|WP_106700437.1|1155540_1156014_-|dihydrofolate-reductase
MISMIWAMDENWLIGKDNVLPWHYPKDLAYFKNKTKNEAVLMGDMTYQSLKGYYKTKPLPFKKVYVANIMDAFYPDAIHVKDIFTFIKETKEDIFIIGGKTIYKLLLPHADRLYITYVLGRHEGNVYFPSFDLSKFKLIDKKMEDRLIFATYERKVV
>NZ_CP017950.1|WP_106700438.1|1156010_1156877_-|thymidylate-synthase
MKAYLDLCRHVLEHGTFKMDRTKTGTKSVFGYQMRFDLSEGFPLLTTKKVHLRSIIHELLWFISGNTNIKYLVDNGVRIWNEWPYEIFKKSKDYQGESMNDFVEKIKSDDDFATKYGDLGPVYGAQWRNFNGIDQLQYILDELKNNPNSRRMILSAWNPSEIHSMALPPCHTLIQFYVADGRLSLQLYQRSADIFLGVPFNIASYALLLMMVAQVTGYKVGEFVHTLGDAHIYQNHFDQIKLQLSRTPKQPPKMILNPNVKSLYDFKYEDFELKDYDPHPAIKGKVAV
>NZ_CP017950.1|WP_106700439.1|1156889_1158266_-|dipeptidase-PepV
MKIDFKQEVINRKDDIIRDLKGLIKINSELTTYDANRKGAPFGEGIKEALDFMLQLGEKDGFDIVNLDGYAGHISYGNQKEYVGTIGHLDVVPAGNDWTYPPYGAEIHDNKMYGRGTEDDKGPTIAIYYALKILKELGVPLSKRIKLILGTDEETAWRGVRHYFSVYPEIPVSGFIPDADFPLIYAEKGISRIFIEGKLESKDIISVKGGFRDNMVPDYAEAYLNPTKSFDQLFKAFLKENNYQGVVEKQNQQFYIKVVGKSAHGSTPQFGENAIDRLFEFFMYAGLEDEIVKLAEERLIKDIHGNKLGVNYRDEEMGDLTINLGALSTTDGMYRFNLNLRYPNGVDFDQVVQLINENVQIYDAKATVDNHQELLYVDPKSDLVQSLLKVYRKHTGDMTEPIIIGGGTFARALPNSVAFGPHFLDKPTYIHQKNEFIDLDDFFKAIIIYTEALYELAK
>NZ_CP017950.1|WP_106700440.1|1158339_1159356_-|DUF4097-family-beta-strand-repeat-protein
MRTMMKVLFILLGVGVIFVMAAIIFVPEWSLVAGTFNSDRDYGEMITHEEDQVITGIKLELENRHIVVNNVDQDELTINYYAEENDTFTFDIVDDVFVMTHDFESFWLNIFSWNMVSREYVTVTVNIPETWTLESVDLKTMTGDIDMDFDDEKTYQNVRLYNRTGSMDISNVTALELYAHTDTGDIFMSDINVSGDYEVELSTGDMTLNGVSANTFSAKSSTGDIELMDITANDATVDNSTGRISISDSTFTSLNADISTGRIVLNHVIANSYILESSTGDIVVTLSTIDDYRFDLETDTGKIKINGNSQGDEYQSLNGSIIFSANTNTGNITIEVDA
>NZ_CP017950.1|WP_106700441.1|1159352_1159916_-|DUF1700-domain-containing-protein
MEKWLKTLEQRLSKKFNKTEVDEVISYYEEIINDRLEHGEAIEDILKQYHMATIERDMMVSELSKREVNSIQDLFKTVFQFFFILIATPLWIPIAVIYFVSFVIVFVFFIVSIAIFFSGLAAIIYYIAVAFTDMTSFLEVTGYIGVGLIVMSILSLISLWFYKASQGVAKGLFKVFVNLIKKYRGVK
>NZ_CP017950.1|WP_106700442.1|1159923_1160226_-|PadR-family-transcriptional-regulator
MKQQLKKGVIEIFVLALLSKGDSYGYKLIQDLSDFVEISESTLYPILRRLEKAGQLKTYNALYQGRNRKYYQITKAGYQAIDDFLDEWKDIKKIYDLLTK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

241882 : 248124

Streptococcus_phage(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106699542.1\|241882_242740_-	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.4e-24	28.4
WP_106699543.1\|242736_243048_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.1e-11	35.0
WP_106699544.1\|243243_244047_+	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	7.4e-20	32.1
WP_106699545.1\|244022_244871_+	energy-coupling factor transporter ATPase	W5SAS9	Pithovirus	1.6e-12	26.4
WP_106699546.1\|244863_245844_+	hypothetical protein	NA	NA	NA	NA
WP_106699547.1\|245844_246567_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_106699548.1\|246580_247183_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.3e-42	46.0
WP_106699549.1\|247179_248124_+	AAA domain-containing protein	M1NSC1	Streptococcus_phage	7.6e-16	32.8

DBSCAN-SWA_2

293103 : 343270

Streptococcus_phage(36.36%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106699417.1\|293103_294270_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_106699588.1\|294520_295708_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	2.5e-48	35.1
WP_106699589.1\|295700_296507_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_106699590.1\|296510_297134_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_106699591.1\|297231_297579_+\|transposase	transposase	NA	NA	NA	NA
WP_157825106.1\|297575_298427_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-28	29.9
WP_106699593.1\|298520_299186_+	hypothetical protein	NA	NA	NA	NA
WP_106699594.1\|299383_299797_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_106699595.1\|299850_300321_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_106699596.1\|300339_302412_+	elongation factor G	E4ZFJ7	Streptococcus_phage	9.3e-59	25.3
WP_106699597.1\|302503_303688_+	elongation factor Tu	A0A142CJQ8	Brazilian_marseillevirus	9.8e-21	29.7
WP_106699499.1\|303819_304140_-	hypothetical protein	NA	NA	NA	NA
WP_157824872.1\|304132_305458_-	hypothetical protein	NA	NA	NA	NA
WP_106699598.1\|305586_306777_+	MFS transporter	NA	NA	NA	NA
WP_157824877.1\|306872_307649_+	TatD family hydrolase	NA	NA	NA	NA
WP_106699600.1\|307638_308721_+\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	9.6e-07	23.5
WP_106699601.1\|308717_309179_+	CinA family protein	NA	NA	NA	NA
WP_106699602.1\|309289_309577_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_106699603.1\|309578_310019_+	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	6.4e-34	49.7
WP_106699604.1\|310030_310267_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_106699605.1\|310304_310715_-	hypothetical protein	NA	NA	NA	NA
WP_106699606.1\|310711_311158_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_106699607.1\|311167_311701_-	hypothetical protein	NA	NA	NA	NA
WP_106699608.1\|311921_314357_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_106699609.1\|314366_315719_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-92	44.6
WP_157824878.1\|316399_316864_+	NUDIX domain-containing protein	A0A1X6WFB1	Pacmanvirus	6.6e-05	36.6
WP_106699611.1\|317083_317305_+	hypothetical protein	NA	NA	NA	NA
WP_106699612.1\|317321_317714_+	hypothetical protein	NA	NA	NA	NA
WP_106699613.1\|318200_318413_+	hypothetical protein	NA	NA	NA	NA
WP_106699614.1\|318430_318943_+	hypothetical protein	NA	NA	NA	NA
WP_106699499.1\|319554_319875_-	hypothetical protein	NA	NA	NA	NA
WP_157824872.1\|319867_321193_-	hypothetical protein	NA	NA	NA	NA
WP_106699615.1\|321309_322467_+	hypothetical protein	NA	NA	NA	NA
WP_106699616.1\|322879_323089_+	hypothetical protein	NA	NA	NA	NA
WP_106699617.1\|323099_323684_+	hypothetical protein	NA	NA	NA	NA
WP_106699618.1\|323731_324262_+	hypothetical protein	NA	NA	NA	NA
WP_157824879.1\|324341_324629_+	hypothetical protein	NA	NA	NA	NA
WP_106699620.1\|324838_325765_+	hypothetical protein	NA	NA	NA	NA
WP_106699621.1\|325823_326051_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_106699622.1\|326055_328530_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.8e-94	32.4
WP_106699623.1\|328513_329443_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_106701782.1\|329537_331589_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.2e-79	32.8
WP_157824880.1\|331676_332234_-	hypothetical protein	NA	NA	NA	NA
WP_106701784.1\|332242_332500_-	metal-sensing transcriptional repressor	NA	NA	NA	NA
WP_106699625.1\|332668_332998_+	hypothetical protein	NA	NA	NA	NA
WP_106699626.1\|332999_333611_+	hypothetical protein	NA	NA	NA	NA
WP_106699627.1\|333691_334372_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-21	28.8
WP_106699628.1\|334364_335597_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_106699629.1\|336312_336807_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_106699630.1\|336796_337117_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_106699631.1\|337419_338109_+	hypothetical protein	NA	NA	NA	NA
WP_106699417.1\|338569_339736_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_106699632.1\|339987_340539_+	AAA family ATPase	NA	NA	NA	NA
WP_106699633.1\|340699_341152_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106699634.1\|341207_341720_+	hypothetical protein	NA	NA	NA	NA
WP_106699635.1\|341757_342804_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_106699591.1\|342922_343270_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

524982 : 578982

Streptococcus_phage(30.77%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106699417.1\|524982_526149_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_106699869.1\|526228_526477_-	helix-turn-helix transcriptional regulator	S5M643	Brevibacillus_phage	1.4e-06	48.2
WP_106699871.1\|526479_526914_-	hypothetical protein	NA	NA	NA	NA
WP_106699873.1\|527078_529838_+	hypothetical protein	NA	NA	NA	NA
WP_106699875.1\|529879_530377_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106699876.1\|531236_531950_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_106699878.1\|531955_532597_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_106699880.1\|532593_533421_-	hypothetical protein	NA	NA	NA	NA
WP_106699882.1\|533493_533733_-	hypothetical protein	NA	NA	NA	NA
WP_106701794.1\|533734_534286_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157824898.1\|534420_535857_-	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	5.4e-05	24.0
WP_106699886.1\|535867_537265_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-27	28.1
WP_106699888.1\|537957_538446_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106699889.1\|538442_539414_-	hypothetical protein	NA	NA	NA	NA
WP_106699891.1\|539416_540172_-	hypothetical protein	NA	NA	NA	NA
WP_106699892.1\|540152_540854_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-31	36.6
WP_106699894.1\|541015_541468_+	hypothetical protein	NA	NA	NA	NA
WP_157824899.1\|541512_542853_-	hypothetical protein	NA	NA	NA	NA
WP_106699897.1\|542883_543441_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106701796.1\|543537_544413_+	helix-turn-helix domain-containing protein	D0R0F8	Streptococcus_phage	1.0e-11	41.7
WP_157824900.1\|544450_545389_-	membrane dipeptidase	NA	NA	NA	NA
WP_157824901.1\|545397_546186_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157824902.1\|546185_546701_-	hypothetical protein	NA	NA	NA	NA
WP_106699904.1\|546709_547444_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_106699906.1\|547409_548162_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_106699908.1\|548483_549371_-	hypothetical protein	NA	NA	NA	NA
WP_106699910.1\|549626_550973_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	9.0e-87	41.8
WP_106699911.1\|551248_551950_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_106699912.1\|551939_552644_-	hypothetical protein	NA	NA	NA	NA
WP_106699913.1\|552911_553355_-	hypothetical protein	NA	NA	NA	NA
WP_106699914.1\|553550_554429_+	hypothetical protein	NA	NA	NA	NA
WP_157824903.1\|554436_555231_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_106699916.1\|555269_555719_-	hypothetical protein	NA	NA	NA	NA
WP_106699917.1\|555722_556112_-	FMN-binding protein	NA	NA	NA	NA
WP_106699918.1\|556117_556579_-	hypothetical protein	NA	NA	NA	NA
WP_106699919.1\|556698_558564_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	5.3e-21	28.2
WP_106699920.1\|558690_559392_-	response regulator transcription factor	NA	NA	NA	NA
WP_106699921.1\|559675_560776_-	glycerate kinase	W6LM47	Streptococcus_phage	8.5e-35	36.0
WP_106699922.1\|561033_562161_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_106699923.1\|562242_563766_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.3e-12	32.0
WP_106699924.1\|563758_564868_+	ABC transporter permease	NA	NA	NA	NA
WP_106699925.1\|564864_566034_+	ABC transporter permease	NA	NA	NA	NA
WP_106699926.1\|566084_566492_-	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_106699927.1\|566537_567263_-	hypothetical protein	NA	NA	NA	NA
WP_106699928.1\|567278_567890_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_106699929.1\|567996_568443_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106699930.1\|568744_569224_-	hypothetical protein	NA	NA	NA	NA
WP_106699931.1\|569236_570601_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.6e-54	29.9
WP_106699932.1\|570712_571888_-	acetate kinase	NA	NA	NA	NA
WP_106699933.1\|571969_572629_-	hypothetical protein	NA	NA	NA	NA
WP_106699934.1\|572615_573158_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_106699935.1\|573208_574645_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	3.4e-124	49.1
WP_106699936.1\|574741_575458_+	YaaA family protein	NA	NA	NA	NA
WP_106699937.1\|575458_576943_+	cardiolipin synthase	NA	NA	NA	NA
WP_106699938.1\|576995_577694_-	hypothetical protein	NA	NA	NA	NA
WP_106699939.1\|577849_578125_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	4.0e-18	50.0
WP_157825108.1\|578106_578982_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.9e-64	49.0

DBSCAN-SWA_4

732835 : 743789

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106700072.1\|732835_735178_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.0e-117	36.2
WP_025724738.1\|735192_735558_-	winged helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	2.3e-13	38.7
WP_157824915.1\|736001_736817_-	hypothetical protein	G8DDA3	Micromonas_pusilla_virus	3.7e-11	27.0
WP_106700074.1\|737302_738025_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_106700075.1\|737924_739826_-	cation-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.5e-100	36.3
WP_106700076.1\|739822_740038_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_106700077.1\|740777_741320_-	helix-turn-helix transcriptional regulator	A0A0C5ACE9	Bacillus_phage	3.5e-05	44.1
WP_106700078.1\|741452_742595_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106700079.1\|742670_743789_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.3e-34	35.3

DBSCAN-SWA_5

1365954 : 1395761

Mycobacterium_phage(12.5%)

head,portal,capsid,transposase,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106700635.1\|1365954_1367151_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_106700636.1\|1367147_1367819_-\|head,protease	HK97 family phage prohead protease	A0A076YKE5	Mycobacterium_phage	7.5e-18	37.1
WP_106700637.1\|1367802_1369029_-\|portal	phage portal protein	NA	NA	NA	NA
WP_106700638.1\|1369031_1370723_-\|terminase	terminase large subunit	A0A0P0IJU3	Lactobacillus_phage	1.5e-67	31.2
WP_106700639.1\|1370715_1371039_-	hypothetical protein	NA	NA	NA	NA
WP_157824964.1\|1371163_1371862_-	HNH endonuclease	A0A0K2CYS9	Paenibacillus_phage	1.0e-09	45.2
WP_106700641.1\|1371855_1372344_-	hypothetical protein	NA	NA	NA	NA
WP_106700642.1\|1372646_1374194_-	hypothetical protein	Q7Y4K1	Streptococcus_phage	1.2e-05	46.7
WP_106700643.1\|1374193_1374595_-	hypothetical protein	NA	NA	NA	NA
WP_106700644.1\|1374587_1374914_-	hypothetical protein	NA	NA	NA	NA
WP_106700645.1\|1374906_1375722_-	ATP-binding protein	H7BV58	unidentified_phage	3.6e-06	31.9
WP_106700646.1\|1376442_1376892_-	hypothetical protein	NA	NA	NA	NA
WP_157824966.1\|1376881_1377322_-	hypothetical protein	NA	NA	NA	NA
WP_106700648.1\|1377485_1378196_-	hypothetical protein	NA	NA	NA	NA
WP_106700649.1\|1378192_1378429_-	hypothetical protein	NA	NA	NA	NA
WP_106700650.1\|1378425_1378776_-	hypothetical protein	NA	NA	NA	NA
WP_106700651.1\|1378786_1379254_-	hypothetical protein	NA	NA	NA	NA
WP_106700653.1\|1379604_1380135_+	hypothetical protein	NA	NA	NA	NA
WP_106700654.1\|1380337_1380979_+	hypothetical protein	NA	NA	NA	NA
WP_106700655.1\|1381124_1381838_+	hypothetical protein	NA	NA	NA	NA
WP_106700656.1\|1382576_1382861_-	hypothetical protein	NA	NA	NA	NA
WP_106700657.1\|1382872_1383145_-	hypothetical protein	NA	NA	NA	NA
WP_106700658.1\|1383141_1383882_-	hypothetical protein	NA	NA	NA	NA
WP_106700659.1\|1383883_1384336_-	hypothetical protein	NA	NA	NA	NA
WP_106700660.1\|1384418_1384850_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700661.1\|1384846_1385311_-	hypothetical protein	NA	NA	NA	NA
WP_106700662.1\|1385342_1385537_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700663.1\|1385722_1386073_+	hypothetical protein	A0A0A7RTU8	Clostridium_phage	1.9e-12	40.2
WP_157824968.1\|1386120_1387635_+	recombinase family protein	A0A2K9V2Y5	Faecalibacterium_phage	1.4e-59	33.0
WP_157824970.1\|1387598_1388783_-	hypothetical protein	NA	NA	NA	NA
WP_106700666.1\|1388995_1389691_-	hypothetical protein	NA	NA	NA	NA
WP_106700667.1\|1389780_1390476_-	hypothetical protein	NA	NA	NA	NA
WP_106700668.1\|1390536_1391511_-	aromatic acid exporter family protein	NA	NA	NA	NA
WP_106700669.1\|1391516_1392047_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_106700671.1\|1392275_1392767_-	hypothetical protein	NA	NA	NA	NA
WP_106700672.1\|1392821_1393838_-	DUF2804 domain-containing protein	NA	NA	NA	NA
WP_157824972.1\|1393822_1394443_-	hypothetical protein	NA	NA	NA	NA
WP_106699591.1\|1394565_1394913_+\|transposase	transposase	NA	NA	NA	NA
WP_157825106.1\|1394909_1395761_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-28	29.9

DBSCAN-SWA_6

1411746 : 1452057

Staphylococcus_phage(30.0%)

head,portal,capsid,tail,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106700693.1\|1411746_1412451_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_106700694.1\|1412447_1413158_-	hypothetical protein	NA	NA	NA	NA
WP_106700695.1\|1413160_1414774_-	hypothetical protein	NA	NA	NA	NA
WP_106700696.1\|1415173_1416364_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157824980.1\|1417106_1417928_-	hypothetical protein	NA	NA	NA	NA
WP_106700698.1\|1417967_1418705_-	hypothetical protein	NA	NA	NA	NA
WP_106700699.1\|1418709_1418940_-	hypothetical protein	NA	NA	NA	NA
WP_106700700.1\|1419062_1420001_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700701.1\|1420344_1420626_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_106700702.1\|1421104_1422298_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700703.1\|1422964_1423396_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157824982.1\|1423471_1424335_-	DUF4143 domain-containing protein	NA	NA	NA	NA
WP_106700705.1\|1424777_1425896_-	glycosyltransferase	NA	NA	NA	NA
WP_106700706.1\|1426034_1426847_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_106700707.1\|1427154_1427685_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_106700708.1\|1427681_1428569_-	DegV family protein	NA	NA	NA	NA
WP_106700709.1\|1428622_1429249_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_106700710.1\|1429292_1430180_-	hypothetical protein	NA	NA	NA	NA
WP_106700711.1\|1430172_1431075_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	25.6
WP_106700712.1\|1431071_1431971_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.1e-23	31.2
WP_106700713.1\|1432165_1433746_-	recombinase family protein	Q6DMS5	Streptococcus_phage	4.5e-106	42.1
WP_106700714.1\|1433738_1435052_-	recombinase family protein	E4ZFN8	Streptococcus_phage	2.2e-69	42.0
WP_106700716.1\|1435252_1435528_-	hypothetical protein	NA	NA	NA	NA
WP_106700717.1\|1435636_1436122_-	hypothetical protein	NA	NA	NA	NA
WP_106700718.1\|1436108_1436435_-	hypothetical protein	NA	NA	NA	NA
WP_106700719.1\|1436421_1437060_-	hypothetical protein	NA	NA	NA	NA
WP_106700720.1\|1437052_1437385_-	hypothetical protein	NA	NA	NA	NA
WP_106700721.1\|1437392_1438073_-	hypothetical protein	NA	NA	NA	NA
WP_106700722.1\|1438072_1438924_-	hypothetical protein	A0A1B0XUH9	Freshwater_phage	1.7e-19	41.7
WP_106700723.1\|1438935_1439709_-	hypothetical protein	NA	NA	NA	NA
WP_106700724.1\|1439708_1440827_-	hypothetical protein	NA	NA	NA	NA
WP_106700725.1\|1440828_1441659_-	hypothetical protein	NA	NA	NA	NA
WP_106700726.1\|1441655_1443395_-	hypothetical protein	NA	NA	NA	NA
WP_106700727.1\|1443726_1444143_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_106700728.1\|1444155_1444944_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_106700729.1\|1444936_1445575_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-17	30.4
WP_157824984.1\|1445606_1445852_-	hypothetical protein	NA	NA	NA	NA
WP_106700730.1\|1445796_1446144_-	hypothetical protein	NA	NA	NA	NA
WP_106700731.1\|1446154_1446721_-\|tail	phage tail protein	A6XMK3	Bacillus_virus	2.7e-21	39.1
WP_106700732.1\|1446723_1447059_-	hypothetical protein	NA	NA	NA	NA
WP_106700733.1\|1447060_1447441_-	hypothetical protein	NA	NA	NA	NA
WP_157824986.1\|1447424_1447763_-	hypothetical protein	NA	NA	NA	NA
WP_106700735.1\|1447768_1448050_-	hypothetical protein	NA	NA	NA	NA
WP_106700736.1\|1448075_1449215_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	8.7e-59	45.7
WP_106700737.1\|1449230_1449821_-\|head,protease	HK97 family phage prohead protease	A0A060AB24	Staphylococcus_phage	1.7e-13	36.2
WP_106700738.1\|1449804_1450023_-	hypothetical protein	NA	NA	NA	NA
WP_106700739.1\|1450006_1451068_-\|portal	phage portal protein	A0A290G4I4	Caldibacillus_phage	7.2e-39	33.6
WP_157824892.1\|1451169_1452057_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1535906 : 1587122

Staphylococcus_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106699653.1\|1535906_1536887_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.4e-76	48.5
WP_106700805.1\|1536974_1537841_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_106700806.1\|1537940_1539155_+	arginine deiminase	NA	NA	NA	NA
WP_106700807.1\|1539160_1539808_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_106700808.1\|1539816_1540524_-	DUF554 domain-containing protein	NA	NA	NA	NA
WP_106700809.1\|1540604_1541537_-	aldo/keto reductase	NA	NA	NA	NA
WP_106700810.1\|1541640_1542429_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_157824999.1\|1543029_1543179_-	hypothetical protein	NA	NA	NA	NA
WP_106700812.1\|1543315_1546015_+	calcium-translocating P-type ATPase, PMCA-type	A0A1J0FA34	Only_Syngen_Nebraska_virus	4.1e-91	31.1
WP_106700813.1\|1546047_1546866_-	DUF3137 domain-containing protein	NA	NA	NA	NA
WP_106700814.1\|1546843_1547884_-	NYN domain-containing protein	A0A2P0VNQ4	Tetraselmis_virus	3.9e-05	28.3
WP_106700815.1\|1547886_1549062_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_106700816.1\|1549426_1549729_-	hypothetical protein	NA	NA	NA	NA
WP_106700817.1\|1549834_1550863_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_106700818.1\|1550865_1551264_-	arsenate reductase ArsC	A0A2H4PQT9	Staphylococcus_phage	4.9e-17	39.2
WP_106699417.1\|1551516_1552683_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_106700819.1\|1552798_1553029_-	thioredoxin family protein	NA	NA	NA	NA
WP_106700820.1\|1553044_1554067_-	permease	NA	NA	NA	NA
WP_106700821.1\|1554054_1554345_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700822.1\|1554471_1555314_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-20	38.7
WP_106700824.1\|1555769_1556654_-	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_106700825.1\|1556733_1557648_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_157825001.1\|1557699_1558188_-	hypothetical protein	NA	NA	NA	NA
WP_106700827.1\|1558426_1559161_-	helix-turn-helix domain-containing protein	A0A139ZPI6	Marinitoga_camini_virus	3.8e-07	45.9
WP_106700828.1\|1559627_1559915_-	hypothetical protein	NA	NA	NA	NA
WP_106700829.1\|1560044_1560911_-	hypothetical protein	NA	NA	NA	NA
WP_106700830.1\|1560970_1561339_-	hypothetical protein	NA	NA	NA	NA
WP_106700831.1\|1561508_1561979_-	hypothetical protein	NA	NA	NA	NA
WP_106700832.1\|1562148_1562382_-	hypothetical protein	NA	NA	NA	NA
WP_157825003.1\|1562409_1562562_-	hypothetical protein	NA	NA	NA	NA
WP_106700833.1\|1562856_1563543_-	hypothetical protein	NA	NA	NA	NA
WP_106699591.1\|1563731_1564079_+\|transposase	transposase	NA	NA	NA	NA
WP_157825106.1\|1564075_1564927_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-28	29.9
WP_106700834.1\|1564940_1565699_-	hypothetical protein	NA	NA	NA	NA
WP_106700835.1\|1565815_1566346_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106700836.1\|1566487_1567087_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106700837.1\|1567203_1569507_-	hypothetical protein	A0A1L2BY82	Clostridium_phage	4.1e-124	37.5
WP_106700838.1\|1569561_1570674_-	hypothetical protein	NA	NA	NA	NA
WP_106700839.1\|1570753_1571302_-	hypothetical protein	NA	NA	NA	NA
WP_106700840.1\|1571375_1572095_-	hypothetical protein	NA	NA	NA	NA
WP_106700842.1\|1572980_1574150_-	MFS transporter	NA	NA	NA	NA
WP_106700843.1\|1574169_1575516_-	radical SAM protein	NA	NA	NA	NA
WP_106699334.1\|1575952_1577197_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.1e-57	40.5
WP_106700844.1\|1577343_1577625_-	hypothetical protein	NA	NA	NA	NA
WP_106700845.1\|1577935_1578871_+	hypothetical protein	NA	NA	NA	NA
WP_106700846.1\|1579226_1579748_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_106700847.1\|1580129_1580789_-	hypothetical protein	NA	NA	NA	NA
WP_106700849.1\|1581429_1582146_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-14	29.1
WP_106700850.1\|1582138_1582459_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_106700851.1\|1582451_1583072_-	hypothetical protein	NA	NA	NA	NA
WP_106700852.1\|1583163_1584315_-	aldo/keto reductase	NA	NA	NA	NA
WP_106700853.1\|1584713_1585178_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_106700854.1\|1585318_1586692_+	AAA family ATPase	K4FB40	Cronobacter_phage	1.3e-64	53.1
WP_106699591.1\|1586774_1587122_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1991870 : 2049127

Paenibacillus_phage(15.38%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157825116.1\|1991870_1992728_-\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	2.2e-62	56.0
WP_106701499.1\|1992709_1993426_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	6.7e-41	44.4
WP_106701501.1\|1993555_1994926_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-47	28.5
WP_106701503.1\|1994936_1996253_-	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_106701505.1\|1996265_1997243_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_106701507.1\|1997244_1998330_-	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_106701509.1\|1998546_1999731_-	ATP-binding protein	NA	NA	NA	NA
WP_106699719.1\|1999996_2001157_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_106701855.1\|2001436_2002324_-	agmatinase	NA	NA	NA	NA
WP_106701512.1\|2002316_2003804_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_157825077.1\|2003948_2004992_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_106701516.1\|2005046_2005781_-	helix-turn-helix transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	1.2e-05	30.8
WP_157825079.1\|2005957_2006095_-	hypothetical protein	NA	NA	NA	NA
WP_106701518.1\|2006091_2008074_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_106701519.1\|2008070_2008337_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_106701521.1\|2008477_2009035_-	nitroreductase	NA	NA	NA	NA
WP_157825082.1\|2009126_2010215_-	diguanylate cyclase	A0A2D0W9B6	Bordetella_phage	1.8e-05	37.3
WP_106699673.1\|2010684_2011731_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_106701525.1\|2011787_2013164_-	deoxyribodipyrimidine photolyase	A0A097P963	Sucra_jujuba_nucleopolyhedrovirus	1.2e-70	35.3
WP_106701527.1\|2013387_2014341_+	hypothetical protein	NA	NA	NA	NA
WP_106701529.1\|2014374_2015181_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_106701531.1\|2015180_2016062_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_106701533.1\|2016033_2016804_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.9e-23	32.3
WP_106701535.1\|2016891_2017953_-	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_106701537.1\|2018234_2019800_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_106701539.1\|2020120_2021017_-	bifunctional enoyl-CoA hydratase/phosphate acetyltransferase	NA	NA	NA	NA
WP_106701541.1\|2021034_2022111_-	butyrate kinase	NA	NA	NA	NA
WP_106701543.1\|2022107_2023346_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_106701545.1\|2023347_2024742_-	tryptophanase	NA	NA	NA	NA
WP_106701548.1\|2024877_2025249_-	HIT family protein	D7NW73	Streptomyces_phage	2.0e-12	35.3
WP_106701550.1\|2025425_2025662_+	hypothetical protein	NA	NA	NA	NA
WP_106701552.1\|2025799_2026216_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_106701554.1\|2026295_2027324_-	PLP-dependent cysteine synthase family protein	NA	NA	NA	NA
WP_106701556.1\|2027567_2028062_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157825084.1\|2028073_2028610_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_106701560.1\|2028665_2029016_-	amino acid ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_106701562.1\|2029028_2029391_-	amino acid ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.0e-09	37.9
WP_106701564.1\|2029381_2030128_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_106701566.1\|2030117_2030846_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_106701568.1\|2030928_2032011_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_106701570.1\|2032026_2032599_-	NADH:ubiquinone reductase (Na(+)-transporting) subunit E	NA	NA	NA	NA
WP_106701572.1\|2032612_2033239_-	NADH:ubiquinone reductase (Na(+)-transporting) subunit D	NA	NA	NA	NA
WP_106701574.1\|2033251_2033833_-	FMN-binding protein	NA	NA	NA	NA
WP_106701576.1\|2033816_2034725_-	RnfABCDGE type electron transport complex subunit D	NA	NA	NA	NA
WP_106701578.1\|2035130_2035442_-	hypothetical protein	NA	NA	NA	NA
WP_106701580.1\|2035446_2036802_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_106701582.1\|2036890_2039077_-	adenosylcobalamin-dependent ribonucleoside-diphosphate reductase	A0A2R2ZGN9	Clostridioides_phage	4.8e-106	40.4
WP_106701585.1\|2039319_2039901_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_106701587.1\|2039890_2043259_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.8e-78	26.1
WP_157825086.1\|2043437_2044139_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_106701591.1\|2044179_2045367_-	hypothetical protein	NA	NA	NA	NA
WP_106701593.1\|2045455_2047759_-	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	2.8e-32	42.0
WP_106699591.1\|2047931_2048279_+\|transposase	transposase	NA	NA	NA	NA
WP_157825106.1\|2048275_2049127_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-28	29.9

Anti-CRISPR protein detection

Acr_ID: NZ_CP017950.1|WP_106699806.1|483286_483721_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP017950.1|WP_106699806.1|483286_483721_-|hypothetical-protein

483286_483721_-

144 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|44	0.8402777777777778	1	1.0

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017950

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information