CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP025493	Legionella sainthelensi strain LA01-117 plasmid pLA01-117_122k, complete sequence	0 crisprs	DinG,DEDDh	0	1
NZ_CP025492	Legionella sainthelensi strain LA01-117 plasmid pLA01-117_165k, complete sequence	0 crisprs	WYL,DinG	0	0
NZ_CP025491	Legionella sainthelensi strain LA01-117 chromosome, complete genome	2 crisprs	DEDDh,PrimPol,cas3,WYL,DinG,csa3	1	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

93431 : 101960

Bacillus_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101901950.1\|93431_93707_+	hypothetical protein	A0A125RQ78	Bacillus_phage	1.4e-07	39.0
WP_101901952.1\|93945_94371_+	hypothetical protein	NA	NA	NA	NA
WP_101901954.1\|94394_95360_+	hypothetical protein	NA	NA	NA	NA
WP_101901956.1\|95317_95842_+	hypothetical protein	A0A125RQ78	Bacillus_phage	2.1e-55	60.2
WP_101901958.1\|95825_96212_+	hypothetical protein	A0A125RQ78	Bacillus_phage	3.8e-30	58.6
WP_101901961.1\|96983_97949_+	hypothetical protein	M4QT73	Synechococcus_phage	1.4e-25	26.7
WP_101901963.1\|97932_98289_+	capsular biosynthesis protein	M4QRS4	Synechococcus_phage	5.7e-25	42.9
WP_101901965.1\|98300_99035_+	hypothetical protein	M1I080	Acanthocystis_turfacea_Chlorella_virus	1.1e-33	38.7
WP_101901967.1\|98947_100087_+	hypothetical protein	NA	NA	NA	NA
WP_101901969.1\|100083_101139_+	hypothetical protein	NA	NA	NA	NA
WP_101901970.1\|101270_101960_-	DUF72 domain-containing protein	A0A1V0CNL1	Kaumoebavirus	3.8e-17	38.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025491

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025491_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025491_1

247992-248160

Orphan

Consensus_repeat	Method
TCAAATTTACCGCGATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP025491_1

>merge|NZ_CP025491|1|247992-248160|CRISPRCasFinder
TCAAATTTACCGCGATAACAGTAATTTTTAGGAATTTATAATAAATAAATATGGGAAAATCAGGAAATCAATCAAATTTACCGCCATAACAGTAATTTATGGTGAATTAATGCAAAGAAATACAATAATAAATTTATTTTTATCATTTTTACTGCTATAACAGTAATAT

>NZ_CP025491|1|1|247992-248160|CRISPRCasFinder
TCAAATTTACCGCGATAACAGTAATTT	TTAGGAATTTATAATAAATAAATATGGGAAAATCAGGAAATCAA
TCAAATTTACCGCCATAACAGTAATTT	ATGGTGAATTAATGCAAAGAAATACAATAATAAATTTATTTTTA
TCATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025491.1\|WP_101898599.1\|258896_259124_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898601.1\|260103_261972_-\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
NZ_CP025491.1\|WP_101898596.1\|248710_249649_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	unknown	unknown	gnl\|CDD\|377920
NZ_CP025491.1\|WP_101898593.1\|247085_247793_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101901430.1\|253894_255565_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898591.1\|244059_245280_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	unknown	unknown	gnl\|CDD\|341492
NZ_CP025491.1\|WP_101898594.1\|248181_248409_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_CP025491.1\|WP_101898589.1\|242925_243201_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP025491.1\|WP_101898586.1\|237734_238310_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898587.1\|238552_239323_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898588.1\|239516_240044_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898595.1\|248405_248714_+\|toxin-HipA	unknown	unknown	gnl\|CDD\|274416
NZ_CP025491.1\|WP_101898590.1\|243845_244073_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_CP025491.1\|WP_101898597.1\|250344_252075_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101901433.1\|255628_257230_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369446
NZ_CP025491.1\|WP_101898592.1\|245537_247049_+\|cell-filamentation-protein-Fic	unknown	unknown	gnl\|CDD\|225718
NZ_CP025491.1\|WP_101898600.1\|259415_259907_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP025491.1\|WP_101898584.1\|236179_237355_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP025491.1\|WP_101898585.1\|237468_237681_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101898598.1\|257301_258561_-\|CPBP-family-intramembrane-metalloprotease-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999

Protein	Function_ID	Function_description	E-value
NZ_CP025491.1\|WP_101898596.1\|248710_249649_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.23781e-59
NZ_CP025491.1\|WP_101898591.1\|244059_245280_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	gnl\|CDD\|341492	cd17793, HipA, type II toxin-antitoxin sytem toxin HipA and similar proteins. This family contains type II toxin-antitoxin (TA) system HipA family toxins similar to Escherichia coli and Shewanella oneidensis HipA, which is a serine/threonine-protein kinase that phosphorylates Glu-tRNA-ligase (GltX), preventing it from being charged, leading to an increase in uncharged tRNA(Glu). This induces amino acid starvation and the stringent response via RelA/SpoT and increased (p)ppGpp levels, which inhibits replication, transcription, translation and cell wall synthesis, reducing growth and leading to persistence and multidrug resistance. HipA is the toxin component of the HipA-HipB TA module that is a major factor in persistence and bioflim formation; its toxic effect is neutralized by its cognate antitoxin HipB. HipA, with HipB, acts as a a corepressor for transcription of the hipBA promoter. Structures of HipAB:DNA complexes from both Escherichia coli and Shewanella oneidensis reveal distinct complex assembly.	1.21949e-158
NZ_CP025491.1\|WP_101898594.1\|248181_248409_+\|transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	2.15563e-23
NZ_CP025491.1\|WP_101898600.1\|259415_259907_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	1.96249e-31
NZ_CP025491.1\|WP_101898589.1\|242925_243201_-\|DNA-binding-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00250657
NZ_CP025491.1\|WP_101898601.1\|260103_261972_-\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP025491.1\|WP_101898595.1\|248405_248714_+\|toxin-HipA	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	2.4741e-44
NZ_CP025491.1\|WP_101898590.1\|243845_244073_+\|transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	5.4072e-19
NZ_CP025491.1\|WP_101901433.1\|255628_257230_+\|hypothetical-protein	gnl\|CDD\|369446	pfam07642, BBP2, Putative beta-barrel porin-2, OmpL-like. bbp2. BBP2 is a family of putative porin proteins that are likely to be outer membrane beta barrel proteins porins.	4.29939e-10
NZ_CP025491.1\|WP_101898592.1\|245537_247049_+\|cell-filamentation-protein-Fic	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	6.23465e-17
NZ_CP025491.1\|WP_101898584.1\|236179_237355_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	6.74203e-64
NZ_CP025491.1\|WP_101898598.1\|257301_258561_-\|CPBP-family-intramembrane-metalloprotease-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	1.55608e-19

>NZ_CP025491.1|WP_101898593.1|247085_247793_+|hypothetical-protein
MEFAKPVKVAFGRLEHIAFIKRHLDVYKKPDITQYPIAAYEFDFLDFIYSLGLINILTFVCISLFPSYFKYDPFKIFNIIPIMLLLIANTVLIAAVIVLFHWGLCKCIGFIYKIKTHTFYEAGIFWRVFRVLSLSYLLITIPLLIQINSIFTHEGLGTTLNLISLLTIILMLMLQIKLFILPLYKIGKQFGKALGSIQSLLVIASALLINNFFWKQIPPSIFVNIQEVIKLFSAQ
>NZ_CP025491.1|WP_101898592.1|245537_247049_+|cell-filamentation-protein-Fic
MKPSEKLAQSLEVLHNLQKQGKYAIQSKDISRTHRERLIENAFLEEVVKGWYVPIKPDEQKGESTAWYASFWSFCASYLNERFGDEWCLSPEQSLLLHSENWTVPKQLMIRSPKGTNRNMELPHNTSLFSVQYKMPATQDIEIKQDIRVYSIVPALLYCSPKFFSQYPTEARSVLSMFNSASDLLHYLLEEGHSWIAGRICGALQNIGKSHVAEEIKKTMESAGYQIREEDPFLTNTPIDFSVIYKPAYRSRLEVMWHDMRNIVRENFPKPRPTTIDIKGYLEQVDENYVSDAYHSLSIEGYQVSPDLIQKVRFGQWDPDATKQDRNHRSALAARGYWQAFQAVKKSLIEILNGENPGKVIQKEHRDWYRELFQPGVAVGLLKPTDLAGYRRSPVFIRQSKHIPPRWQIVGELMEEFFQLIIQEKEPGVRVVLGHFFFVYIHPYSDGNGRIGRFLMNVMLASGHYPWTIIPVERRNEYMEALEQASADQNIIPFTKFIASCIE
>NZ_CP025491.1|WP_101898591.1|244059_245280_+|type-II-toxin-antitoxin-system-HipA-family-toxin
MKNHKLGVYLNQILAGQLSIDTRGDMSFEYDNYYLENKQNRPLSHSLPLQKASYSTKQCRPFFSGLLPEAHMRTAIARQLGISEKNDFALLAAIGGECAGAVMILPQNTSIAQLKPDYKIIKKKDVLEILQTMHQRPMIVGEDGVRLSLAGAQDKLPVAIIEENLAIPMNGAPSTHILKPINRDFPTLIENECFCLNLAQKIGLNAVDAAIHYADDTPYLLVKRYDRVETEQGIQRLHQEDFCQALGISPEMKYQREGGPKISECFGLIREISSLPIFDIKELLQGILFNVIIGNNDAHSKNFSLLYHGSKTRLAPFYDMISTIYYPNLSSKMAMKVGSKYDFDGLFPRHFTQMAEEALLSGALVRKEVLDLVSKIQKNITASPFTGIILQRADKLFQRFQKSSAE
>NZ_CP025491.1|WP_101898590.1|243845_244073_+|transcriptional-regulator
MIQSPEKIGCYIRKVRKELNVTQKDLALTAGTGLRFIIDLENGKPTCQIGKILQVLQVLGIQLNLSHADFENEKS
>NZ_CP025491.1|WP_101898589.1|242925_243201_-|DNA-binding-protein
MTLKKLSRLNLLNEFESAPHSALFNQQTIAAVLSCSTQLLERNRWAGGGVPYLKIGRKVLYRKSDVLNFLQQQKIYYSTSDEGQIQPVENA
>NZ_CP025491.1|WP_101898588.1|239516_240044_-|hypothetical-protein
MTKIPQIPAGKGSNIGEFDLADCFFQSGEMLYAAAYDGITKNATRRIGFPTDEYFHGHFIVAFYNFRHAIELKMKQLALLLGITKRYGHKLSDLWDEVLKHAKITANETIVTEALLVLADYDVLQDEELFRYSQRNKSPNQLLQDYPAIQSDSFHLLGKAYCLLSEAILLLTPGK
>NZ_CP025491.1|WP_101898587.1|238552_239323_+|hypothetical-protein
MMEHWLYLKTQQKYFQIFLILNIWYIGGWCPVLRNTSKIKHPGTLDVDILFKESYKSGYLQNVIKSFINTGFMPSAKHPFQLLKPKEINGERIIYNVDILHPNMTEYSDQIGMFVDHLELDVPLNNSEKELKKMMSIVLPNSEILFREGLFDEFSRSGEVFKLVSFLGMFITKMDSCQKQKRERDSFDIYLAFLSDGIDVNKIEAIALGDGRIKESLESFKKHLNNDSDTFDKNVQHFCKSIEDSPANFILNKLNA
>NZ_CP025491.1|WP_101898586.1|237734_238310_+|hypothetical-protein
MLQDFLKDKVTLVKNNGTKVRSEIPAQVSSNRIIIFDSSLPIEVGDHILRQLKSGLVEDFIVDDPCFQTGHGSIPDSFQIKVHRSDEPTAKPEVIINQISGNNARINIHSTDNSTNIVGDHNQLFSTMNQLIEDNIDSDDERERLRVLVSELKENVGKPNFKNAYDKFIEGAANHMTIFVPIISALSLLLS
>NZ_CP025491.1|WP_101898585.1|237468_237681_+|hypothetical-protein
MSNKQQISVNTDELKTEIDSYESQMTRLTNNLNQKLKEQFINKPDIYPNFYRYKAAVISFWQNFFKKDFN
>NZ_CP025491.1|WP_101898584.1|236179_237355_-|ISL3-family-transposase
MPKKDCILNLPGYSIKKVSGENPVYIEVTYRCVVRCIHCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCPACGRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRHKKILNRSCPRVLGLDEHSFNRKVGYATTFCGLAKHKIFDVVEGRSEKDLEGYLHTLEGKDKVQVVCIDLSSSYRKLIRRYFPNALIVADRFHVIRLLNQFCLQTYQQIDPDMKYQRGLLAALRTNPNNLTVKRLNRRERYLQQQPVIAALYYFKQRLHRLLMRKHRTAKQCTRLIPLFLKLIASLKESPFESLKTLGKTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVKVLCS
>NZ_CP025491.1|WP_101898594.1|248181_248409_+|transcriptional-regulator
MPTHEIANLIHYYRKQSGLSQQELARLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQIKFETPFPQTTDNNT
>NZ_CP025491.1|WP_101898595.1|248405_248714_+|toxin-HipA
MRKAYVSVNGIKAGVLEELEGKKYQFTYLNDYQGAPVSLTMPLTNKIYDFDVFPPFFEGLLPEGIMLEALLRKYKIDKNDYFGQLILVGQDVVGAVTIEELR
>NZ_CP025491.1|WP_101898596.1|248710_249649_+|type-II-toxin-antitoxin-system-HipA-family-toxin
MKRCPITYDVISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGCFEIVDQKGQYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLIYSKDNSFTYFIKRFDRIGHNKKLAVEDFAQLSGEDRHTKYKSSMEKVIAVIAQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKERKISISPAYDLLNSTIAQKNTKEELALPLKGKKNNVTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGSSFLSQSMQEKYLELLEQRCKRLNFFD
>NZ_CP025491.1|WP_101898597.1|250344_252075_+|hypothetical-protein
MNSTKDFFTIVSTPREENGKLYYRSFPSINYNGMCLIADKYNSKYFINESNKRIIVAASKIGFQQQLEPYLKSNKDCMIGFSVPQREGASGHPTPVIFEIHNGKKYLFINDSVGYDTLANSLQLFCEKNNVDLYENPYGRQVDNGSCKSDCLAYLKNSLQMESIAASVTLLNKEETTQYLSQTPSDRPGMPKHKIFLPTGDMLKTIQTSKVLGQNQLDVNQPLVSTKSKNTYMEKMSGYHKGETYYETIDRNTHVKSGDTKVWKERTYLRQKTETHHKQIIDILENKESDYINAAICRAANVFDLNTAIAQKNYPLIDIFREKNTQEPIKEENQELYVEYFKFKLRELLKECITDYKKNVENFNEEKLLPILENPKIQIEEKLNKLLSPEVPISDNFRAHLKFHSIFQENGAPSILLEHAIQVFIEDAKNKENGNKKEHINIIIDKHLHLFTTKAKWMALQGAEYSNASWAMDEIVRTIKRERELFNQAPLSQFDQAQQWLLASCTDIIDRSKDILGKHRGYKELFVQFLSGVTSVSTLGVANYATKKSFYGLFPARTDSAKMLDNFTEEMKGCSH
>NZ_CP025491.1|WP_101901430.1|253894_255565_+|hypothetical-protein
MKEIVSLLELEQDQIDFAIHKREVIMVLRRKFRTQKDWIIASFNQYQFTKEESQKVQQAILNGDLRITDLLERPFSHYFWSFFTFKWGEILSGGKRLSKQEVLQVATYSSNGQEFARTPIQNRNRLIKGVPLVIGKVVTSMALCMVFCLGLLSTLGAPFALGLALAIVLSLCNGIVCLLSRGQAMLDSAGFQPKKQKTFKTLEENLKQKTIFDKGQKLFFGIVTLLACISAGISGYAGLVGLLTFLGAGMLASNPLVLIVTIGLSLIAAVSFYSFQAVGIRENYEKFKNLFIEDYKKPYGLLRCILLGVVSTIFLAVYATLTWFTTVSGINKLFNALGSNPDTFLAHVLSMICTSTTMVVNTFSQVYKVFNPKTYVDLKEKFESIHQPPEEYQTKAQKIKYGAINVLKLCALIGDSLAYSVAGGIRSGIHVGETLGEAIGAKLALTITMAILSPVILVFVSIAFTWPTVFQSKKTTQYPSQMEKPLIEKVSQSHNPNALQNNTLLSTSEKFPKTNNSKIRQAGLRFFDASLNEEPIVKPNCSSTLERRTVVTSYSL
>NZ_CP025491.1|WP_101901433.1|255628_257230_+|hypothetical-protein
MFPYLTLAITTSSVWSKNIQSSSSCDPYRNYSCLDSYLGEDFITRFFRYYKLEIGHAAAPSDPHAPTSHRASWPATPESTPPMPFTEWPYGATTSLGVSLPNSVDSPLMVGLANAPVGKWLQKNHIQIYGWVNGGGNLSTNTEKPAGNAPMAYLYTPNTIQLDQAVLYMERVPDTVQTNHVDWGFRLSGIYGENYRYTTAYGIASYQLLNNNSVYGYDFPMVYGELYIPNVAQGLLFRVGRYISIPDIEAQLAPNNYMYSHSMTYTFDNYTNEGIVASLAVAKNVIFQLGLVGGTDTAIWNIGKKVKNPAPNPLYPNPTFLKDPGARISAVACARFTWNDGKDTFYPCMDGINNGVWGYNNLQWYGFTYYHKFNERWHIAYEIYTLHQNNVANINNPIAAALIATGGTPFSPQYIPFNAPNAAQCNSTSALSCTASVLATVAYINYQFSPLDNISFRPEFYDDKQGQRTGVKTRYLNFGLGWQHWLSPQIELRPEIDYDYALDRNAFNGNANAGISPSKRYTVLGAMDIIAHF
>NZ_CP025491.1|WP_101898598.1|257301_258561_-|CPBP-family-intramembrane-metalloprotease-domain-containing-protein
MEEIIDEEIIKILQKNNLFSSLSNKQLNDLMPLIRVIDFDANKLIIYENDNPIDLYIIWKGEVEVLKKAKDGTELRISTLQSGEAIGEMGLIDNSPRSATIRTIVPTKLLVFSIADLKNLTKNTLFYNQLISKLSDVINELQFYINEQPTYLTLISNLAGTLSNRIRQTNQLTVDTLRSDLEHTKARIAMGKFMIDVLLVVVIYMYTFSVLAKLAHSHQSTSIVSIPLIIFFGIIVLFMMKNSSYPLQFYGLTLNNWRRALWEGILLSIPLILLIVLIKWLVINLVPQFSHLTLINAAILTGNDMHPNHNLPSLIALVLAYLVFTPIQELIARGALQSSLQEFLIGPNRIWWAILMSNILFSVTHLHVSISLAIAVLIPGFFWGWLYYRHKTLIGVSISHLIVGGLAFFVFDIRSIFAF
>NZ_CP025491.1|WP_101898599.1|258896_259124_+|hypothetical-protein
MSKYIKSLLLSSSLSFTIFTPGILFADDCDVDCAKGSNQIDCPGKGCGCWCDKDQNAKCKCTQPLDENNTNTKNK
>NZ_CP025491.1|WP_101898600.1|259415_259907_+|Hsp20/alpha-crystallin-family-protein
MSKIAKLKHIHPAEHPSSPFIRLHNEVDRLFGEFSDFFSPTRFRGLEQFEQLNLAPSMDVVEDKDHFSIQLEMPGMDEKDIHLSITDNVLTISGEKSISKKNKHKKYVSREISYGKYERSISLPSSVNVDEVKANFKKGMLWVQLPKKEEATSGSRDIKIEQA
>NZ_CP025491.1|WP_101898601.1|260103_261972_-|heavy-metal-translocating-P-type-ATPase
MRLSLISLKSKWQLYVALLALIALGVYLVMLAFHIPASNIPLFFVIVIGGIPVFLQILFKLFKGNLGADSLAAIALITGVILHQYLAATLIVLMLASGQTLEYYAMRKASFVLRSLVARMPSIAHRKINSHIEDIPLLDIKIDDLIVIYPHETCPIDGIVIDGHGSMDESYLTGEPYQISKTPGTFVLSGAINGETLLVIKTTKLTSDSRYSAIVKVLEEAEQKRPSIRRLGDQIGAIFAPIALIFAMVAWYVTGDAIRFLSVLVIATPCPLLIAIPITIISAISRAARQAIVIKDPTVLEQLPTCKTAIFDKTGTLTYGKPALTEIHVTPNYTKEMVLQYVASLERYSKHPLSSAVLNVAKKENITLLDSSNVSEKPGQGLRGIIGKHKIRITSRKKILEENPESINLLPPIAPGLECIVMIDNKYAASLHFHDAPRIESKSFLGHLAPSHQFKKIMLVSGDRESEVVYLANLLNIKEIHASQSPEQKLAIVREEIKKAPTVFMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIMENTLSKVDELIHLSLNTRRIASQSAIGGMLLSIIGMGFAAGGFINPVSGAIIQEVIDILAIVNALRLALGSRIKIDLPEFSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025491_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025491_2

2948065-2948182

Orphan

Consensus_repeat	Method
GCCAATTCTGCGCCTGATATTTCGCCAAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025491_2

>merge|NZ_CP025491|2|2948065-2948182|CRISPRCasFinder
GCCAATTCTGCGCCTGATATTTCGCCAAGCGAATTCCTGCTTAAATCAAGCGTGGTTATCTCTTGTGGCATGGTAGCAAAAGCTTGAGCCAATTCTGCTCCTGATATTTCGCCAAGCG

>NZ_CP025491|2|2|2948065-2948182|CRISPRCasFinder
GCCAATTCTGCGCCTGATATTTCGCCAAGCG	AATTCCTGCTTAAATCAAGCGTGGTTATCTCTTGTGGCATGGTAGCAAAAGCTTGA
GCCAATTCTGCTCCTGATATTTCGCCAAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025491.1\|WP_012979182.1\|2959727_2960234_+\|SOS-(Error-prone)-mutagenesis-protein-UmuD	unknown	unknown	gnl\|CDD\|182350
NZ_CP025491.1\|WP_058466449.1\|2949324_2949552_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|314732
NZ_CP025491.1\|WP_041819071.1\|2957357_2957543_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101900413.1\|2946414_2946897_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379267
NZ_CP025491.1\|WP_101900408.1\|2943751_2944084_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP025491.1\|WP_101900405.1\|2941716_2942250_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101900416.1\|2953831_2955250_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_058466483.1\|2949568_2949823_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|374105
NZ_CP025491.1\|WP_101900409.1\|2944083_2945349_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP025491.1\|WP_101900412.1\|2946059_2946278_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|315923
NZ_CP025491.1\|WP_101900404.1\|2940563_2940821_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379165
NZ_CP025491.1\|WP_101900407.1\|2943300_2943669_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_012979185.1\|2956496_2956937_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101900411.1\|2945870_2946059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|315923
NZ_CP025491.1\|WP_101900410.1\|2945345_2945795_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99777
NZ_CP025491.1\|WP_012979183.1\|2958922_2959591_+\|SOS-response-associated-peptidase	unknown	unknown	gnl\|CDD\|376837
NZ_CP025491.1\|WP_012979184.1\|2957928_2958108_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101900414.1\|2948562_2948745_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025491.1\|WP_101900406.1\|2942295_2942676_-\|DUF4949-domain-containing-protein	unknown	unknown	gnl\|CDD\|292923
NZ_CP025491.1\|WP_101900415.1\|2951190_2953161_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP025491.1\|WP_012979182.1\|2959727_2960234_+\|SOS-(Error-prone)-mutagenesis-protein-UmuD	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	1.60159e-44
NZ_CP025491.1\|WP_058466449.1\|2949324_2949552_+\|hypothetical-protein	gnl\|CDD\|314732	pfam11903, ParD_like, ParD-like antitoxin of type II bacterial toxin-antitoxin system. ParD-like antitoxin is a family of archaeal and bacterial proteins of a type II bacterial toxin-antitoxin system. Many of the cognate toxins for these molecules fall into family ParE-like_toxin, pfam15781. Gene-pairs are expressed from the same operon, the toxin of the pair being expressed first, eg, for UniProtKB:Q3AQ93 and UniProtKB:Q3AQ94.	5.99202e-17
NZ_CP025491.1\|WP_101900413.1\|2946414_2946897_-\|hypothetical-protein	gnl\|CDD\|379267	pfam13565, HTH_32, Homeodomain-like domain.	7.15462e-07
NZ_CP025491.1\|WP_101900408.1\|2943751_2944084_-\|hypothetical-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.56472e-12
NZ_CP025491.1\|WP_058466483.1\|2949568_2949823_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|374105	pfam15781, ParE-like_toxin, ParE-like toxin of type II bacterial toxin-antitoxin system.	1.57059e-34
NZ_CP025491.1\|WP_101900409.1\|2944083_2945349_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.80025e-81
NZ_CP025491.1\|WP_101900412.1\|2946059_2946278_-\|hypothetical-protein	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	4.44574e-11
NZ_CP025491.1\|WP_101900404.1\|2940563_2940821_+\|hypothetical-protein	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	2.22573e-10
NZ_CP025491.1\|WP_101900411.1\|2945870_2946059_-\|hypothetical-protein	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.3449e-07
NZ_CP025491.1\|WP_101900410.1\|2945345_2945795_-\|hypothetical-protein	gnl\|CDD\|99777	cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.	5.46966e-10
NZ_CP025491.1\|WP_012979183.1\|2958922_2959591_+\|SOS-response-associated-peptidase	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	1.066e-102
NZ_CP025491.1\|WP_101900406.1\|2942295_2942676_-\|DUF4949-domain-containing-protein	gnl\|CDD\|292923	pfam16307, DUF4949, Domain of unknown function (DUF4949). This small family consists of uncharacterized proteins around 140 residues in length and is mainly found in various Legionella pneumophila and longbeachae species. The function of this family is unknown.	1.10812e-24

>NZ_CP025491.1|WP_101900413.1|2946414_2946897_-|hypothetical-protein
MIRIYLNEAAKIDLIRLSRSQKSNIGERAYYVLLCGEGHSVSETAKITGRNEHTIRLWLKRYITCGITGLKSRSQPGRPARKAPIIESQLEESLGKSPQEYGYQEAGWQINLLRDWFEKQGMTACDNTLVKSLNRLVLCINDFQKSYQQMHHPRLRKNHG
>NZ_CP025491.1|WP_101900412.1|2946059_2946278_-|hypothetical-protein
MKARLSKTIFGALNMRTSRFYWKQADTGNSQQFIMFLHQFHKANPNKKLMIILDNRPIHKSKKVQKFVRKND
>NZ_CP025491.1|WP_101900411.1|2945870_2946059_-|hypothetical-protein
MNLFFLPAYSSEYNPIERFWQWLKQRVYGCKSFSTMEELLQQIRKLVWHFREGRTVSKINFN
>NZ_CP025491.1|WP_101900410.1|2945345_2945795_-|hypothetical-protein
MNNAFGFYREYDGYKFMCVFARKKESVAPKLNFSAEKSMMNIVWKFLNQILPYYQQENSALKYSRISQDASFRKNFIFGQYKSSFLELKDRERGCLFWARYGKSTSETSKILGLKRATVKKYLEGVREKCQVSSIQEAITLALQHQFIS
>NZ_CP025491.1|WP_101900409.1|2944083_2945349_-|MFS-transporter
MSYHMENKKKRVTVASIGTFLEWAEFTYFAYIANIIAALFFPELSSRLGLIATFSVFAVGYFFRPLGSLYFGYLGDKLGRRVALQASIMLMGISSLLIGCLPTYNTIGILAPTLLVLLRCTQGFAVSGEFNGSAIYLIEHDVEKPCQAGSWTGFASALGMMFGGLMATLISYHQMPVWAWRIPFLFGTLSCFCALYFRRNLSESPAFLSMTKERSVNPLKILFKNYKNKLLKAASLIAALSIYIYIMNVFYATHLAKYTTLQATETKLIVTFAQGLVALFIFSIGILADKINEQRLITMGFIGYFIAAPLAYWVPQTNSFILILLAQIPYALCNALVGVPIFKILNDFFPTQIRYSGVSIAWGVSTAIFGGTAPLVAVYLQNLFNLSIAPIFYILLSATIALLVLQNKKRYKVTSMKLELR
>NZ_CP025491.1|WP_101900408.1|2943751_2944084_-|hypothetical-protein
MTIVERRGLWNPEHYFKNSATQFGHATELLKNYPFKGDELILDVGCGDGKITVALANLVPNGQVIGLDKNSTTINFAQEKFPSNSYPNLSFLHGDVTHPSNLGKFSNRFI
>NZ_CP025491.1|WP_101900407.1|2943300_2943669_-|hypothetical-protein
MLYRKCKAQWDALNKTSAHTKWSHYFKNYDPGYYEYLPTSYQELLNASGLGRFKAEFTTEEQISYEDIETFTNFMKGWLPHLNILPKEHHDEFLSLFITDYLNNLNTSISKITIPFVRLIIA
>NZ_CP025491.1|WP_101900406.1|2942295_2942676_-|DUF4949-domain-containing-protein
MKFRAKLFSFTLASILTGSVFSVQFECPKIEVIKTEDFLFAEKIKENFYLTYNISKFETDSYWVFVLRPIEAETANKAKHRANEVLSKMYEQGVFMEEDGESFCQYPTGDNTLLARAAPENLLSTM
>NZ_CP025491.1|WP_101900405.1|2941716_2942250_-|hypothetical-protein
MKQSIKFEMSLPDSSFSLYLRQLHEESNRLVVILEVVESDVGFSFSMVQDMFLNLIIYTKCNHELPVICFVIQDTEPNYWLEKVNHVRSNKEIILSADAICIYNGELKVPKQFMMVPKYYEIHNGQAIETTINSPQETKVSNTGMFSSSKNDTDDTKNGKDDTVEADKSYFSQCTII
>NZ_CP025491.1|WP_101900404.1|2940563_2940821_+|hypothetical-protein
MLLSLAQDEGFIKIVGEVGTGKTLLCRILLNQLAEDYVTVYIPNPDQTAKSMRFAIASELGIPAETHWNQHQTLEAIKLRLLELT
>NZ_CP025491.1|WP_101900414.1|2948562_2948745_-|hypothetical-protein
MFLIFQAMIIMSAKPIKHDACSKIYVQIMNERFNVKVWPIINTFYDIISAHDLRDLFKLS
>NZ_CP025491.1|WP_058466449.1|2949324_2949552_+|hypothetical-protein
MGIPIRIDETIYYEAKKVAAAEFRSIPNQIEYWAKLGKCALDNPDLPIEFIKDVLLSKLQDKSLAEPFQFEGEGG
>NZ_CP025491.1|WP_058466483.1|2949568_2949823_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MPAFKKAYKKLPSSHKSIINEAVRIIVNNPKVGEEKKGDLAGVYVYKFKMNHQQFLLAYEWEPTLRILVALGVHENFYRDLKRK
>NZ_CP025491.1|WP_101900415.1|2951190_2953161_-|hypothetical-protein
MLPLFPKEDQPITIEQGRVGDCYLLAAIDCLYNSKDGKKRLTNMFTELSNGDIEVRIQYSKQSQYLKPEKVKLKYQYKNNIENDIITIPKDRLELIAKDQRGVKTNSLAVLILEHLSPYFFTVAREDSLLAHNHIIRYEGTDADFIAKLVGFEAGYLEDINQVIKLKTIAPHEPVYFTLDYGQQDRRGVYHSRHALRVDKITPNPQIPGGYEFSLVNPWNTRIIETWSQEDIKKRRPKYACFYKNKEKKAFSLKILSIPEHEAGFIFNHAELKENLFSLFRTRNDVNTQFLLNGVSLYKRFPSIFDKIPSIASRELSIFNSSIQKDALIACLKSSPEQFENNYKLLIKKCFPNTDFASQEEVNKLTDLINQNVRRQSGAPIEKPEEKIMDFYFFQDFEKLPPGNIRNTFIHPETIAAVPQLKKKLLARGLHLLAINDIGQFGVDGKDFLKSEHPVDQQLYKDIRAQEKNFLNPLKSIFNVRSINPSLSKQLLKLAKEDLAKTNVKTIKTMIDKQPDDAFKAWLKSMFDSDIELRTKWNNNLALEIRALLKDPSQLSSLPAFFEKINNDDFINKYIKVYEKHFGIVPKKEIGDIVLNEWQRKMNNERHQRKKPLGESTPNDAPVRNLNLLFKPFPQPSFNKDLNNDNEETYRKNPLA
>NZ_CP025491.1|WP_101900416.1|2953831_2955250_-|hypothetical-protein
MSYSNLETVRSTNLTTLNVWLCNDGDFNTDIQKAEKYLQNMGNFILSSVDFTPLEFAEKMEVKLKRILGQADNTIQEEKLNDCINKIENYKKFLKLNLPAAEKKANNLIKQYKNVTDIKEECLNEMLRAKPKLHRARNLFIKVAQQADKSIFQRGINSYQILWDQLSTNLKIFKDIVKKYPENQLALLLHDPQSFIEALEDGKIPLGGELGALALQRIFSEYPQLTVRQKVSIATLIEKTQIERDTHCNSVALKSEIIKLQLYAQYCRDNDLPLVAWIGSARPVFSMIADHPGEGAYLNCDDAKWSPELNSTWLLIVSSMGYEIKLVEQHYPKVVDALTSGNILNYVSALIDEIRPFRKEFDSQYHGGDQPTATPQEILRLMSIGCKAKKNDDGSVSLTPPKSWVAEDYRSRKIKGLPQKDNIGRESQDVGVSRTRRHSVAFFKGSAQPVKKSLFEHPGESEEIRKNEKPKL
>NZ_CP025491.1|WP_012979185.1|2956496_2956937_-|hypothetical-protein
MAKIFWGISFLSTLGAILYYNLFTPNSAPQQAALAAMTLVIAILPYCLARAVAEAEKIAEVKEKTELHKEINSTFLDYFILNRISLLFTLTNVEHLSTPTYEQIINRVNYLKKLLDEDLISNDEYEQARNYLLVTLKDNLKQQIER
>NZ_CP025491.1|WP_041819071.1|2957357_2957543_+|hypothetical-protein
MDLPFYFERQRKGGKLYLNLHHQNKRYRKRYGSPKRTGPIKNCRLNLCRCQAFKIIQNLNE
>NZ_CP025491.1|WP_012979184.1|2957928_2958108_+|hypothetical-protein
MKKPGSIADKSGQYEIVGPRGGKTGEERTVTKGEPLPPTPKPGQGYILVDSSKNKSGKK
>NZ_CP025491.1|WP_012979183.1|2958922_2959591_+|SOS-response-associated-peptidase
MCGRFSYIASYETLKYQFNSTNSVEITPKFNIAPGTDVLCLIKTNSNEVQSVLLHWGLIPSWATDRKKIGSLINARAETLFEKPAFRNAMKSKRCLMPMSGFYEWHMESGVKQPYFFRLKNQELLAVAALWDTWQSATEVIHSCCLITTEANSVMQSVHHRMPVILDKEGQSLWLDNSQCPKEELLALLKPYSNEDLQGYRVSTLVNNADFEHPLVIEPLPQ
>NZ_CP025491.1|WP_012979182.1|2959727_2960234_+|SOS-(Error-prone)-mutagenesis-protein-UmuD
MSPRGGTRPGAGRPKGEPTKTVRLPVSLLAELEQLKERPNYQLPIFSSKVQAGFPSPADDYIEGYLDLNTKFIKHPSATFVLQVMGDSMVEAGIFSGDWLLVDRSIEATDGRIVIAAVNGELTVKRLSKKEGKIQLLPANPKFKPIDITQDCEMVVWGVVTLVLHELV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025491_1	1.2\|248090\|44\|NZ_CP025491\|CRISPRCasFinder	248090-248133	44	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	257659-257702	2	0.955

1. spacer 1.2|248090|44|NZ_CP025491|CRISPRCasFinder matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 2, identity: 0.955

atggtgaattaatgcaaagaaatacaataataaatttattttta	CRISPR spacer
atggtgaattaatgcaaataaatgcaataataaatttattttta	Protospacer
****************** ****.********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

45199 : 100581

Prochlorococcus_phage(33.33%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101898461.1\|45199_46486_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-98	46.7
WP_101898462.1\|46682_47453_-	acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_003635379.1\|47449_47902_-	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
WP_101898463.1\|48056_49100_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003635375.1\|49114_49615_-	membrane protein	NA	NA	NA	NA
WP_101898464.1\|49779_52092_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_101898465.1\|52226_53579_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_101898466.1\|53743_54526_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_101898467.1\|55819_57361_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_101898468.1\|57353_58577_+	peptidase M24	NA	NA	NA	NA
WP_101898469.1\|58667_60020_+	peptidase S41	A0A0R6PIZ1	Moraxella_phage	1.6e-19	26.6
WP_101901406.1\|60210_61053_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_101898470.1\|61168_61744_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_101901408.1\|61876_62542_+	hypothetical protein	NA	NA	NA	NA
WP_101898471.1\|62689_63418_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_101898472.1\|63613_65098_+	adenosine deaminase	NA	NA	NA	NA
WP_101898473.1\|65650_66949_-	adenylosuccinate synthase	A0A285PX35	Cedratvirus	5.3e-68	34.3
WP_101898474.1\|67035_67950_-\|protease	protease modulator HflC	R4VJU7	Alteromonas_phage	7.6e-05	24.6
WP_101898475.1\|67952_69089_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_101898476.1\|69158_70283_-	metal-activated pyridoxal enzyme	NA	NA	NA	NA
WP_101898477.1\|70356_70980_-	LysE family translocator	NA	NA	NA	NA
WP_101898478.1\|71078_72467_-	hypothetical protein	NA	NA	NA	NA
WP_101898479.1\|72540_73227_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_003635329.1\|73388_73625_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_003635328.1\|73640_73805_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_101898480.1\|73934_75332_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_101898481.1\|75482_75776_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_101898482.1\|75950_76220_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_101898483.1\|77099_77837_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_003635287.1\|78011_78290_+	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_027269657.1\|78320_78839_-	hypothetical protein	NA	NA	NA	NA
WP_101898484.1\|78943_79678_+	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
WP_101898485.1\|79694_80705_+	fructose-bisphosphate aldolase class I	A0A0K0KVJ8	Prochlorococcus_phage	3.8e-74	48.4
WP_101898486.1\|81045_81801_-	hypothetical protein	NA	NA	NA	NA
WP_101898487.1\|82024_82870_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_101898488.1\|82866_84456_-\|protease	zinc protease	NA	NA	NA	NA
WP_101898489.1\|86069_86522_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_101898490.1\|86508_86994_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_101898491.1\|87004_88345_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_027269647.1\|88350_89220_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_101898492.1\|89325_90915_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.7e-66	46.3
WP_101898493.1\|91161_91806_+	short-chain dehydrogenase	NA	NA	NA	NA
WP_101898494.1\|91959_93702_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_101898495.1\|93959_96125_-	acyl-[ACP]--phospholipid O-acyltransferase	NA	NA	NA	NA
WP_101898496.1\|96258_97080_-	4-amino-4-deoxychorismate lyase	NA	NA	NA	NA
WP_101898497.1\|97134_97329_-	hypothetical protein	NA	NA	NA	NA
WP_101898498.1\|97588_98167_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_003635241.1\|98192_98534_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_101898499.1\|98640_98898_+	hypothetical protein	NA	NA	NA	NA
WP_101898500.1\|99072_100581_+\|protease	ATP-dependent protease	NA	NA	NA	NA

DBSCAN-SWA_2

3555568 : 3562370

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101900831.1\|3555568_3556366_-	phospholipid ABC transporter ATP-binding protein MlaF	G9BWD6	Planktothrix_phage	3.2e-23	33.8
WP_101900832.1\|3556498_3557461_+	D-arabinose 5-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	32.4
WP_101900833.1\|3557460_3557988_+	3-deoxy-D-manno-octulosonate 8-phosphate phosphatase	A0A140XBD6	Dickeya_phage	8.5e-25	43.7
WP_101900834.1\|3557984_3558560_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_101900835.1\|3558540_3559080_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_101900836.1\|3559076_3559802_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-19	27.0
WP_101900837.1\|3560007_3560574_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.5e-56	53.2
WP_101900838.1\|3560563_3561598_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.4e-77	46.6
WP_101900839.1\|3561590_3562370_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.1e-55	52.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025493

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025491

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection