CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP028565	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pGES5_045096, complete sequence	0 crisprs	NA	1
NZ_CP028566	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pKPC2_045096, complete sequence	0 crisprs	DEDDh	0
NZ_CP028568	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 chromosome, complete genome	5 crisprs	cas3,DEDDh,DinG,WYL,csa3,RT	6
NZ_CP028564	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p3_045096, complete sequence	0 crisprs	NA	0
NZ_CP028567	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence	0 crisprs	cas14j,PD-DExK,c2c9_V-U4,DEDDh	3
NZ_CP028563	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence	0 crisprs	NA	0
NZ_CP028562	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12172 : 20129

Escherichia_phage(16.67%)

integrase,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001389365.1\|12172_12937_-\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001297012.1\|13024_13138_+	hypothetical protein	NA	NA	NA	NA
WP_000376623.1\|13443_13944_-	N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|13962_14142_+	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|14071_14911_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|14904_15252_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_012658785.1\|15473_16337_-	carbapenem-hydrolyzing class A beta-lactamase GES-5	A0A1B0VBP7	Salmonella_phage	5.6e-42	39.0
WP_000845039.1\|16516_17530_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_107979018.1\|17498_17798_+\|transposase	transposase	NA	NA	NA	NA
WP_011222055.1\|17802_18390_+	recombinase family protein	E5FFF9	Burkholderia_phage	9.7e-54	56.9
WP_101617792.1\|18461_20129_+	modification methylase PaeR7I	R4TFP1	Halovirus	6.2e-21	24.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028568

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028568_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028568_1

67465-67567

Orphan

Consensus_repeat	Method
GGGCTGTTTTCCAAGTCCAGAGGGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028568_1

>merge|NZ_CP028568|1|67465-67567|CRISPRCasFinder
GGGCTGTTTTCCAAGTCCAGAGGGGCGTGCCATGTTTGAGAGTCTGGGAGTCATCAATGTCTGGACCTGCTTGACCGGGCTGTTTTCCAAGTCCAGGGGGGCG

>NZ_CP028568|1|1|67465-67567|CRISPRCasFinder
GGGCTGTTTTCCAAGTCCAGAGGGGCG	TGCCATGTTTGAGAGTCTGGGAGTCATCAATGTCTGGACCTGCTTGACC
GGGCTGTTTTCCAAGTCCAGGGGGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028568.1\|WP_101618178.1\|73473_74571_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366088
NZ_CP028568.1\|WP_101616839.1\|60838_62026_+\|enoyl-[acyl-carrier-protein]-reductase-FabV	unknown	unknown	gnl\|CDD\|237460
NZ_CP028568.1\|WP_011704092.1\|63927_64557_+\|non-heme-ferritin	unknown	unknown	gnl\|CDD\|224445
NZ_CP028568.1\|WP_101618180.1\|70973_73454_+\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|225729
NZ_CP028568.1\|WP_016348904.1\|56643_56805_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616833.1\|56789_57719_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP028568.1\|WP_101618182.1\|70178_70880_+\|molecular-chaperone	unknown	unknown	gnl\|CDD\|225663
NZ_CP028568.1\|WP_101616841.1\|62032_63823_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP028568.1\|WP_101617825.1\|77582_81041_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|182169
NZ_CP028568.1\|WP_101617823.1\|81076_81517_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616843.1\|66011_67232_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031
NZ_CP028568.1\|WP_107979036.1\|75357_75879_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|381090
NZ_CP028568.1\|WP_043118040.1\|64637_65825_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224992
NZ_CP028568.1\|WP_107979035.1\|69839_70115_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185131
NZ_CP028568.1\|WP_031285326.1\|68751_69699_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP028568.1\|WP_101616835.1\|57780_58755_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP028568.1\|WP_107979037.1\|77186_77429_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225107
NZ_CP028568.1\|WP_021141311.1\|76081_77218_+\|ISAs1-like-element-ISAs12-family-transposase	unknown	unknown	gnl\|CDD\|379382
NZ_CP028568.1\|WP_101616837.1\|58733_59747_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183400
NZ_CP028568.1\|WP_010635648.1\|59938_60373_-\|universal-stress-protein-A	unknown	unknown	gnl\|CDD\|185073

Protein	Function_ID	Function_description	E-value
NZ_CP028568.1\|WP_101618178.1\|73473_74571_+\|hypothetical-protein	gnl\|CDD\|366088	pfam00419, Fimbrial, Fimbrial protein.	0.000964796
NZ_CP028568.1\|WP_101616839.1\|60838_62026_+\|enoyl-[acyl-carrier-protein]-reductase-FabV	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP028568.1\|WP_011704092.1\|63927_64557_+\|non-heme-ferritin	gnl\|CDD\|224445	COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism].	2.12756e-87
NZ_CP028568.1\|WP_101618180.1\|70973_73454_+\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|225729	COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion].	0
NZ_CP028568.1\|WP_101616833.1\|56789_57719_-\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	1.26589e-24
NZ_CP028568.1\|WP_101618182.1\|70178_70880_+\|molecular-chaperone	gnl\|CDD\|225663	COG3121, FimC, P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion].	5.08363e-61
NZ_CP028568.1\|WP_021141311.1\|76081_77218_+\|ISAs1-like-element-ISAs12-family-transposase	gnl\|CDD\|379382	pfam13808, DDE_Tnp_1_assoc, DDE_Tnp_1-associated. This domain is frequently found N-terminal to the transposase, IS family DDE_Tnp_1, pfam01609 and its relatives.	1.27187e-31
NZ_CP028568.1\|WP_101616841.1\|62032_63823_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.32633e-51
NZ_CP028568.1\|WP_101617825.1\|77582_81041_+\|histidine-kinase	gnl\|CDD\|182169	PRK09959, PRK09959, acid-sensing system histidine kinase EvgS.	8.01985e-126
NZ_CP028568.1\|WP_101616843.1\|66011_67232_-\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.63971e-104
NZ_CP028568.1\|WP_107979036.1\|75357_75879_+\|DNA-binding-response-regulator	gnl\|CDD\|381090	cd17535, REC_NarL-like, phosphoacceptor receiver (REC) domain of NarL (Nitrate/Nitrite response regulator L) family response regulators. The NarL family is one of the more abundant families of DNA-binding response regulators (RRs). Members of the NarL family contain a REC domain and a helix-turn-helix (HTH) DNA-binding output domain, with a majority of members containing a LuxR-type HTH domain. They function as transcriptional regulators. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	8.46642e-32
NZ_CP028568.1\|WP_043118040.1\|64637_65825_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224992	COG2081, COG2081, Predicted flavoproteins [General function prediction only].	0
NZ_CP028568.1\|WP_107979035.1\|69839_70115_+\|hypothetical-protein	gnl\|CDD\|185131	PRK15209, PRK15209, long polar fimbrial protein LpfA; Provisional.	4.60767e-05
NZ_CP028568.1\|WP_031285326.1\|68751_69699_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	7.29593e-93
NZ_CP028568.1\|WP_101616835.1\|57780_58755_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.28267e-43
NZ_CP028568.1\|WP_107979037.1\|77186_77429_+\|hypothetical-protein	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.71224e-18
NZ_CP028568.1\|WP_101616837.1\|58733_59747_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183400	PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed.	0
NZ_CP028568.1\|WP_010635648.1\|59938_60373_-\|universal-stress-protein-A	gnl\|CDD\|185073	PRK15118, PRK15118, universal stress protein UspA.	1.41472e-43

>NZ_CP028568.1|WP_101616843.1|66011_67232_-|MFS-transporter
MEKSLNTDQPLAAATAHDALNRTTYPVIAAISFSHLLNDMMQSVLLAIYPLLKLGLNLSFAQIGLITLTYQFTGSLLQPLIGLYTDRRPMPYSLPFGMGFTMIGLLSLSQAASFGAVLLSAMLIGIGSSVFHPESSRVARMAAGSQPGLAQSLFQIGGNLGSAIGPLLAALIIVPQGQGSAAWFSLFALVGVIVLSLVGRWSSHHAANFHKRMKAHLGHGLSRRQIGWSLAILGLLMFSKFFYMASLSSYYTFYLMDKFSLSLDSAQLYLFAFLFAVAAGTVLGGPIGDRIGRKRVIWISILGVAPFTLLLPHVDLFWTSVLSVIIGLILASAFSAILVYAQELVPGKVGTISGLFFGFAFGMGGIGAALLGQLADATSIETVYRVCAYLPLIGLLTAFLPTLRKG
>NZ_CP028568.1|WP_043118040.1|64637_65825_+|NAD(P)/FAD-dependent-oxidoreductase
MMKQFDVVVIGAGAAGLMCAAQAGYRGRSVLVLDNAKKPGRKILISGGGRCNFTNHQAGPHAFLSANPHFCKSALARYTQQDFIELVDRHGLSYHEKTLGQLFCDESAKEIVDILLTECDWAGVALQFQTEILTVSKREEGFVLTTSQGEISCHSLVVATGGLSMPKLGATPYGFKLAEQFGLKVLPTRAGLVPFTLHQAEKEAFADLAGVSLPVAVTAEDGTCFKEAMLFTHRGLSGPAILQISSFWLAGEKIHINLLPELDIAATLREWAQAHPAQELKTVLGRELPKRFVDKLVELGQLVSKPMRQYNERELEAVATLLGDWQILPNGTEGYRTAEVTLGGVDTNELSSKTMEARKVAGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAGQYC
>NZ_CP028568.1|WP_011704092.1|63927_64557_+|non-heme-ferritin
MRRKAVTTESSGSGIWLLHNETVATIVTKSQWRIIMLAKAMIEKLNEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLRQHAVEERQHMERLFTYVSETGAMPLLGAIDAPPHEFKSLGDIFRTTLEHEYHITKCINGLAHVAFTTQDYSTFNFLQWYVAEQHEEEKLFKSIVDRLSLVGEDGKGLYFIDKELAELAKGAPASIMDGNA
>NZ_CP028568.1|WP_101616841.1|62032_63823_-|GGDEF-domain-containing-protein
MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDMEQFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQALTLLEQLKTAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPDSTIASLQCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYIDTDRPAQARRLLDNLLANPALAPDYRAIILGYQAMALNAQHDWAGALRTLDEAQALYQQLGYPEAGGRLLETRARALQGSGEKQLALQLLTSQGPAGAGSKALQASLLADQGRYPEAYQALNEYVNDYKQHFNQTLSQHAAAFQAEMDLARSEASNRVLQQENENKRQQLLHQQSARHYQLALVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQWQQEGPLTLLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEFLVAVPLPAADCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMYQAKRQGRNQTILAAEPNNPEQPEALASSVA
>NZ_CP028568.1|WP_101616839.1|60838_62026_+|enoyl-[acyl-carrier-protein]-reductase-FabV
MIIHPQIQGCVARNCHPIGCRAAVLQQIERIRVAGPFNGPKRVLVLGASSGFGLASRIALTFGAGADTVGVSFERGPSDKGPGSAGWYNNIWFRKEAEQAGRIAINLIGDAFSTGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTGQPFSGWGLDLEQDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQTVAYSYIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAEIGGHAWVSVCKALVTKASAYIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHELDPAIQAAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLSELLP
>NZ_CP028568.1|WP_010635648.1|59938_60373_-|universal-stress-protein-A
MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDVDLKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAVRDYQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK
>NZ_CP028568.1|WP_101616837.1|58733_59747_-|tryptophan--tRNA-ligase
MHNPVILTGDRPTGKLHIGHYVGSLRQRVEAQHHYRQFVMIADLQALTDNGHNPAKVTDHVLEVMADYLAAGLDPAKTTFCLQSALPALAELTTYYLNLVSVARLERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQTNEIVRRFNSLVGKEVLTECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEIKQAVFSMYTDPNHLKVSDPGQVEGNTVFAYLDAFHPDKALVAEMKAHYQRGGLGDMRCKQVLNDCLQTLLAPMRERREAAIADKRQLLRLLQQGTEQARALTDEVLAEVKGAMGLDYFAGLN
>NZ_CP028568.1|WP_101616835.1|57780_58755_+|LysR-family-transcriptional-regulator
MEMPLSRLDLNLLTVFDMLMQERNVTRAAERMHLSQSTVSHALGRLRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFRIATPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANHLSPRLWREPWFNNPLVCLSPLGSELPDVLGPDDLVSRPHIHTSSWGHSQAMVDLWLARFGVERELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYLMAGHPLTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK
>NZ_CP028568.1|WP_101616833.1|56789_57719_-|EamA-family-transporter
MHRRITSEIKMRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAAGRALCGSLTLGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVVMGCIPFVTILMAPLLVSGEKITKGGLVSVVIGFVGVLVLFWPKLASGMNAGLLGAMAILFGASCFAIGLLMIKRFAKDHPVVVARNILISSAIQLLLAAPFVTDLSALTMPSQHAIGAVAVLGVFCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGALFLGEQIQSTTGVALALILGSVALNQWAQQRRVQREAALCQAS
>NZ_CP028568.1|WP_016348904.1|56643_56805_-|hypothetical-protein
MSGILTTLCGGLVVIAGWQYRQRLMGLLGLLMVLLPWFFDSKLQAMLSYALSA
>NZ_CP028568.1|WP_031285326.1|68751_69699_-|IS30-family-transposase
MRYHQLTEGQRYQIACLHDHGLSQAMIARKVGVHPSTISRELRRNRCAQGYQPAEAHQSATLRRCSSSKYRVPEDTLIFVTMALAADWSPEQISSVCRRIGCPVSHEWIYRYVAQDKANGGKLFRHLRQGHKRYRKGQNAKRCVIPNPVSIDERPAIVDSRSRLGDWEVDTVSGKQGSGAIVTLAERKSRLYLVQYVPAKTAAAVADAIICMLEPYKAHVHTITADNGSEFVEHERVAKVLNAQFYFAHPYSAWERGLNENSNGLLRQYVPKGSDLSQLSPDELSAFERRLNLRPRKCLDFRQPQIVFDELRQVA
>NZ_CP028568.1|WP_107979035.1|69839_70115_+|hypothetical-protein
MALMPNVGSTEGKLLKNIDISNEAAHGVGIVVLDNRNKALDFESGAVYLDAPLKEGNARIKLSAAYAKDTTEEKVTPGAVSAVLPFVLTYE
>NZ_CP028568.1|WP_101618182.1|70178_70880_+|molecular-chaperone
MKKLYIGAILFILGGISYASASISLSATRLIYNQKDNEVSINATNDGEQDVLIQSWLEAFDNSAPPFAITPPLAKISGKERQLLRVFYQGDGLPQDRESVLWLNVQEIPKESSSKNSIQLAILQRIKLFYRPEALSGNALSAPLNVKGYFSGGSLELSNTTPYHINLVSIQQGNNVVKAEMISPYDAVNFDVRKFKSNGVVTLRVVNDYGAARTIKGVLKSGKLCDLKFAKDD
>NZ_CP028568.1|WP_101618180.1|70973_73454_+|fimbrial-biogenesis-outer-membrane-usher-protein
MLLRAKKLLTLATIIVLAVISQSVSGQVVSNVKQNKNARFNTAFLHGDRIDIDKLFSSPDIIPGVYRLELFLNNEFSSMENIHFATVNGKVKPCIPSELMERLGVNFAGLEDILYFHNNVQCVSIEKVEYANWRYEERTQRLYLSMPQSRFYHKYKGYISPELWDDGVIAFYSNYSIQSRYDHASSSGSHNSNTVILNNGFNIMAWRFRNQSNLTGQDGNSSWRSERTYLEHDLPDWSSQISVGEIYGRSDVFDSPSLRGVQVRSDESMLPDELRGYSPVVTGIAETNATVEIRQGGIMVYSTTVAPGPFELRDIPTYGSNGDLEITVIESDGRRKAQTQGFGMLPVMVRAGVGRYQYSFGQLEHESLAPSERWYFSADGAYGLLSDLTIFGGIQGMKNYGAINGGIGFGTRFGSLSVDVTHSDSSSLEGHHSGESYRFRFGRVFHDAGTTLALAGYRYATEDYRSLNEHITSSSHNITASHRYSLRSELSASVTQQLPSEWGNLNLSASEQDYWDNSQRSRTLSGGYGNYLGKLSYQVNVQHSYSQTSGDTQLMLYATYPLSFGGGSHSISFSSSHNKGENERAQRTSVGLSGGWDDYSYSISASNDQHGNNSLSASSYINTAFGSGGGGYSHGREYSSFNANWNGSVVAHAGGLNFGPVVQDGFILAEVKDVEGVGFRNSKATTGRNGFAIIDQATPYRRNEITVDTQTLPTGVETATGNAYVVPRRGSISKVSIQARSVQRVQFTLLNEEGKHYPFGTQLESKYGDILALADPNGRALAVIDRTVKSFVIREPSGRACIVDYKISGRARITTRYERAVLQCTQ
>NZ_CP028568.1|WP_101618178.1|73473_74571_+|hypothetical-protein
MAIMRLFLYFLLSLFPFSVIAEGCGNINPNLVSSSSGACEINEVHPYYMGDAISVSDPEGTKVGDVMLRYKFTCMLPYDSSGHNDNYMQLGLDVRKDVSAGDKIRTTLDQRIFMKADLQKLAGQYGYIIPSIIAAPEEHGGGAGATKIRAKEVVINGKKYWCGHDQNDKVILSAYRGVGVIEPGENRLSTYSKADFVMGHFTGSGSTKPIGQSLGDFMITIGNATCKFRNSNGDITVNINNGAPMSSDEFDKIVTNFDVPLECSSVQMDVKYKIKIQNDVGRAAEGIFGLTPAVDGASGVGYKLSRVENGAVTKAMDLSRSLHIERKGPDMRAYDLSFSVSPIKLGNNVVPGNADATLLLELDYD
>NZ_CP028568.1|WP_107979036.1|75357_75879_+|DNA-binding-response-regulator
MAKVLIVDDHPAIRLAVKYLLEQAQHEICGEVDNGVDAIQEFRMKSPDIVVLDLGIHRLDGLEVIKRIKTINVSAIIIILSTHNSRHVMLRCYQAGANGFVSKLEDLQQLRAAIDECSKGGKFFQSYILEQDKSSSGIDIIALERLSDQGEIVNILLKIKNSFLPTKQILIGL
>NZ_CP028568.1|WP_021141311.1|76081_77218_+|ISAs1-like-element-ISAs12-family-transposase
MSIDAVFAQFFDNIHDPRQHAKIYYPFYDVLFLTVCAVIGGAEGWEDIEDFGEVHLPWFQSKGLFKNGIPVHDTIARIISGIKPEPFQAAFVRWTQAINQHTDGALVAIDGKTLRSSYDREDRTSTIHMVSAYAAANKLVLGQIKTDAKSNEITAIPELLALLDIKGCLVSIDAMGCQTEIAETILQQGGDYLLAVKGNQPKLFEAVRQALAPLAATPLCAETMTLEKAHGRIDGREYHVMAAGELAAQFPHWKQLHSIGVAISYRVENMQKITIEQRYFISSKALVQDEFARAVRGHWAIENSLHWVLDVTMGEDDCPIYRGDAAEILACIRHMGLNMLRAETSRKASVRRKQKIAGMSSEYLETVLNAGLKKLGEI
>NZ_CP028568.1|WP_107979037.1|77186_77429_+|hypothetical-protein
MRVSKNWVKFNKMFTLSPWLSDREMNVFLAICQGKSNKDIAENMLLSEKTISTYKTRLMKKLAVENMVELLELAKRTHII
>NZ_CP028568.1|WP_101617825.1|77582_81041_+|histidine-kinase
MQKQWLAKKVKLVLAVSQLDSPPLDVIRRKTLDGFIYEGVNADFSNVIASSLNAVIEVKSYRSRQDAMQAVINGDADFISSVRESEDSNEIALTQPYLKDAFSLYKRIGLQDRDIKKVALVELSIPRHLIRKYLPNVDIEYFPSPYSAVAAAVYGNVDAVLIDSISGNFIKNKFYNGLLDTGKEIVEEDQGLSFATVQENNILQGILDVALLNLPHIYRVTILKRWNGGKMSVLDGVGITDEDKSALRKKSPITIAINTNIPPLSYIDKNGNYAGVMADILQHVANKLAVDFDILQVSSYVDAIRAVESGNADLIFMSPSPSRWRQFVFTRSFIFEPVVYLVRSHNVGRIYLDNMTHGGSLAVLDRDILSSVLINDEFTKNTIKFSQLEDALSCVLNGKCQAIVLPLSVARYFSDVKYSGRLAIAGEAFQSTPFGVGFAGTTENRNLIETLDKVISLIPPDGLNSLEGFREVSVKRSAITWWDLYQDFGVAISISIIIISWVLLWSVSLRKQIKLRRAVEADLNTKLNFIQELVDSTPHPVYSRDDAGRLTLCNHSYSAFLGEDKKTLLGTIFSETESRWPYLKPLLQVYEDSICDGLPRHDDYTLWLENRKVHLYHWLQPIRDSTGQVNGVVGGWIDVSERIRLLDELAAASQEAQKSNRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLHEEDKTSLSIAHGSARDLLSLIGDILDISKIESGRLELRPEPHEIAALTASVVTVFTALARQKNLQLELAAGEPRWVQIDGICYKQILSNLISNAIKYTEQGSVRVELQSKTSDGWCTLQLVIRDTGIGIAPVEQARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLLLESEPGHGTCISIEMKLPLASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQQLAYLGHDATAAESGREALALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTHRCLILGLTADARQEQVSEGLTAGMDDCLFKPVGLEELERCLCRHMQHQEQREIERCVQEIKQCLGPLTGNQPALMLPLLHEFVRASDDDLLGLQQAAEGGELARFLDYVHRLKGGARIMGAMTLVAVCGEIESGGIAPQGLPMALRQLQHAYGIVRQAMVQMQAEPE
>NZ_CP028568.1|WP_101617823.1|81076_81517_-|hypothetical-protein
MSQKGVLVALLAGCCAMAAQAGTHTYQLNWPATASKSTGMEISLTHPGQQPVNSVSTSSPVQAEAINVSNPDFNTTYQLQARTLYASLPEQAGTDFKLALNGQPLPRHHALPLTQATRYFLSYLAPAARPDQTGEAAYELLVYWHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028568_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028568_2

740111-740215

Orphan

Consensus_repeat	Method
GGTGACATGAGTCGTTTTCAGGCCATTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028568_2

>merge|NZ_CP028568|2|740111-740215|CRISPRCasFinder
GGTGACATGAGTCGTTTTCAGGCCATTGCACTGGAAGCGGGACTGTATGGTACCCCAGCCGTTTCGACATTTTGGAGGTGATATGAGTCGTTTTCAGGCCATTGC

>NZ_CP028568|2|2|740111-740215|CRISPRCasFinder
GGTGACATGAGTCGTTTTCAGGCCATTGC	ACTGGAAGCGGGACTGTATGGTACCCCAGCCGTTTCGACATTTTGGA
GGTGATATGAGTCGTTTTCAGGCCATTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028568.1\|WP_101616519.1\|734191_735196_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190
NZ_CP028568.1\|WP_005304873.1\|736701_737019_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225653
NZ_CP028568.1\|WP_101616517.1\|733618_734062_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240034
NZ_CP028568.1\|WP_045525426.1\|736328_736556_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_011707347.1\|737892_738513_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP028568.1\|WP_101616515.1\|732229_733381_-\|chorismate-binding-protein	unknown	unknown	gnl\|CDD\|273350
NZ_CP028568.1\|WP_101616527.1\|742890_744204_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
NZ_CP028568.1\|WP_101616538.1\|748446_749172_-\|DUF3142-domain-containing-protein	unknown	unknown	gnl\|CDD\|371478
NZ_CP028568.1\|WP_101616543.1\|751802_753956_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP028568.1\|WP_101616525.1\|741836_742676_+\|isopenicillin-N-synthase-family-oxygenase	unknown	unknown	gnl\|CDD\|226022
NZ_CP028568.1\|WP_005304871.1\|737107_737584_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP028568.1\|WP_101616521.1\|738678_739920_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340888
NZ_CP028568.1\|WP_101616541.1\|751295_751760_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616536.1\|746711_748337_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381139
NZ_CP028568.1\|WP_043127347.1\|741064_741628_-\|DUF2799-domain-containing-protein	unknown	unknown	gnl\|CDD\|378521
NZ_CP028568.1\|WP_101616531.1\|745376_746690_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
NZ_CP028568.1\|WP_017411109.1\|735798_736293_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP028568.1\|WP_080708629.1\|735278_735755_-\|organic-hydroperoxide-resistance-protein	unknown	unknown	gnl\|CDD\|274649
NZ_CP028568.1\|WP_101616529.1\|744204_744921_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270422
NZ_CP028568.1\|WP_101616540.1\|749141_751235_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP028568.1\|WP_101616519.1\|734191_735196_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	2.53953e-171
NZ_CP028568.1\|WP_005304873.1\|736701_737019_+\|hypothetical-protein	gnl\|CDD\|225653	COG3111, COG3111, Periplasmic protein with OB-fold [Function unknown].	0.00960974
NZ_CP028568.1\|WP_101616517.1\|733618_734062_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240034	cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.01726e-51
NZ_CP028568.1\|WP_011707347.1\|737892_738513_-\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	1.14517e-53
NZ_CP028568.1\|WP_101616515.1\|732229_733381_-\|chorismate-binding-protein	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	4.46728e-66
NZ_CP028568.1\|WP_101616527.1\|742890_744204_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	2.87123e-165
NZ_CP028568.1\|WP_101616538.1\|748446_749172_-\|DUF3142-domain-containing-protein	gnl\|CDD\|371478	pfam11340, DUF3142, Protein of unknown function (DUF3142). This bacterial family of proteins has no known function.	7.88709e-15
NZ_CP028568.1\|WP_101616543.1\|751802_753956_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	4.86578e-99
NZ_CP028568.1\|WP_101616525.1\|741836_742676_+\|isopenicillin-N-synthase-family-oxygenase	gnl\|CDD\|226022	COG3491, PcbC, Isopenicillin N synthase and related dioxygenases [General function prediction only].	1.99068e-38
NZ_CP028568.1\|WP_005304871.1\|737107_737584_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.22775e-48
NZ_CP028568.1\|WP_101616521.1\|738678_739920_+\|MFS-transporter	gnl\|CDD\|340888	cd17330, MFS_SLC46_TetA_like, Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.44462e-41
NZ_CP028568.1\|WP_101616536.1\|746711_748337_-\|hypothetical-protein	gnl\|CDD\|381139	cd17624, REC_OmpR_PmrA-like, phosphoacceptor receiver (REC) domain of PmrA-like OmpR family response regulators. This subfamily contains various OmpR family response regulators including PmrA, BasR, QseB, tctD, and RssB, which are components of two-component regulatory systems (TCSs). The PmrA/PmrB TCS controls transcription of genes that are involved in lipopolysaccharide modification in the outer membrane of bacteria, increasing bacterial resistance to host-derived antimicrobial peptides. The BasS/BasR TCS functions as an iron- and zinc-sensing transcription regulator. The QseB/QseC TCS activates the flagella regulon by activating transcription of FlhDC. The RssA/RssB TCS regulates swarming behavior in Serratia marcescens. OmpR family DNA-binding response regulators contain N-terminal receiver (REC) and C-terminal DNA-binding winged helix-turn-helix effector domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	0.000826174
NZ_CP028568.1\|WP_043127347.1\|741064_741628_-\|DUF2799-domain-containing-protein	gnl\|CDD\|378521	pfam10973, DUF2799, Protein of unknown function (DUF2799). Some members in this family of proteins are annotated as yfiL which has no known function.	6.33836e-28
NZ_CP028568.1\|WP_101616531.1\|745376_746690_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	1.7728e-167
NZ_CP028568.1\|WP_017411109.1\|735798_736293_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	6.60573e-22
NZ_CP028568.1\|WP_080708629.1\|735278_735755_-\|organic-hydroperoxide-resistance-protein	gnl\|CDD\|274649	TIGR03561, organ_hyd_perox, peroxiredoxin, Ohr subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein. [Cellular processes, Detoxification].	3.39776e-57
NZ_CP028568.1\|WP_101616529.1\|744204_744921_-\|hypothetical-protein	gnl\|CDD\|270422	cd13704, PBP2_HisK, The periplasmic sensor domain of histidine kinase receptors; the type 2 periplasmic binding fold protein. This subfamily includes the periplasmic sensor domain of the histidine kinase receptors (HisK) which are elements of the two-component signal transduction systems commonly found in bacteria and lower eukaryotes. Typically, the two-component system consists of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. The two-component systems serve as a stimulus-response coupling mechanism to enable microorganisms to sense and respond to changes in environmental conditions. Extracellular stimuli such as small molecule ligands and ions are detected by the N-terminal periplasmic sensing domain of the sensor kinase receptor, which regulate the catalytic activity of the cytoplasmic kinase domain and promote ATP-dependent autophosphorylation of a conserved histidine residue. The phosphate is then transferred to a conserved aspartate in the response regulator through a phospho-transfer mechanism, and the activity of the response regulator is in turn regulated. The sensor domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space through their function as an initial high-affinity binding component. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.76243e-15

>NZ_CP028568.1|WP_101616521.1|738678_739920_+|MFS-transporter
MEGIKGQASLWVLVMTVTLAVAGFSLPSPVLAPLMLDPAQGMLTPEASDWSRKVWLGVIMGLYPLFQLVGAPWLGKLSDRHGRKPVLTLCLVGVLVGYALMALGIAWRSLPLLLLSRVVEGFFNGDIAIVQAMAADMSTAKTKARSFAWINIGMNLGWVVGPMIGGYAAVVSGDYSLAAWLAVAMTLINLLLVLWLLPNRPAAARSEQPPPALSSRQLLLQPALLPYFVLTLLSYGAVQLYFTYFNVWLVERLAWDPVQLAQAAVLVSVPMILGSWLGSRLARHWRGSSLGVVGHLVMAAGMLMFVLPGHWWGLALTFIPTGIGMSLGELATSVAVSNRSHAEQQGQAMGLYRGLAVGSEILAVVVGSLVLLAGTEWPFYLATLCSLLCAVGFYGLRRAADRRQRLDVQVEAG
>NZ_CP028568.1|WP_011707347.1|737892_738513_-|transcriptional-regulator
MNASTDKILFLLKSHGPQSAAELGEQLQMTSMGARQHLMTLEADGWVSFNDEARGRGRPVRLWHLTEQAWQRFPDSHSELTLQLIDNIQQLFGEVGMERLIAQREQQQLARYQAELTQPALADRLAALTAQRTREGYMADFRQEEDGSWLLWESHCPICAAARACRGFCRSELEMFRRLLAPAGVEREQYLLEGDHRCLYRIRPQP
>NZ_CP028568.1|WP_005304871.1|737107_737584_-|Lrp/AsnC-family-transcriptional-regulator
MLKLDRIDRHILELMQENGRISNLELAELVGLSPSPCSRRVKALEDAGLIDTHVTLLNARQLGLTLTAYIHISMDRHTPERFENFDRAISELPEVLECDLITGNDADYQLKVVVRDMEHYQHFLLDKLTHIPGVTGVRSSFVLRRIKHKTALPLNHLG
>NZ_CP028568.1|WP_005304873.1|736701_737019_+|hypothetical-protein
MQSSLVGLSILWGLASFGVQGDFIESRDSVAPSWQAESRVEMEGYLIESLGEDRWLFDNGSESLLVSLPQGQWVPTGERLRVSGEPQQEQAGWLLQVQDVSQVAV
>NZ_CP028568.1|WP_045525426.1|736328_736556_+|hypothetical-protein
MKLLLPLFALLLTACSTGSHAPSMAIDDADAWQAICKDGTRVRAVVEEGICADHRGVAMWTNKPRAARMAEEAAK
>NZ_CP028568.1|WP_017411109.1|735798_736293_+|MarR-family-transcriptional-regulator
MCANYSTPDFPGVYWPQSSARCPMSELKKQVCFALYSASNAVMRAYRPLLDKLDLTYTQYLVMLSLWARDEVSLKEIGQETGLDAGTLTPIVKRLESKGWLTRTVSSEDERQKCIGLTEAGRQLQQEVRECCLADNLRNQVDLADAELAQLKQLCDRISAQLGR
>NZ_CP028568.1|WP_080708629.1|735278_735755_-|organic-hydroperoxide-resistance-protein
MHTNKIRDPDMKTLYRTQAIAQAGRNGEVHTLDNSLQLALALPTALGGNGKGNNPEQLLAAGYAACFSNALIHVAHKLGAPLSSAPVTAGIELLALDDGRFNFAITLDVALAATQPEQAAQAEQIVRLAHQTCPFSNAMRGNVVTRLLLNGAPLDETA
>NZ_CP028568.1|WP_101616519.1|734191_735196_-|NADP-dependent-oxidoreductase
MNQSSHQIQLLRRPVGLPSLADFTLTEVALPELQAGEVRVANQWLSVDPYMRGRMSEAKSYVPPFPLNGPLDGGAIGVVEASRHPDFAVGDRVSSMLGWRDRFVANGAQLTRLPDTRLPPQLFLGALGMPGMTAWTGLNRIAKLQAGETVLVSAASGAVGSMVVQLAKRAGARVIGSTGSADKVAYLKSLGADEVINYRETPDLDAELARLAPEGIHVYFENVGGAMLDAALNHMVVHGRIVMCGLIEQYNGQSEASGPRNLSQVIRKRLTMQGLIVFDHWQHYGEFLAEVTPAFDAGTLQAEETVYQGLASMPQAFIGLFEGRNTGKMLVKLT
>NZ_CP028568.1|WP_101616517.1|733618_734062_-|NUDIX-domain-containing-protein
MSTPYPRVGVGVILTNRQGQVLLGKRKGSHAPYWSIAGGHLELGETFESAAIREVAEETGFQISNPSVIAVTNNLETWRESGLHYVSVTLLAGVEGEPQLLEPEKCEGWVWCDPRNLPEPHFDASRQSIACWLADRCYLPTPNQPTP
>NZ_CP028568.1|WP_101616515.1|732229_733381_-|chorismate-binding-protein
MGQVFIQFLWLGCVSFGGPAAHIGYFQRTFVERLGWLTQAEFAQLLALCQLLPGPASSQLGFAIGRQRAGLAGALAAFAGFTLPSFLLLLTAAIGLGQLGNNVWLDATLHGLKLLALVVVADAVLTMSRQFCKTTRNQGIMVATAAALWWQPGLLTQLVMLAGAALLCARVGEPQTPGPQPSPAQSIPVHQPHWPTLLLFALLFVGLPLLGGPVGQLVADFYRAGSLVFGGGHVVLPLLAESVGHSLNQQQFLTGYSLAQLVPGPMFTLATYLGAQLLPATPVGGALLATLALFLPGFLLLWAMGPCWQSWLARPRLAGTVAGINAAVVGLLLAALYQPVWQSAVLAPTDLALAAIGFYLLRGLKLPILALATLLVVATLLLA
>NZ_CP028568.1|WP_043127347.1|741064_741628_-|DUF2799-domain-containing-protein
MSPKILLLTLPFLLAGCSSLSEEECRTMSWYNLGYQDGEQGKTRAATRDYVSTCGEYGLKVDEAEWKRGYTKGLELYCIPELAYSKGKSGAEYQGVCPNDASFLTQYDRGRQEYLVEKQLSDLKSDMERTERDIETLERQIRNENDSKQRDYYRAQRERAIRHYEGLRRDYNRIRFPDRVIQFSFGN
>NZ_CP028568.1|WP_101616525.1|741836_742676_+|isopenicillin-N-synthase-family-oxygenase
MKVLTVDYRSPDAAQRFTESLRTTGFGVLTNHPIPKELVQSIYDNWYRFFMSEQKQDFLFNRETQDGYFPPSVSEVAKGHSQKDIKEYFHLYPWGQMPAELKEQAMEYYRLANNLAAELLGWVEQYTPSDIAAHYSCPLSSMIEESQKTLLRVLHYPPFDGTEELGAIRAAAHEDINLLTILPAANEPGLQVKGSDGEWMDVPCDFGTLIINIGDMLQEASHGYYPSTTHRVINPTGGSAAKSRISLPLFLHPRPDVVLSERHTAHSYLMERLRELGVI
>NZ_CP028568.1|WP_101616527.1|742890_744204_+|sodium-dependent-transporter
MKQSQWSSRLGYILAAAGSAVGLGAIWKFPYVTAANGGGAFLLVFLLFSFTLGVAVLMGETLLGSLSRRGVVGAFGELMGKRWRWVGAMGLLSSLLIYSFYSVVGGWTLGYTGMALAGSLQHGDGAALTARFNDYVGDPLWPVLTHLLFAGLTWWFVQGGVQKGVERTLRWMMPALFIMILMLVAFGLTLPNAMAGVRHFLMPDFSKLGMSGVLDAMGLAFFSLSIGLGIHTTYGAYLPSSDGVGRSSLWVVLLASLIAVLAGLMIFPVLAATGIDPASGPGLTFMTMPAVFQQLPFGQGLAVVFFALLVVAALSSAISLLEHLQCFVSESLGWSRRAACGLITVLVMAGGIPVSLSFGPWAQVTLFGKNIFELLDFVTSNLMMPMFGLALTLLLGWKLGRQALPAGLALHWRTLVMGCWRWLAPLLIGGILVRGLV
>NZ_CP028568.1|WP_101616529.1|744204_744921_-|hypothetical-protein
MKWLLPWLLLPGLAQATQPPLTLLSHELPPFTHTSDGKLGGLAVQLVQEAQQEMGVDYPIKIYPLKRALALTRVEPGFALFVILRTPQREPQFKWVGPLFLNRVVIYQGRGSQPLTDLAQLRQLARVGVLLGNADDELLTREGYTNLVRCQTIEDAIERLMLGKIDAFPMGEQIMPAILAKMKFSPRSVVNSGLLLQENWLYIVFSKSEDDAVIARWQAAIDKVRDRHPQPQQPIRQP
>NZ_CP028568.1|WP_101616531.1|745376_746690_+|sodium-dependent-transporter
MSQVQWSSRIGHVLAAAGSAIGLGAIWKFPYVTATNGGGAFLLMFLLFSFTLGVAVLVGETLLGSRSQRGVLGAFHKLVGPNWRWMGYMGILCGFFIYSFYSVVGGWTVGYAALAVSGQLNLSEGTALTALFNGYVSHPWWPVLTHLVFAGLTWWFVQGGLQKGVERALRWMMPALFVMMMLLVVTGLSMPGAMAGVRQFLLPDFSMLTGQGVLDALGLAFFSLSIGLGVHTTYGAYLPSSEGVLRSGVWVVILASLISVLAGLMIFPVLASTGIDPTAGPGLTFMTMPAVFNHLPFGQGLAVVFFLLLLVAALSSSISMLEHLVRFTTEEWGWSRRGACRVLTLLIMASGIPVSLSFGPWSELTLFGKTIFDLLDYLTSNLMMPLFGLVLTLLLGWRLGESVLPDGLSPLLRGCLLWCWRLVAPLLIAGILVRGLL
>NZ_CP028568.1|WP_101616536.1|746711_748337_-|hypothetical-protein
MQILLIEDDTMLSMALCQGLSQQDIASSQLTHCKEIASLPTLLRQQPFDAIICRQNHHQGQEGIRMLQEAHYLGLLEPGCVLLLLDADLDLQQYPPSDLYFPLQLAIPFTADQLTAILRELVLLTGLTRALPAPMRLREWQVSCALCEDLLYQQQKYRELGPLLDRIKGYMLLQQQNYFHAAQHYAVCTTEHDAWWPRKGLIHALLGLGKLESARKDLARNRERLPAPLQLELALACLLHERQWEGAWDVLTLLLQKQAWQPEWRQAAILLALLLKDEGKALEQANALSLRFFGDHKFRVSIENFILNASLAVLWHYPSAARISALQQEYRYLSQAVTLRAHEEALLKALMLSLDYRFDEALLLLAKHPPESARDHHLNQLLGFAVSQFCGLPHHAQRYLSQLSQYQARVAPAPLVQQLFKQVIGDFMKQLERRELRLTYLRQERQRASAAGQHQLAVQYALTLQEEFPALPGDAWQLLELLQLCWPAGMAAPRVALLVDRLERRLNHSASFMEHHAKEYHKTLLQIRSHLNPRLPTTPPN
>NZ_CP028568.1|WP_101616538.1|748446_749172_-|DUF3142-domain-containing-protein
MGQAAQILLVMLALLGAEASAAVEASHYRQFWLWAGVRPQPELQQAERLYLHQGEIGPLDARQPVRFQGQGIAPSKLPVKELWLAYRVERLDWDEALLKNLTNQLAAWQRKGNGVRGVQINFDARTHRLADYGDFLRQLRRQLPADCAISITGLLDWTRTGDVTTLNALAGVVDELVVQTYRGRRTEPGYARYLQALTRLTLPFKVGLVQGGEWDPTWESRLADSAAYGGAVVFLINPSGA
>NZ_CP028568.1|WP_101616540.1|749141_751235_-|hypothetical-protein
MPASRLLLEAPMKLTPLWLALCSLPALACGPDGCETPLTLQLTAAQCHLNGLPFLSPDNDTRTNLALLLADEQAFSLPKAPLPLPFAIEDLLNPALLNPTQAEPAPAVPDPLLALAAGLGIEQSTTQAALERAAGWSEGRCISNNPVAAEAFLQALVDTSALGADERSQLARQRLAMLGQCAQQIETAPEDKAMPLSAAGQGFADYLAASQRFYQGEFAQADTLFAALAGQDQPWLKETADYMRIRVALNQSQQSAFDDWGTLDRNQIDQAAVQRAEQFIADYRSRYPEGRYLDSANGLLRRLAWFKGDEAALAGLFLQASRQPGNPELLNEIDLKLLMQPGFTGSAAMPQLTLVQDLRRLRLHESWDEWQPLQSGELAQQSAQFASTPAWLAYLQQAERYYLAKDYAAVIAAAPALGKGPLDNLAFSQQVLKGMALAASQALSEAEQQWRALLASQPTPLQDQLLQLALAMTLERAGRLEQVFAKESPIQSDHYRIPLLEYVAPAPLLRRMVQDEQASDTLRQRAGHTLRYKQLTHGDYRGFLQDLALAPLATPFDWQGSQEYQCPALTAVVTTLADNPKSPKALNCLGEFFLSQGLDWDPLLQRPGADTLAGSRDLFAGQQRSRLDWYQQVIASPKAAKEEKAYALYRAINCYAPSGNNSCGNQEIPLSQRKGWFNTLKRQHGTSQWAKQLKYYW
>NZ_CP028568.1|WP_101616541.1|751295_751760_-|hypothetical-protein
MHPTRAPLLLLTLLLGGCATPGHQQLGAALSGLEGELQRLEEELAAMNGLHYQKAIDAPLSLRRRLSAPVPTAQGLRPSRSTLTDGPLLRYDYRLPAGMASLPLAEPCLRYEFELRHLGRLGQLTLHWQGAAGSGEQLIQQRDCPFSAKGPGLQ
>NZ_CP028568.1|WP_101616543.1|751802_753956_-|PLP-dependent-aminotransferase-family-protein
MPVRQGRRCTFFASLCGLWRHSVPEHHHAERGQRPQAAVEPAPASVRVDPAAELMTEQHPGKADWQSGHGEDRHDAPQTRPVSTARQTEQTDGGDPHHPGLGVEELKAQPLQQGQRARTSLRIAGGAGHRDAPCQPQQIEAAQHLQAQLEQRPTLEQGVEPQRQHQLQDGLSHHDTDQMGQGATHPEVGAGGGQHEVVGARRAAGEQRKAKQGGIPFDRHLCTPELRTLYRYNVPLLVVIGFKFTLYCRYISINGFIVTMTIWTPDLTPFAGPLYLKLVKAIEQAIQDGSLPPETRLPTHRALADKLGVTVGTVTRAYGEAERRGLLAARVGHGTWVKGDHEDPANAWVIRKEEGHRIELWQNLPVQLDRAAIIRPMLAEVADGDLNALLGYDKEAGQPSQRQLFIDWLAEQGVAGSEEYLLFSHGAQHGIMLSLLATGCVGETLFCEGLSYPGMLGNARQLKNQVVGLAMDAEGLLPDALEAACRTRRAKLLYLTPTLQNPTTATMSLARREAIVAIARRHDLLIIEDDVNGLLPQQPVTPLVNLAPERVIYLGSLAKIACGGLRVGFVLTPPALRGAFAQAMRLSSWMVSPLLIELACKLVSQRQIMPLVEQQRQILARRGELLRHLLPGACWQAGSMHAWLPLPEPWRSQEFAEAANALDVGVASGEHFAAGQFAAPQGVRLSLSQPATDARVAEGLERLAGLLRAAPPTNTLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028568_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028568_3

1420416-1420497

Orphan

Consensus_repeat	Method
CGTGCCGTTTGTGAACAGGAGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028568_3

>merge|NZ_CP028568|3|1420416-1420497|CRISPRCasFinder
CGTGCCGTTTGTGAACAGGAGGCGTGATGAGGGAGTTATCCACATTTGCCGGCCCCATGCGTGCCGTTTGTGAGCAGGAGGC

>NZ_CP028568|3|3|1420416-1420497|CRISPRCasFinder
CGTGCCGTTTGTGAACAGGAGGC	GTGATGAGGGAGTTATCCACATTTGCCGGCCCCATG
CGTGCCGTTTGTGAGCAGGAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028568.1\|WP_101614621.1\|1417818_1418625_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP028568.1\|WP_011705161.1\|1416025_1416718_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
NZ_CP028568.1\|WP_101614625.1\|1422263_1423439_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP028568.1\|WP_011705160.1\|1414453_1416022_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
NZ_CP028568.1\|WP_005343899.1\|1418687_1420205_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143434
NZ_CP028568.1\|WP_005298527.1\|1425233_1425923_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
NZ_CP028568.1\|WP_101614612.1\|1410829_1411021_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_011705171.1\|1428741_1429548_+\|M48-family-peptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP028568.1\|WP_029301537.1\|1430151_1431054_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|183967
NZ_CP028568.1\|WP_101614610.1\|1408980_1410036_-\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP028568.1\|WP_029303670.1\|1429535_1430042_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP028568.1\|WP_101614631.1\|1425931_1427227_+\|two-component-system-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|182895
NZ_CP028568.1\|WP_101614614.1\|1411566_1412874_+\|citrate:sodium-symporter	unknown	unknown	gnl\|CDD\|377030
NZ_CP028568.1\|WP_010634735.1\|1410037_1410511_-\|transcriptional-regulator-SlyA	unknown	unknown	gnl\|CDD\|179596
NZ_CP028568.1\|WP_101614619.1\|1416815_1417715_-\|EamA/RhaT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP028568.1\|WP_101614623.1\|1420500_1422177_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225822
NZ_CP028568.1\|WP_101614629.1\|1424633_1425131_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP028568.1\|WP_101614617.1\|1412885_1414436_+\|oxaloacetate-decarboxylating-malate-dehydrogenase	unknown	unknown	gnl\|CDD\|237414
NZ_CP028568.1\|WP_011705170.1\|1427603_1428578_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS-family-protein	unknown	unknown	gnl\|CDD\|273991
NZ_CP028568.1\|WP_101614627.1\|1423438_1424593_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110

Protein	Function_ID	Function_description	E-value
NZ_CP028568.1\|WP_101614621.1\|1417818_1418625_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.48111e-27
NZ_CP028568.1\|WP_011705161.1\|1416025_1416718_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	1.67073e-63
NZ_CP028568.1\|WP_101614625.1\|1422263_1423439_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	0
NZ_CP028568.1\|WP_011705160.1\|1414453_1416022_+\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	2.63621e-113
NZ_CP028568.1\|WP_005343899.1\|1418687_1420205_-\|aldehyde-dehydrogenase	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
NZ_CP028568.1\|WP_005298527.1\|1425233_1425923_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	1.37954e-135
NZ_CP028568.1\|WP_011705171.1\|1428741_1429548_+\|M48-family-peptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	1.29687e-86
NZ_CP028568.1\|WP_029301537.1\|1430151_1431054_+\|transcriptional-regulator	gnl\|CDD\|183967	PRK13310, PRK13310, N-acetyl-D-glucosamine kinase; Provisional.	3.16053e-109
NZ_CP028568.1\|WP_101614610.1\|1408980_1410036_-\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	2.347e-65
NZ_CP028568.1\|WP_029303670.1\|1429535_1430042_+\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.46736e-12
NZ_CP028568.1\|WP_101614631.1\|1425931_1427227_+\|two-component-system-sensor-histidine-kinase-PhoR	gnl\|CDD\|182895	PRK11006, phoR, phosphate regulon sensor histidine kinase PhoR.	0
NZ_CP028568.1\|WP_101614614.1\|1411566_1412874_+\|citrate:sodium-symporter	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	2.51347e-159
NZ_CP028568.1\|WP_010634735.1\|1410037_1410511_-\|transcriptional-regulator-SlyA	gnl\|CDD\|179596	PRK03573, PRK03573, transcriptional regulator SlyA; Provisional.	1.05279e-33
NZ_CP028568.1\|WP_101614619.1\|1416815_1417715_-\|EamA/RhaT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.44782e-19
NZ_CP028568.1\|WP_101614623.1\|1420500_1422177_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225822	COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription].	1.08712e-124
NZ_CP028568.1\|WP_101614629.1\|1424633_1425131_+\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.20646e-37
NZ_CP028568.1\|WP_101614617.1\|1412885_1414436_+\|oxaloacetate-decarboxylating-malate-dehydrogenase	gnl\|CDD\|237414	PRK13529, PRK13529, oxaloacetate-decarboxylating malate dehydrogenase.	0
NZ_CP028568.1\|WP_011705170.1\|1427603_1428578_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS-family-protein	gnl\|CDD\|273991	TIGR02136, ptsS_2, phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975. [Transport and binding proteins, Anions].	2.20214e-86
NZ_CP028568.1\|WP_101614627.1\|1423438_1424593_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	5.64919e-159

>NZ_CP028568.1|WP_005343899.1|1418687_1420205_-|aldehyde-dehydrogenase
MIYTAPGQAGALVSFKSRYDNFIGGEWVAPRAGRYFENISPVDGKVFCEVARSDAADIELALDAAHKAFASWSKTSVTERSNLLLRIADRIEQNIEVLAIAETWENGKAVRETLAADLPLVVDHFRYFAGCIRAQEGSAAELDQNTVSYHFKEPIGVVGQIIPWNFPLLMAAWKLAPVLAAGCCSVLKPAEQTPVTIMLMMDLIKDILPAGVVNVVNGFGAEAGQALATSNRIQKLAFTGSTEVGAHILRCAADKLIPSTVELGGKSPNIYFADVMQHESSYIDKAVEGMLMTFFNQGEVCTCPSRALVQASIYDDFMDKVLARARTIVQGNPLDTATQVGAQASREQFDKILSYMEIGRGEGAKMLIGGGPARVSGLEGGFYIQPTIFSGQNKMRVFQEEIFGPALGVTTFKDEAEALAIANDTQYGLGAGLWTRDSNLAWRMGRGIQAGRVWVNCYHAYPAHAAFGGYKKSGIGRETHKMMLDHYQNTKNLLVSHDINPLGFF
>NZ_CP028568.1|WP_101614621.1|1417818_1418625_+|AraC-family-transcriptional-regulator
MAIRHYHPTDLHLPEPNPLYLRYQQIQAESACAPHSHPWGQLSLISLGVMEIVLDDHRLVAPADYLIWVPADLEHASYNQQALDYTSIYVNHALAARLPAEPRLLQMTPLIRAILADFCDRKLGHMEDEWDVRQAELLVEKLTRTRCQDSYLPMSQDKLLAPMLAALHSDPADPRTLAQWAEQLHTTERTLARRCVRELGMNFGQWRARLKLLKALAWLKGELPVQEIGWRLGYGSTSAFIAMFNRELGCSPQRYRQQLGIGAGQAAL
>NZ_CP028568.1|WP_101614619.1|1416815_1417715_-|EamA/RhaT-family-transporter
MRIFYPLMFPLLAVLIWATNTVVSKAAADVLDPAAISFYRWVIAALALTPFCLPQLWRRRGEIRPWLGKLLVLAALGMVLYQCLAYYAAHTTSATNMGVIGSLIPLLTLLQSALFFGQRPGKQALLGMSISLFGVFWLLSLGQPLALLHDGINQGDGLMLLGSASYALYGLLIRRWQLPFGPWLNLYIQILLAVLLLIPVALCAESLAVPAEGWGLVLFAGIASSLFAAYCWMRGLACMGAERTSVFMNLMPLCTALIAVISLGEPIHGYHLLGGGLILAGVMLSQFKPKARPALLEEA
>NZ_CP028568.1|WP_011705161.1|1416025_1416718_+|response-regulator
MEPIFTLVIEDDERIGSILAELVSSTPGFSLLGRAESLTQADLMMRAAQPQLLLVDISLPDGSGLEWVNRLRSHNREAYVIMVTASCDVETIQQALNQGVQDYIIKPLRLFRIQQSLDEILTLHRRICERGSLEQSDLDRLMGKVRPQGREVRDTPKGIDAITLRQVLELLAGEPDSAFSTDTVALRLSLSRTTARRYLEYLESEDRVDVDLNYGQRGRPERRYHWRRGS
>NZ_CP028568.1|WP_011705160.1|1414453_1416022_+|sensor-histidine-kinase
MKLRHQLVTLSLGLSLLLIVILGSLLALFIRHLLEVNLEEKGGDLARVLAADSRVVQALEWGSDPGLRDYVQGICSRTDAAYMVVTDEHARRLSHPSPELVGGLFRGEDIWPSLNERSSYCSKDVGTLGPAIRCFAPVIGADGRAIGAVVVGYLMQTVEGIYLDRIALLISAIGAVLGCGLLLALWIQHRLRRTLLDLEPETIVNRFVLQELVLEHISEGVIALDSQGHIRMLNSAAFYQLRLPGTGRHSLLGQPLAELSPPLAPALTQLETELGFTVHGESFIGRWQAVEGKIPGRLLIFSRPEVTGSLGMQVTHLRQYAEMLRMQTHEFANKLSSLSGLLQLGHVDQAVELIQQESEACQTMLHDLLRAIEDKPVAGLILGKFSRARELGVELVLDPDSALGEYPAAVSADLITLIGNLLDNGIRAAWARRKQCPPRVLISLNDFGRRLVIEVEDSGEGVDEALADHLFDYGISRQTGDHGVGLFLVKETVARRGGVIEWRRTAEQTTLFGIYLNKNQLV
>NZ_CP028568.1|WP_101614617.1|1412885_1414436_+|oxaloacetate-decarboxylating-malate-dehydrogenase
MNDIMMGTSLPYAERKRQGLMGRMPHKEESLAQQRRRIYRLVSAMQSPFDQHLLLRQLQEDNPVLFYELVRHHLPELLPIIYTPVVGEACQRHSDLYLRSHGLYLSWHDRDELDGIFAAVEQEVDVIVISDGERVLGLGDLGIGGMGICIGKLALYSAAGGINPARTLPLCVDVGTNNPELLEDDSYLGWQAPRVDGEPYYQFMDKVVAAIRKRWPQVVLQFEDFAGKHAANLLARYRDELCMFNDDIQGTAAVASACVLAGLQQAGSALAETPVLIVGAGSAGCGIAAMLAQLAGSTARVQLFDQDGLVCLDRAGLTPAQQPFARPAAEACNSLAALIERLRPGVLIGVSGQGSLFDAAVLTAMGEVCERPVILPLSNPTRSAEATPAQVWQATGGRALLATGSPFPPVTVDGAARVVSQCNNVYVFPGIGLGACAVKARRISDGMLRAAVQAVGAYPLAEGRLLPPIEQVGEVARAVARAVALCARAEGLADFEGDPAPLIDQTWWRPHYWSAS
>NZ_CP028568.1|WP_101614614.1|1411566_1412874_+|citrate:sodium-symporter
MKNLSTPPTRIALFGDRQIAGMPMMIFLGLATCVLFSGWNGSLPLGMVGALALMFVLGTLLTELGERITPIREYLGGGTILAIFGGAALFEYRILPVEAGQVIIGFMKEGGFLNFFIASLVTGSVFGMSGALLKNAAMRYLPVILGGVALALLSVGLVGALMGYGFKNAVLLIGLPIMGGGMGAGAVPLVEILSGPLQMSSADLLSRMVPAVVIANTLAILVGTLLARLGRRYPSLTGNGKLMIKESAAGVAEEKVQAPTLESLGLGLFISSSMFVLGSLLGNFIPMHPFALMILAVAVIKVSGLLPRRYEQAAADWYQFVVSNLTPSLLVGIGVAYTSIPELISAFSVSYFVLVLVTVVGGALGAALVGRMIGFYPIEAAITGGLCMANMGGTGDVAVLSAAQRMTLMPFAQISSRLGGAVMLILATLLISLLA
>NZ_CP028568.1|WP_101614612.1|1410829_1411021_+|hypothetical-protein
MMGQLNRETIAVERYESGDPNFSIESLLVEVEYVADGHYGLSLESTETCHEFDPANIPLLLAE
>NZ_CP028568.1|WP_010634735.1|1410037_1410511_-|transcriptional-regulator-SlyA
MMKDLEMLRELSLAERVGRLHRLWRTVADLELAPLGLTHPRWTALWKLSRLGGHLSQKTLAEALEIELPSLMRTLGQLEEQGLVERHCCSQDKRARIVTLTPAGKALLDQIEDRIMEIRRELLAGISQRELEQFEDIVHRICANALGKIGAQSEERE
>NZ_CP028568.1|WP_101614610.1|1408980_1410036_-|HlyD-family-secretion-protein
MTPDQQFKRWIKWAMGAFVLVFAYFLLADLKMPLTPQAMATRVVTKMAPQVSGKVVEVAVGNNQHVKQGDLLFVLDPAPFELAVEQARLALAQAEQQNRQLDATLNAASADFSSLQTQAALKLREAERIDALYRRHMVSEQQKDDADSAFRTAQANLLASKARMTQARVNRGLPGDDNLLLRQARNRLAQAELNLDYSRVHASQDGIITNLQLKPGSFAAAGAPLLALVSEQVDVIADFREKSLRHVNQDSQALVAFDGEPGRLYPARVTSLDAGVSAGQFDANGLLASPTESDRWVRDAQRLRLHLALEQLPAHLPAGARATVQLLPDNALTGLLARAQIRLLSLLHYIY
>NZ_CP028568.1|WP_101614623.1|1420500_1422177_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MSELSQSSASPIERSWQRCLHQGLSRRQSAELDLLPQGELSARQEQHRVLIASFQRFVLPLFGQLLAGRPCRLLLCDGEGAILAASGDDGFARHAERIFLRSGARWGEASKGTNAIGTALAEQNEVQVLGNQHFFAQHSFLSCSACPLLGPDGQLLGVLDISTDAAHHDGDMLGTVRLLAMTLENALLARQPGWLVDLEPQSLWSARLLLGEEGELLGANRAGRLWLGQHPFDGKQLLRDRRGLRLVPEAHPVATLPGLPADAGGSHGQQVPLKMLERGISLLIEGETGSGKEHLVRELHGQSSRRAQPLVCVNCGALPAELVEAELFGYVGGAFSGARSQGSQGYLRAAHGGILMLDEIGELPLLAQTRLLRVLQERAVTPVGSHRPEAVDFWLVSASHRDLAAMVAAGTFREDLYYRICGWRQLLAPLRDWPTRERQALVQRLLAEMDPALHLTDEAERHLLAHPLPGNVRQLKQALEVACVLAEGQGWIEPAHLHLPTVAVGPAATTALAGSTLRQQNRQRVQQTLTECDGNVSEAARRLGISRTTLYRALREAG
>NZ_CP028568.1|WP_101614625.1|1422263_1423439_+|acyl-CoA-dehydrogenase
MTRTRFDWQDPFFLDGQLGEEERLIRDAARDYCQARLMPRVLEANRREQFDRTIMNELGELGLLGATLPEQYGCAGVNHVAYGLIAREVERVDSGYRSAMSVQSSLVMHPIHAYGDEAQRQRWLPGLARGELVGCFGLTEPDAGSDPGSMKSRAERVDGGYLLTGNKMWITNSPIADLFVVWAKLDGEIIGFVLEKGMAGLSAPKIEGKFSLRASITGEIVMERVFVPEANRLAGVSGLKGPFGCLNKARYGIAWGALGAAEFCWHAARQYGLDRQQFGRPLAATQLFQLKLANMQTEIALGLQGCLQAGRLMDEGRCPVELVSLIKRNSCGKALEIARVARDMHGGNGISDEFHVIRHVMNLEAVNTYEGTHDIHALILGRAQTDLQAFE
>NZ_CP028568.1|WP_101614627.1|1423438_1424593_+|CoA-transferase
MGPLAGVRVLDLSRVLAGPWASQLLADLGADVVKVEAPGRGDDTRHWGPPELVAGEAAYFHAANRGKRSIALDLARDRETLLALVDRADVVIENFKVGGLARYGLDYPSLKARRPALIYCSITGFGQDGPWAQRPGYDLLIQGLGGLMSITGQPDEAPGGGPVKVGVALVDILTGLYATIGIQAALRHREQTGEGQQIDLALLDVSVAVLANQAMNYLATGQAPGRLGNGHPNIVPYDVYPTRDGHLILAVGNDGQFAALAALLGEPGWAMDPDFASNSARVRQRHRLNALIAKRLLARSSAEWSAMLEAAGVPGGPILTLDALFALEQGAVRGWVQQVQRGEQPLPTLANPLHLSATPVRYGRASPALDGDRDSVLRDWLGQG
>NZ_CP028568.1|WP_101614629.1|1424633_1425131_+|VOC-family-protein
MSSHLPRCWSPGPSPAMMHPVHSSVEELPMAQHIGALALLVADYDAAITFFTQGLGFELLEDTPLDEPGKPGKRWVRVAPKGAPGSALLLARAATPEQRAAIGQQGGGRVFLFLETDDFWGDYQRMQAYGVHFCEQPRSEAYGTVVVFEDISGNRWDLLQLAAAN
>NZ_CP028568.1|WP_005298527.1|1425233_1425923_+|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MAKRILVVEDEAPIREMLCFVLEQKGYETVEAEDFADGLAKVREPYPELIVLDWMMPGGSGIQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVMRRVSPTSVDEVIEVQGLKLDPVSHRVSAEEKALDMGPTEFKLLHFFMTHPERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKAIEETGHDRLIQTVRGAGYRFSTRL
>NZ_CP028568.1|WP_101614631.1|1425931_1427227_+|two-component-system-sensor-histidine-kinase-PhoR
MLQPYAWRRQLWRMAFFYAPFALVGWLTNTLALCLLAATVLHLGWHYRFQKRLSDWLWHDRSLVPPNGSGSWEYIFNGIYKLQQRHRARRRELAGLIRRFREGAEALPDAAVVFRTDGSILWCNRLAEQLLGFRWPEDAGQHIGNLIRHPAFGAYLGKGQYDEPFEMTSPINEEKFLEFRIMPYAEDQAMLVVRDVTRLRSLEKTRKHFVSNVSHELRTPLTVLKGYLEMTEEPPPPAMWAKAHKVMMEQTIRMDNLVNQLLTLSRIEAAPTVDLSHLVDMPAMLGLLEQEARALSGERAHQIEFMVQPNLLVRGDQDQLRSAVSNLVYNAIHYTPAGRKITVEWRKQGAMALFAVQDEGEGIPPEHLARLTERFYRVDKARSRHTGGSGLGLAIVKHALSHHDCQLDIESRVGLGSRFSFLIPGRMVVVK
>NZ_CP028568.1|WP_011705170.1|1427603_1428578_+|phosphate-ABC-transporter-substrate-binding-protein-PstS-family-protein
MKLNKLAGVIGFTAATLFSVSTLAAGVDKNLPDYTPTSGISGNLSSVGSDTLANMMTLWAEEFKRMYPNVNVQIQAAGSSTAPTALTEGVAQFGPMSRAMKSGEEEAFEKRYGYKPTAIRVAVDALAVFVNKDNPIKGLTMPQLDAIFSSTLKCGEAKAATKWADLGLDGNWSSKDLQLFGRNSVSGTYGYFKEHALCNGDFKSGVNEQPGSASVVQSVSSSLNGIGYSGIGYVTSGVRAVPLSKDGKTFIEATSDNAITGKYPLSRFLYVYVNKHPNKPLSPMEQEFLKMVLSKAGQNIVAKDGYVPVPAKVVEADLKKLGIM
>NZ_CP028568.1|WP_011705171.1|1428741_1429548_+|M48-family-peptidase
MTSPLFKLGLAALCSTLLASCAQSPTGRSQMLLFSPQQMSKLGADSFEEMKKQEKVSTDAKMNAYVSCVAKAVTAQVPSQYGITSWEVVVFDSKQVNAFALPGGKIGVYSGLLKVAKNQDQLATVIGHELTHVLAQHSNERLSRSQLTGLGLAAADIAMGSSEYRGATMAALGLGVEVGVMLPYGREQESEADRLGLDLMARAGFNPAEAIPLWQNMSAAAGGNAPPQLLSTHPSNENRIAELQAQQAEAVPLYEQARASGLVPQCKA
>NZ_CP028568.1|WP_029303670.1|1429535_1430042_+|N-acetyltransferase
MQGISLRMARPDDAAAMTVMQRASWLAAYGGVLGADMLAQLAVTEHLQIWQRRLAEAGPRPMLLCQDEVVIGLLYWQPETTGEYPTAWIRAFYLHPDHWRQGHGKRLWQAVAMQMRRAGCEGVRLWLLDGNHIGEGFYLRRGFMFDGQERTLMSLGQPCLQRQMFRLL
>NZ_CP028568.1|WP_029301537.1|1430151_1431054_+|transcriptional-regulator
MYYGFDIGGTKIAFAVYDGALNLCHEERMSTPGNDYEGLQQLIRERVEQADARFGARGAVGIGFPGILNRHDHSIVAANLPSINGRHLGADLAELLERPVKVDNDANCFLWSEVHQGAAAGADSALGVTIGTGIGGAVYLAGKLIQGRNWLAGEIGHYPLPATMLMKYPDLPRPRCGCGRLVCFETYASGTGLERLYHHFHGQRASGHQIVGRFEAHEPHAVATVDCWLEIMAAGLATAISVVDPDVVVLGGGLSGLPALYEQLPLRLPGHLLPGVALPEIREARFGGAGGVRGAALLNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028568_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028568_4

3998135-3998340

Orphan

Consensus_repeat	Method
ACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	PILER-CR
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP028568_4

>merge|NZ_CP028568|4|3998135-3998340|PILER-CR,CRISPRCasFinder
AAAAGGTGGGTTAGCCGGCTAAGGGGATTGGCATCTGAAAAACACCCATAAAAATGAAATCCAATGCCATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCGATCCTAAAGAGTTGAGGGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATATCATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG

>NZ_CP028568|4|1|3998135-3998340|PILER-CR
AAAAGGTGGGTTAGCCGGCTAAGGGGATTGGCA	TCTGAAAAACACCCATAAAAATGAAATCCAATGCCATCAAGACCATGATGGCCTGTA
AAAAGGTGGGTTTGCCGATCCTAAAGAGTTGAG	GGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATATCATCAAGACCATGATGGCCTGTA
AAAAGGTGGGTTTGCCG

>NZ_CP028568|4|4|3998202-3998340|CRISPRCasFinder
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG	ATCCTAAAGAGTTGAGGGTACCGGCGCCTGAACAGCACCTATAAAATAAAGCCCAATAT
CATCAAGACCATGATGGCCTGTAAAAAGGTGGGTTTGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028568.1\|WP_101613980.1\|4003566_4004124_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240042
NZ_CP028568.1\|WP_024944297.1\|4007145_4008153_-\|L-asparaginase-1	unknown	unknown	gnl\|CDD\|181876
NZ_CP028568.1\|WP_101613987.1\|3996495_3997473_+\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP028568.1\|WP_017409325.1\|4010051_4011923_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP028568.1\|WP_016351764.1\|4008667_4009867_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
NZ_CP028568.1\|WP_101613984.1\|3998676_3999225_-\|NAD(P)H-nitroreductase	unknown	unknown	gnl\|CDD\|182761
NZ_CP028568.1\|WP_101613981.1\|4001657_4003502_+\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|182860
NZ_CP028568.1\|WP_101613995.1\|3989931_3991410_+\|sodium/panthothenate-symporter	unknown	unknown	gnl\|CDD\|236519
NZ_CP028568.1\|WP_011707113.1\|3988210_3989551_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	unknown	unknown	gnl\|CDD\|236307
NZ_CP028568.1\|WP_101613975.1\|4005128_4006559_+\|glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|236219
NZ_CP028568.1\|WP_011707112.1\|3987739_3988195_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	unknown	unknown	gnl\|CDD\|235777
NZ_CP028568.1\|WP_101613989.1\|3995432_3996311_+\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|283886
NZ_CP028568.1\|WP_101614123.1\|3992917_3993766_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP028568.1\|WP_101613982.1\|3999331_4001347_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	unknown	unknown	gnl\|CDD\|239240
NZ_CP028568.1\|WP_101613993.1\|3991487_3992915_+\|PTS-N-acetylglucosamine-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|273920
NZ_CP028568.1\|WP_101613985.1\|3997546_3998110_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP028568.1\|WP_101613977.1\|4004130_4004931_-\|DUF2989-domain-containing-protein	unknown	unknown	gnl\|CDD\|371419
NZ_CP028568.1\|WP_011707114.1\|3989678_3989942_+\|DUF997-domain-containing-protein	unknown	unknown	gnl\|CDD\|377626
NZ_CP028568.1\|WP_101613991.1\|3993890_3994907_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176214
NZ_CP028568.1\|WP_011707127.1\|4006599_4006893_+\|DUF1315-domain-containing-protein	unknown	unknown	gnl\|CDD\|225681

Protein	Function_ID	Function_description	E-value
NZ_CP028568.1\|WP_101613980.1\|4003566_4004124_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240042	cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.15623e-39
NZ_CP028568.1\|WP_024944297.1\|4007145_4008153_-\|L-asparaginase-1	gnl\|CDD\|181876	PRK09461, ansA, cytoplasmic asparaginase I; Provisional.	0
NZ_CP028568.1\|WP_101613987.1\|3996495_3997473_+\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	1.21535e-140
NZ_CP028568.1\|WP_017409325.1\|4010051_4011923_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	9.10854e-70
NZ_CP028568.1\|WP_016351764.1\|4008667_4009867_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.81318e-176
NZ_CP028568.1\|WP_101613984.1\|3998676_3999225_-\|NAD(P)H-nitroreductase	gnl\|CDD\|182761	PRK10828, PRK10828, putative oxidoreductase; Provisional.	3.05811e-88
NZ_CP028568.1\|WP_101613981.1\|4001657_4003502_+\|signal-peptide-peptidase-SppA	gnl\|CDD\|182860	PRK10949, PRK10949, signal peptide peptidase SppA.	0
NZ_CP028568.1\|WP_101613995.1\|3989931_3991410_+\|sodium/panthothenate-symporter	gnl\|CDD\|236519	PRK09442, panF, sodium/pantothenate symporter.	0
NZ_CP028568.1\|WP_011707113.1\|3988210_3989551_+\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	gnl\|CDD\|236307	PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated.	0
NZ_CP028568.1\|WP_101613975.1\|4005128_4006559_+\|glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|236219	PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed.	0
NZ_CP028568.1\|WP_011707112.1\|3987739_3988195_+\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	gnl\|CDD\|235777	PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein.	1.86945e-78
NZ_CP028568.1\|WP_101613989.1\|3995432_3996311_+\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|283886	pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA). This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.	1.50618e-139
NZ_CP028568.1\|WP_101614123.1\|3992917_3993766_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.76012e-70
NZ_CP028568.1\|WP_101613982.1\|3999331_4001347_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	gnl\|CDD\|239240	cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provides a hydrid ion to the C5 atom of substrate, and Tyr and His are proposed to form a catalytic dyad that protonates the C4 atom of the substrate and completes the reaction.	0
NZ_CP028568.1\|WP_101613993.1\|3991487_3992915_+\|PTS-N-acetylglucosamine-transporter-subunit-IIBC	gnl\|CDD\|273920	TIGR01998, N-acetylglucosamine_and_glucose_PTS, PTS system, N-acetylglucosamine-specific IIBC component. This model represents the combined B and C domains of the PTS transport system enzyme II specific for N-acetylglucosamine transport. Many of the genes in this family also include an A domain as part of the same polypeptide and thus should be given the name "PTS system, N-acetylglucosamine-specific IIABC component". This family is most closely related to the glucose-specific PTS enzymes. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.59429e-94
NZ_CP028568.1\|WP_101613985.1\|3997546_3998110_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	5.54818e-91
NZ_CP028568.1\|WP_101613977.1\|4004130_4004931_-\|DUF2989-domain-containing-protein	gnl\|CDD\|371419	pfam11207, DUF2989, Protein of unknown function (DUF2989). Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed.	4.67959e-90
NZ_CP028568.1\|WP_011707114.1\|3989678_3989942_+\|DUF997-domain-containing-protein	gnl\|CDD\|377626	pfam06196, DUF997, Protein of unknown function (DUF997). Family of predicted bacterial membrane protein with unknown function.	2.52143e-20
NZ_CP028568.1\|WP_101613991.1\|3993890_3994907_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176214	cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP028568.1\|WP_011707127.1\|4006599_4006893_+\|DUF1315-domain-containing-protein	gnl\|CDD\|225681	COG3139, COG3139, Uncharacterized protein conserved in bacteria [Function unknown].	1.20717e-28

>NZ_CP028568.1|WP_101613985.1|3997546_3998110_+|sugar-O-acetyltransferase
MTEYDKMITSQPYNCMAPELDLLRRETARLYRRFNRSDEEDEQLALLQKIVGELALDAFICPPLYCTYGRHIYIGERSYINMGATLLDNAPIHIGAEVMIGPNVQIYTAAHALDADERIQGVETALPVTIEDRVWIGGGAILLPGVTIGREAIVGAGAVVTKDVPAGARVVGNPARVLPAKGKTPVS
>NZ_CP028568.1|WP_101613987.1|3996495_3997473_+|D-2-hydroxyacid-dehydrogenase-family-protein
MRIAILDDYQDQVRHLPCFTRLAGHDVTILTQSEPDPERLAAKLAGVEALVLIRERTRIDEALLRRLPSLRFISQTGKISQHIDPLLCQRHGVAVAEGIGSPVAPAELCWALIMAASRHLPAYCHALAQGQWQQSGTLGLGRTLQGLTLGIWGYGKIGRLVAGYGRAFGMSVLIWGSEGSRQQAERDGHASASDKEAFFRDADILSLHLRLHEATRGCVTRTDLARMKADSLLVNVSRAELVEPGALYAELAANPTRRAALDVFDAEPATAQSEPLLRLPNVLATPHLGYVECNSYQLYFQVAFDNLIAFAEGRPTNLVLPVAGR
>NZ_CP028568.1|WP_101613989.1|3995432_3996311_+|50S-ribosomal-protein-L11-methyltransferase
MPWIQIRINATAKTADKVSNMLLGRGAQAVTFMDAKDVPVYEPMPGETPLWGETEVMGLFDAETDPAPTIAFFQQIFGEDVGYKVEQLEDKDWVREWMDHFHPMQFGERLWICPSWRDVPNPDAVNVMLDPGLAFGTGTHPTTALCLQWLDGLDLAGKTVVDFGCGSGILGIAALKLGAARVIGIDIDPQAIQASRDNAMRNGVADQIELYLPADQPQDVEADVVVANILAGPLRELAPLIAGHGKAGSLMALSGVLESQTPELETIYGQWFEMDPTAVKEEWCRLSGRKLG
>NZ_CP028568.1|WP_101613991.1|3993890_3994907_+|zinc-binding-alcohol-dehydrogenase-family-protein
MKAIALTHYLPSDHPHCFIEANLADPTPGPRDLLVRVKATSINPVDTKVRAPKAKVESSPRVLGWDAVGEVIAVGREVTLFKAGDRVWYAGDISRPGSNSALQLVDERIAALAPTSLSDLEAAALPLTAITAWETLFERMGLTRESRGRLLIIGGAGGVGSIAIQLARQLTGMEVIATASRPETRAWCLQMGAHQVVSHHQLQEELTALGITQVDAIFCTNATEQHWDAMASLISPFGHICTIAESSVPWDLSLLKSKSVTFSQEFMFTRSLFQTPDMIEQHNLLGLVAALVDQGVVKTTLSKVVAELTPATLAQAHAEVEAGRMVGKLVIDMSRFGN
>NZ_CP028568.1|WP_101614123.1|3992917_3993766_-|LysR-family-transcriptional-regulator
MGLFATVVEQGSFTGAADLLGMPKSSVSQKISRLESQLGVRLLQRTTRRLSLTPQGEVYVEQCRALLALARSANLAMARLRAAPAGRVRITAPEATGTLLLGRILAEFRALYPEVVLELTLCDEQLDLVGEGYDLALRAAPLKDSSLICRRIGQVPRHLVAAPAYLAAHGTPQQLSELSRYACLVHTSLPVWPLQEGGWRPQGACLSNSLLALRELAINEGGIALLPHHVCEGDLAAGRLQKVLPSHPIPANPFYLIYPSREHLAPALRSLMDFVAERLPFA
>NZ_CP028568.1|WP_101613993.1|3991487_3992915_+|PTS-N-acetylglucosamine-transporter-subunit-IIBC
MPVQNARQILTQALQRLGYALLLPVSILPLAALLYRLGQPDVLDLAVLSLTGRALFSQMPLIYAVAIAFGLSRQGEGTQALAGAVNFLLLSSALGTLAPGLHTDMICGLLAGLTTAIVYPWLKRHPMPHWLRLVNGDFTSLLASALTCLLLAFPLALLWPLLEQGITLLASELLTTPFGAFCYGVLNRLLIPLGLHQVLGSLIGLGESNLQALASAQPLHEGYVAGLYPIIMFGLPGACFAIWLHRQRMQRLPQGGLLLTLALTSALVGITEPIEFLFAFTAPWLFLAHALLTGLSLATCSALGIKVGSYFSAGLLDLVLSYHAGEHSFWLIPVGILFFVAYTLLFYQLLERTPLSLPSKPIAPEHPRLASVAPSDPQMLAIQYLKVLGGMDNLQAMSVCLTRLSLRVRDISLVDQSRLLGLGCLSWIQLNDHQLVLVLGPNASLIEGQIRMLAERQSVPLGLKPNQESAGQSGW
>NZ_CP028568.1|WP_101613995.1|3989931_3991410_+|sodium/panthothenate-symporter
MNLELMLPLIIYLVLVLGVGFWASRHRVSGDFVQEYFIGNRSMGGLVLAMTLVATYTSASSFIGGPGAAYKIGLGWVLLAMIQLPTVWLTLGVLGKKFAIIARRVNAVTINDMLWARYQSKAVVVLGSVTIILAFIATMVVQFIGGARLLETATGLSYQQGLLLFASCVLLYTVIGGFRAVVMTDALQGIIMLIGTGALLAGILVAGDGLPNLIHQLKVIDPKLVSPQGAGDLLTQPFMLSFWVLVCIGVVGLPHSALRCFGYRDSKALHRGILIGTIVSALLMFGMHLAGALGRAILPSMDSPDKIMPSLMMEVLPPWLAGVFLAAPMAAIMSTIDSQLIQASATLVKDLYLNYLSPEKAGQEKLEVRVPRLSLLCTLILGTLVLLAALQPPEMIIWLNLLAFGGLQAVFLWPLVLGLYWSRANGPGALASMVCGILCYAILSQWEIKPAGLHAIVPSLGLGLIAFVLVSLLTPAPSQHVRRLFEPQSSMD
>NZ_CP028568.1|WP_011707114.1|3989678_3989942_+|DUF997-domain-containing-protein
MNRFALARREAALCLLLTLLYFLAWYGTAYFIPAEIECWDMPLWFLLSCILMPLLFIVLCGLMVDRLFVDIPLDSPPLDAKEPSHES
>NZ_CP028568.1|WP_011707113.1|3988210_3989551_+|acetyl-CoA-carboxylase-biotin-carboxylase-subunit
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASTDSYLNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAIEAMKKAGVPCVPGSDGPVDSDAKHNAAIAKRIGYPVIIKAAGGGGGRGMRVVRSEAELSAAIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQVLADGQGNALYLGERDCSMQRRHQKVVEEAPAPGITEEMRKFIGERCVRACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVTELVTSVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAPGGLGVRWDSHIYAGYKVPPYYDSMIGKLICYGENRDVAIARMRQALDELVVEGIKTNVSLQKEIMKDENFQHGGTNIHYLHKKLGL
>NZ_CP028568.1|WP_011707112.1|3987739_3988195_+|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein
MDIRKIKKLIELVEESGIAELEISEGEESVRISRNFSGQVTAAPQMIMQQAAAPVAAPAAAPAAAAPAADAIPSGHLMRSPMVGSFYRSSSPEAKPFVEVGQHVNVGDTLCIVEAMKMMNQIESDKAGVIKAILVENGQAVEFDEPLFIIE
>NZ_CP028568.1|WP_101613984.1|3998676_3999225_-|NAD(P)H-nitroreductase
MDALHLLLNRHSCGRLAEPAPSGEVLDNILKAGLRAPDHGTLTPWQFILFEGEGRERLGTLLAQAARSCGEDEESIKKCQEAPLRAPLLIAVATRYQEHPKVPRLEQELSAGCALMAMQMAAQAQGFNGIWRSGWFIFDEQINEGLGLTPEDQLVGFLYLGTPMLEARKLRELPVSEFVRRF
>NZ_CP028568.1|WP_101613982.1|3999331_4001347_-|NADPH-dependent-2,4-dienoyl-CoA-reductase
MSRYPTLLTPLDLGFTQLRNRVLMGSMHTGLEEEKGGFDKLAAFYGERARGGVGLIVTGGIAPNLRGRLVPHGSQLSFPWQVAKHKKVTSAVHQEGGKIALQILHAGRYAYHPFSLAPSALKAPISPFKPRAMSERQIRGTIRDFAATAQLARSAGYDGVEVMGSEGYLINQFICERTNKRTDGWGGSSENRMRFPVEIVRAIRERVGPDFIIIFRLSMLDLVEQGSSLEEVIALGQALEQVGVTLINTGIGWHEARIPTIATSVPRGAFSWVTAELKKHLKVPLITTNRINTPEVAERILAGGEADMVSMARPFLADPEFVIKAAENRADEINTCIACNQACLDHVFKQKRASCLVNPRACFETELTFGRVPQPKKLAVVGAGPAGLAFACYAAERGHQVSLFDQASEIGGQFNFAKQIPGKEEFHETLRYFAKRLEKCGVELYLGQRQSAESLLGGGFDEVILATGIRPRTPNIPGIEHAKVMSYLDVLRDHKPVGEKVAVIGAGGIGFDVAEYLVEGKGDRSRDHWLKEWGIDKQLGERGGLMAPVIDAPERQVWLLQRKESKVGDGLGKTTGWIHRTVLKNRKVEMLSGVQYLRIDDEGLHIQVGEQQQCLPVDQVIICAGQEPLKELQAGLQAAGKPVHIIGGADVAAELDAKRAIRQGAELAAVI
>NZ_CP028568.1|WP_101613981.1|4001657_4003502_+|signal-peptide-peptidase-SppA
MSIFKGLGWLFRSLWRLLNFTRLMLVNLLFLVVVLIIVFSVSQKEAPSAPIEGALTLNLSGVLVEQRSQTDPTVQLLRQVDNSDELPSEIVLSDLLWAIKSAKDDDRIKALVIKPQGLQGTSFSKLQEVASAIDAFKESGKPVIAMADFYTQGQYLLAAHADHVLLNQSGAVVIEGLGVYQTYYKSALEKLNITPHVFKVGTYKSFVEPYTRDEMSPESKEANQRWLDQLWQSYVADVAEQREIEPDAVAPGKDRFLELLRKAGGNAANYALDNGLVDQLATRDEMTQAVIKEVGESDDHGWKGVGLKEYLAAIPSQYPQSGKDEVGLIVASGAIMDGVQPAGTIGGDSLADLLADARRDDKVKALVLRVDSPGGSAFAAEQIRAELLALKQAGKPVVISMGSYAASGGYWISADADKIFASPTTLTGSIGVFGMFATIDKALSQFGVHTDGVGTTDYVGVGLTRALPEHVGQAIQLNVEDTYQRFVGLVSKGRGLSPEETEKAAEGRVWTGQDAKALGLVDEFGDQEAAIKAAAELANLKEWQVTPIEQEESAKDKFLRQLFDSSAQVLASHLQSWLPAGLGKALVEVNRSLDPLTRFNDPQGTYALCPVCTP
>NZ_CP028568.1|WP_101613980.1|4003566_4004124_-|NUDIX-domain-containing-protein
MNHIESLASDWPHPFDIRLTHGRVNTDGRQLERVTVRAVVLRGDQLLLVHSRVNGDLMFPGGGIEQGECHRTALARELREECGAELVAVGALLGETREYRPAREADYDAYCIRSFYYLCQVGEAWCDPQPQPYEIRLGFTPGWFELAEALQTNKTQLAGPCPQWTVRETRVLAELHHWHESGLLA
>NZ_CP028568.1|WP_101613977.1|4004130_4004931_-|DUF2989-domain-containing-protein
MTPFPARSLLFGLCCGLLLTACDDDRIHNICANYPALCQDLVDDGWCRYERSDIIRARYYLQAEGTQRRQYELMRSLERYLKCAERSTNIEYKRAREQKSPRVEGMLAAGEQLAQLDAATRNANYPYLLLWHWTNNTNELARQQFLALEGQPVLEEPELQLALGGIYAKSEPQKAIALMQHALSLYREGEPVNGRILTSLSTLYMGQKQYGQAYLWGKVSESFQNAAEVSATRFSLYHSLSKQEQESLDSQAATLVEQLKSGTYRP
>NZ_CP028568.1|WP_101613975.1|4005128_4006559_+|glyceraldehyde-3-phosphate-dehydrogenase
MTHEHYLQAWQESQELAEAMQPLIGRLYRQQGIEITIFGRPLQNASTIDILKAHRVVRRHQGAPLPIQQSFPLLQAILALNPTAAEIDLGKLAVGYWQDHQDEAGIDDYLRAKLAPALGRGVPAPTDVVLYGFGRIGRLLARLLIERTGAANSLRLRAIVVRGGRDGDLEKRASLLRRDSVHGPFNGSIEVDVERSAIIANGTFIQVIYANSPADIDYTAYGIHDALIVDNTGVWRDEAGLSEHLKARGAARVLLTAPGKGEMKNVVFGVNHEVIGPADKIISAASCTTNAITPVLKVMQDKYGIRHGHVETVHSYTNDQNLIDNYHKGERRGRSAALNMVMTSTGAAKAVAKALPELKGKLTGNAIRVPTPNVSLAIINLSLEQTTDRESLNAYLQQMALSSALHRQIDFSASTELVSSDMVGSRFAGIVDSQATIAEGDHCVLYVWYDNEFGYSCQVVRVMEQMAGAVRQDLPA
>NZ_CP028568.1|WP_011707127.1|4006599_4006893_+|DUF1315-domain-containing-protein
MSFQQGEFLQAIRQMPAEVYERLKTAVELGKWPDGKPLTDEQKATSLQAVMAWQAMHLDNPEHMNIGRDGEIVMKSKSELKRQYRDEEEIVRVDLNH
>NZ_CP028568.1|WP_024944297.1|4007145_4008153_-|L-asparaginase-1
MKKSIYIAYTGGTIGMQRSDHGYVPMAGFMEDCLARMPEFHRPEMPDYHIHEYAPLIDSSDMTPADWQRIAEDIRDNYDKYDGFVILHGTDTMSFTASALSFMLEDLHKPVIITGSQIPLAELRSDGQQNLLNALYIAANYPIHEVTLFFNNQLYRGNRSKKVHADGFHAFDSPNYPPLLNAGIAISLEAGELGVPSERPLVLHDITPQPIGVVTLYPGISAEVIANILQQPVRALILLSFGVGNAPQNPAMLALLSEASARGVIIVNLSQCLHGKVNMGGYATGNALSRAGVISGFDMTAEAALTKLHFLLSQDLPAPRIRELMQQSLRGELTP
>NZ_CP028568.1|WP_016351764.1|4008667_4009867_+|sodium/glutamate-symporter
MLQLDSYATLVAATLVLLLGRLLVTRVGLLRTFNIPKPVAGGLVVALVLLLLRSTLQMELQFDTSLQTPLMLAFFASIGLSADLASLKRGGKAVLTFLLVVTGLLLVQNSLGVGLATLLGLDPHMGLLAGSITLSGGHGTGAAWGATFTEKYGVQSAAELAIACATFGLVLGGLIGGPVARYLVKKVKVPGEEHNRDDAPQGFEMPDMERPLTTFSLIETLALIAISLKGGEMLSAYLKGGAFELPVFVCVLFVGVLLRNVLTLLNWHEVSDREVSLLGNVSLSLFLAMALMSLRLWDLANLALPIFVLLAAQTVAMALYAIFVTFRVMGSNYDAAVLAAGHCGFGLGATPTAIANMQAITQRFGPSHLAFLVVPMVGAFFIDIINAMVIKLFLALPFL
>NZ_CP028568.1|WP_017409325.1|4010051_4011923_-|methyl-accepting-chemotaxis-protein
MKNLSLKQKILLSVVIALSLVILLLSWQSYTSQKSLLLQGSQEQVQRLGSQQAASVSDWLAARRDVIQALGNKAGAEPLNALQQAQVSGRFQLTYFGESGGKMNDSDPSINRDGYDPRSRGWYQEAMSKGGLIVTKPYLDVAYNIMVVTLAQPAQGGVVGGDLSIASLVEDVTKMKLPADGFAIMMHKDGTVIAYKDAAKAMKPATEIDNDLTNALIEQSKTSNSLVPAYFDNEGRDKLLWAVDIPNTDWELVLVLDKETLEAPLSSLLMTQLGLALLVLVGSILAISWLVSMLLGPLSKVSQALARIADGNGDLTQRIKIDTNDEVGQLANSFNRFVGSQHQLIGNIRKLANELNADAERSLVTNQAAVDELQRQQQEVTMVATAVTEMASATMEIAGNAENTAAAAQQSAQSSEQGKMLVNQTRQSINGLAEEVGQATEVIGELSRHAQAISGILSTIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQEIQSTIETLQQTTARAVSLMQTSQGLADNSVKDADAAAAALEEITQAVSLISDMAGQIATAAEEQTQVTGEITQNTTAIKDVSDEITAAAMRDLDQAESLKGRATDLNQQVSTFIL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028568_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028568_5

4645702-4645783

Orphan

Consensus_repeat	Method
GGTAAAGATACCGGCTTACTTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028568_5

>merge|NZ_CP028568|5|4645702-4645783|CRISPRCasFinder
GGTAAAGATACCGGCTTACTTGCCACGCACGGCCCCCATCATGTCCCGCCTCAGTGACGGTAAAGATACCGGCTTACTTTCC

>NZ_CP028568|5|5|4645702-4645783|CRISPRCasFinder
GGTAAAGATACCGGCTTACTTGCC	ACGCACGGCCCCCATCATGTCCCGCCTCAGTGAC
GGTAAAGATACCGGCTTACTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028568.1\|WP_101616905.1\|4650852_4652526_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	unknown	unknown	gnl\|CDD\|274176
NZ_CP028568.1\|WP_016349155.1\|4652596_4652923_-\|MSHA-biogenesis-protein-MshK	unknown	unknown	gnl\|CDD\|274166
NZ_CP028568.1\|WP_082969978.1\|4643936_4644380_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP028568.1\|WP_101616931.1\|4648790_4649789_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP028568.1\|WP_101616913.1\|4642852_4643413_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227302
NZ_CP028568.1\|WP_101616917.1\|4637903_4639409_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616903.1\|4654155_4655019_-\|MSHA-biogenesis-protein-MshI	unknown	unknown	gnl\|CDD\|227306
NZ_CP028568.1\|WP_011704376.1\|4635710_4636616_-\|rod-shape-determining-protein-MreC	unknown	unknown	gnl\|CDD\|237560
NZ_CP028568.1\|WP_101616901.1\|4655088_4656036_+\|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase	unknown	unknown	gnl\|CDD\|225313
NZ_CP028568.1\|WP_005308111.1\|4636658_4637699_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237562
NZ_CP028568.1\|WP_017408812.1\|4644394_4645066_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP028568.1\|WP_101616898.1\|4656111_4658070_-\|RNase-E-specificity-factor-CsrD	unknown	unknown	gnl\|CDD\|236833
NZ_CP028568.1\|WP_101616915.1\|4642031_4642853_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP028568.1\|WP_065017367.1\|4645143_4645605_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028568.1\|WP_045528781.1\|4653562_4654156_-\|MSHA-biogenesis-protein-MshI	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616933.1\|4641568_4641994_-\|MSHA-biogenesis-protein-MshP	unknown	unknown	unknown
NZ_CP028568.1\|WP_101616909.1\|4647048_4648758_-\|type-II/IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|225363
NZ_CP028568.1\|WP_101616911.1\|4643399_4643882_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP028568.1\|WP_101616907.1\|4649884_4650775_-\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|132060
NZ_CP028568.1\|WP_011704364.1\|4652915_4653563_-\|MSHA-biogenesis-protein-MshJ	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP028568.1\|WP_101616905.1\|4650852_4652526_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	gnl\|CDD\|274176	TIGR02519, related_to_type_II_protein_secretion_protein, pilus (MSHA type) biogenesis protein MshL. Members of this family are predicted secretins, that is, outer membrane pore proteins associated with delivery of proteins from periplasm to the outside of the cell. Related families include GspD of type II secretion (TIGR02517), the YscC/HrcC family from type III secretion (TIGR02516), and the PilQ secretin of type IV pilus formation (TIGR02515). Members of this family are found in gene clusters associated with MSHA (mannose-sensitive hemagglutinin) and related pili, and appear to be the secretin of this pilus system. [Cell envelope, Surface structures].	1.292e-87
NZ_CP028568.1\|WP_016349155.1\|4652596_4652923_-\|MSHA-biogenesis-protein-MshK	gnl\|CDD\|274166	TIGR02500, Yop_proteins_translocation_protein_D, type III secretion apparatus protein, YscD/HrpQ family. This family represents a conserved protein of bacterial type III secretion systems. Gene symbols are variable from species to species. Members are designated YscD in Yersinia, HrpQ in Pseudomonas syringae, and EscD in enteropathogenic Escherichia coli. In the Chlamydiae, this model describes the C-terminal 400 residues of a longer protein. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	8.59679e-05
NZ_CP028568.1\|WP_082969978.1\|4643936_4644380_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	1.49907e-10
NZ_CP028568.1\|WP_101616931.1\|4648790_4649789_-\|hypothetical-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.6715e-08
NZ_CP028568.1\|WP_101616913.1\|4642852_4643413_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227302	COG4967, PilV, Tfp pilus assembly protein PilV [Cell motility and secretion / Intracellular trafficking and secretion].	7.77803e-06
NZ_CP028568.1\|WP_101616903.1\|4654155_4655019_-\|MSHA-biogenesis-protein-MshI	gnl\|CDD\|227306	COG4972, PilM, Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion].	0.000513701
NZ_CP028568.1\|WP_011704376.1\|4635710_4636616_-\|rod-shape-determining-protein-MreC	gnl\|CDD\|237560	PRK13922, PRK13922, rod shape-determining protein MreC; Provisional.	7.19045e-103
NZ_CP028568.1\|WP_101616901.1\|4655088_4656036_+\|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase	gnl\|CDD\|225313	COG2515, Acd, 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism].	4.75656e-61
NZ_CP028568.1\|WP_005308111.1\|4636658_4637699_-\|rod-shape-determining-protein	gnl\|CDD\|237562	PRK13927, PRK13927, rod shape-determining protein MreB; Provisional.	0
NZ_CP028568.1\|WP_101616911.1\|4643399_4643882_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	9.5821e-09
NZ_CP028568.1\|WP_101616898.1\|4656111_4658070_-\|RNase-E-specificity-factor-CsrD	gnl\|CDD\|236833	PRK11059, PRK11059, regulatory protein CsrD; Provisional.	0
NZ_CP028568.1\|WP_101616915.1\|4642031_4642853_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	2.07789e-07
NZ_CP028568.1\|WP_101616909.1\|4647048_4648758_-\|type-II/IV-secretion-system-protein	gnl\|CDD\|225363	COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].	0
NZ_CP028568.1\|WP_017408812.1\|4644394_4645066_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	8.96394e-09
NZ_CP028568.1\|WP_101616907.1\|4649884_4650775_-\|DUF2075-domain-containing-protein	gnl\|CDD\|132060	TIGR03015, pepcterm_ATPase, putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking].	8.70259e-74

>NZ_CP028568.1|WP_065017367.1|4645143_4645605_-|hypothetical-protein
MSRQSQQDEHWLGSYRRLAVGILLLIMVATLARSYLVHREEALAVSLTLLGEQFAERAQRLHGLWLDQRRPAVLHADGMAWQFDERGWPLGAGTVMTPSENCRWLWEQLIGKAASTQPPVQALASLDGEGCEFGWENNWLIYQFSDGRVRQKP
>NZ_CP028568.1|WP_017408812.1|4644394_4645066_-|type-II-secretion-system-protein
MTTTRLVPRYSGVASPHRAAGFSLIELVIVIVILGILAVTALPRFLDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPTDTQVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRGSGNDLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQVTTNIN
>NZ_CP028568.1|WP_082969978.1|4643936_4644380_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MKKQAGFTLIELVIVIIILGILAVTAAPKFLNLQDDAKKAAADGVKGAVASASQLVYSRAVLDGSEKDDTGTKTVKLADNSTVTIKYGYPTATSGGIGKAATIDPLWVGSVSGSGSTYVYQTSGSTCTVVYTEANASGAASTAKSGC
>NZ_CP028568.1|WP_101616911.1|4643399_4643882_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MQKGFTLIELVLVILLIGILAAFAVPKWLGKGGFETQTVRDELLTRLRLVQTVNMHEPADRCTQLVVVSPRFAHRTYAACPASDDMSSGWTDNLRTRGRLVAASDGISISLDNNNRFVLRFDQMGRPLGTCAAGCTLLVSDGRETGRIKIESEGYIHESP
>NZ_CP028568.1|WP_101616913.1|4642852_4643413_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MRAPERGFTLIELIVGIVLLAVALTGILGLLINQAPQAVDPVQQVRAAQLAQRLAGEIQQTSFDEQSDHNGGRYRCGEVVAGVTIQACSTHYGPDGESTPYMFNDVDDFDTAGSWKDASFYTQSGGIIAGDEYRNYQVRIAVNPVDFSDGNFKSCTAPCSVGKRIDLQVRLPDESVLDFSFYRGNY
>NZ_CP028568.1|WP_101616915.1|4642031_4642853_-|type-II-secretion-system-protein
MRTASGFTLIELVMVILLLGIMATFTSQFIGIGSQIYGDAGSREQLMSDARFAMERLNRELRDALPGSERIETLDGSWDDSGPCLRFWPISTSSRYLALNRAQSGSTSTLELVMATPASAANPLNQDANTVKVGDLMVVFPLPTSAAGSLVNGCEYGRCVARVTEVLAPVSGAQTVRYASGETLAGISPGSRVYFANQQVRYCVEGSTMTRSSAAIGAPVAAGVLMAESLRAGNFYREVSAFNAEGEFGLRLVFERKGEVVTFNHKLGVFNVP
>NZ_CP028568.1|WP_101616933.1|4641568_4641994_-|MSHA-biogenesis-protein-MshP
MIALFVIVVMAMLAAAMGRFLLDSSEKNTVEVRSVRALLAAQSGLEVALYRLFPNRTLAQPMPPVVCQATSTLNFASNPGLTNCQAVVRCATVPVTYNGSVTTGYRLESVGTCGNSDLNSANPDFAVSRTLMVEAYDGGQI
>NZ_CP028568.1|WP_101616917.1|4637903_4639409_-|hypothetical-protein
MINGSTILPSGNVNVSFDSNGIGQLTLQYPDAGVLRLDATFLRNDVTGTLKLTGSDTVAVIPKAIALQAQGQSGCSGSNDNTYAACPVYRKAGESFTLQARALNEQDQLTPGFAASNKAISWALLAPAAGGTGTFSPTAISLANGVANNVVANWSEVGVIHLGVSNFVPYPAYQDELPQLETVLRWSEPIGRFVPWDYSLSGGFITPACNAFTYMSQPFASGFVLTARNLQKGTTQNYQGAFAKGVAEMVAANALDGVDRSGRITQAPTLSWASGIASVNQQSPFGLNTRFDRATSPEAPFTTLSFGIKVDDKDGGTTLLANPNINAAVAGSCAGASCDAVRLGTQKLLYGRLLAGTEAGVASAPLAIPLKMQYYEAGNWQPNKEDQCTRLSLAADGIRFLNPSHSFDAATRYLSLGAGRKIKLGLGSSAPGGASAQATDGEILFQFANPDISVRIPYRVDLSKQPSQPLWLSDPATLQGEAIFGSSRGNDRIIYRREVMH
>NZ_CP028568.1|WP_005308111.1|4636658_4637699_-|rod-shape-determining-protein
MFKKLRGVFSNDLSIDLGTANTLIYVKDQGIVLNEPSVVAIRQERGNAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNYFRPSPRVLVCVPCGSTQVERRAIKESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAIISLNGVVYSQSVRIGGDKFDEAIISYVRRNYGSLIGEATAERIKHEIGSAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPELASDISERGMVLTGGGALLKDIDRLLMEETGIPVVVAEDPLTCVARGGGKALELIDMHGGDLFHYE
>NZ_CP028568.1|WP_011704376.1|4635710_4636616_-|rod-shape-determining-protein-MreC
MKPIFGRGPSLQLRLFLAVIISIAAIVADSRFGVFSHVRVYLSSLVSPLQYMANAPGIMLDTMSTQVQTRAGLIEQTKQQEQQLFTLRSRLLKMDHLEHENQRLRELLGSPVHKESRKMVAELLSVDSDPFSHQVLINKGALDGVYNGQPVINDQGVIGQVLHVGSTTSRVLLITDSSHGIPVRVLRNDLRAIASGSGELDKLELRNLPRNTDVQVGDLLVTSGLGGRFPEGYPVATVTRSDYVEGKPFAQVEAKPLVALDRLRYLLLLWTDKKPEVHDDEEAPTPAAAPAAAPSAAGATR
>NZ_CP028568.1|WP_101616909.1|4647048_4648758_-|type-II/IV-secretion-system-protein
MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLIDLGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKVTVAMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHEEYQDASFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRIDGILHENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMPVQYGESVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTTLYGALSELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILLVGEMRDNETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVAQRLVRRVCEHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGVYELLELDQPMMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAEDLG
>NZ_CP028568.1|WP_101616931.1|4648790_4649789_-|hypothetical-protein
MLLLTLICGLALGILGWRTWIYWQQSQRVVEARQLQAAGEPKPDAIARAVPAAVPASAEQEPVDQVVALPTPRHLAAPPTAEPQQEQESAADDADVAAIDEEGPSDEELQPDLYAELAAEQEAPAAAPRKPGVLKIETVNLSEAELATLAERKATTAMAKGQLRDAQDNYYQVLVHDPRNQGAREQLAGLLYGEGRLSEASQLLEEGLRFDPEQADFRLLLARLAISGGDQLKALGWLTGHRPDLASNLDYYATWAGLSQELGQHADAADLYVKLLRQQPDQGRWWLGLGVAEDGQGHSQRALDAYRNAQLHGNLGEASTSWLEQRIAQLAP
>NZ_CP028568.1|WP_101616907.1|4649884_4650775_-|DUF2075-domain-containing-protein
MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEGFIKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVRDQSELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQIVLFGQPELDARLAKPHLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLFGGRALRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRLVPRRWWPLVLLLGCALAYGVWQ
>NZ_CP028568.1|WP_101616905.1|4650852_4652526_-|pilus-(MSHA-type)-biogenesis-protein-MshL
MKKHHLCLISAAMLTAGCTSYRHPEPVQAKDALRHAMTEQNKGGALTSVPKSVQSELLQLNRPPQAISMPEPRLRIAAHDVDAVEFFGSLFKGSRYSVAVHPGVAGQISVELKDVTLTEVLAVVGDMYGFDVQRKGNVFHVYPAGLRTETIPVNYLMMSRRGLSRTSVSTGGVTANDNNGNSNSFDNANNSTNNNSTSNRSSNGSSNSDSNGTRIETDTSSDYWTDLRDTLQTLIGSGDGRAVITSPQAGLVTIRAYPKELKAVREFLNQSESHLKRQVVLEARILEVALNEGYEQGVDWSGLSASWDGNKGITGGGSLTPSTIANTPNQIFSALGGGAGFKISDGNFNVAVNLLKTQGDVNTLSSPRVTATNNQKAVIKVGTDEYFVTNASTTTTTSGTSAPIVTPNVELTPFFSGIALDVTPQIDEEGKVLLHIHPSVIDTEEQKKTIDVGTADPLILPLAKSSIRESDTVVQANNGDIIVIGGLMKTDKQEIVSKVPLLGDIPWVGEAFTNRRESTKKVELVILLKPTVVEKDTWQNELQRSSELLDKWYPPKG
>NZ_CP028568.1|WP_016349155.1|4652596_4652923_-|MSHA-biogenesis-protein-MshK
MARWFPLWACLFSLLAQAQPELLQDPTAPLSGATSGASATGQREAGLPRLQSIMLGNGPALAVLNGSSYRVGQQVDGYRVVAIGADAVVLEKGGKRQSLTLFASKVRI
>NZ_CP028568.1|WP_011704364.1|4652915_4653563_-|MSHA-biogenesis-protein-MshJ
MSLKEQWQAWADKIAALSQRERVLILLTGVVVVGAVAIYGWLDGAAVRLEQERLALSTAQRDLEIMDLENQGKQAKLARDPDLHVRTQLAQLDGELGKLDAELKAQTVDLIQAHEMPAVLEALLSRSANLHMVALTSLTPEPLMAGEQRINLFKHGIRLKLEGGYFDVYQYLKALEGLPRHFYWKQFDYQVQEYPKAVVEMEIYTLSTSKEFIRG
>NZ_CP028568.1|WP_045528781.1|4653562_4654156_-|MSHA-biogenesis-protein-MshI
MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAWQQHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLVTKQEELTAKQGLMRQLGSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNRFKQTPSLAGKQFGELTLSRDKEGRLAFQLSGIEREKP
>NZ_CP028568.1|WP_101616903.1|4654155_4655019_-|MSHA-biogenesis-protein-MshI
MKQLFRRSTPSRQVGLLLASDRIMLASLGNPPIFATRAINGPQEWPQAMAELFSRHGLAKSKVRVALAASLYQQVQIDKPAVPDAEMAGALPWAIKDYVSESVLQLAMDYVDLPTPPAGRPRINVICVPKVRVQQLADAVNGIARLDAIVSDELAMTALYEPDQTVRMLLWQPKGQDLQLLVFHQGGLCFSRQLRGFGALTGEHEPDAMLLDSLALEIQRSLDYLVGQLKLPELGQMQLAIASPFIGTLVRHMEQTFGFAVSAMANKAILSGVEYLSAYAAALGEDA
>NZ_CP028568.1|WP_101616901.1|4655088_4656036_+|1-aminocyclopropane-1-carboxylate-deaminase/D-cysteine-desulfhydrase
MTDYSLSPQSPPMALPPLQPALLPSPLQAVSHPLLSAYGVQLWCKRDDLIHPAISGNKWRKLKYHLLHAREQGKRHLLSFGGAYSNHIHALAAAGCQSGLRTTGIIRGEPEAVSNCTLSAAKGWGMDLVFVDRQSYRRRQDPAWLAQFEDEETLIVPEGGSSPLAIPGVAELVDEVPFSPDLWVLPCASGGTLAGLIAGKRAPQQILAIAVLKGGSFIADEVHRLHPAAADTPGWRIALDHHDGGYAKFSPALWQWVQAFSAETGLPLEPIYSGKAMWGLFRELAAGRIPRGSKIVFIHTGGMQGLAGLREQGRL
>NZ_CP028568.1|WP_101616898.1|4656111_4658070_-|RNase-E-specificity-factor-CsrD
MDVVGHTERHMKLTTQLVSFITLCVIAAMAMVLLGGVFSFRELGMEMQQKKVNSLVEIIDKQLEVADDHQDLTRWLPTLLRSAHVVELEIRQDKQRIYWFRDVQQPTDESLLIPYHQPMPHQPGMQADFKLERPFKEFEYSIKAMSGISLGVFIVVFGLWYSIRWLRLQLRGAELLAERAQLILDNKLTKLAHDPADEWPQPASQALDYLLAELADARKERSRFDNFIRSNAFVDKMTGIGNRLFFDNRLESAIMEASVMSGGMLLIELAGLEELDPELNGRQSQDLLMEASASIAAFVRKHNGALQARYAGQVFAVLLPNMSESEMVDGAGQLHKSLQRLHWPEAVNPDTAVYLGAVCYQAEDSLLKVQEEAELALKSARLQGHTGWFLYEKQLDEEQSSKGTVRWRTLIGRRIEEHGIDFYVQPVQQERDQVVLQQDLLIRIHDEQGRELQAGVFMPMAEKAGLLLPLDRLVAEQTLGLLRQRSEQSCPISLTLCAQSLLHREFQRWLFFDLFQLPRSTNERLILQLSEAQVTRHYEALKRPLRALRMLGCQLAIDHAGQDVVSTQYIKEFEINFLKLHPSLVREIHTRQVNQMAVRSLVGGCANTRTRVIAVGVESGDEWKMLRHLGVHAGQGPWFAEPERLVLEPAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

913329 : 923265

uncultured_Mediterranean_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017410638.1\|913329_914076_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	7.2e-70	54.1
WP_011704775.1\|914080_914698_+	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.0e-34	46.4
WP_073352336.1\|914700_915276_+	DedA family protein	NA	NA	NA	NA
WP_029302383.1\|915286_916327_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	8.6e-13	35.6
WP_011704778.1\|916374_917358_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.7e-34	34.1
WP_024946180.1\|917442_918456_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.1e-108	58.3
WP_005309452.1\|918635_918851_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_101615631.1\|918866_919310_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.7e-26	48.6
WP_043125117.1\|919398_921186_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.0e-74	41.1
WP_073348937.1\|921399_923265_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-34	32.6

DBSCAN-SWA_2

1118749 : 1180912

Salmonella_phage(14.29%)

lysis,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011704936.1\|1118749_1118965_-\|lysis	lysis protein	NA	NA	NA	NA
WP_101614992.1\|1118979_1119948_-	hypothetical protein	NA	NA	NA	NA
WP_011704938.1\|1120067_1120874_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_043159586.1\|1121025_1122432_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_101614990.1\|1122521_1123391_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005303968.1\|1123504_1123840_-	hypothetical protein	NA	NA	NA	NA
WP_016349725.1\|1123965_1124307_-	DUF2956 domain-containing protein	NA	NA	NA	NA
WP_107979044.1\|1124393_1126223_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_031285326.1\|1126219_1127167_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_011704943.1\|1127554_1129096_-	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
WP_029301667.1\|1129274_1130129_-	Tim44 domain-containing protein	NA	NA	NA	NA
WP_073349087.1\|1130309_1130411_+	hypothetical protein	NA	NA	NA	NA
WP_011704946.1\|1130561_1131956_+	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	5.0e-181	71.5
WP_011704947.1\|1132022_1132115_+	hypothetical protein	NA	NA	NA	NA
WP_101618020.1\|1132292_1133366_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.1e-22	26.6
WP_005334896.1\|1133560_1133809_-	4Fe-4S dicluster domain-containing protein	A0A1B1IWY9	uncultured_Mediterranean_phage	1.5e-19	52.9
WP_017408769.1\|1133810_1135172_-	U32 family peptidase	Q6DW11	Phage_TP	1.1e-164	76.2
WP_107979045.1\|1135405_1136107_-	diguanylate phosphodiesterase	NA	NA	NA	NA
WP_019706001.1\|1136225_1137173_+\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
WP_101618202.1\|1137481_1138204_+	hypothetical protein	NA	NA	NA	NA
WP_101618205.1\|1138233_1138725_+	adhesin	NA	NA	NA	NA
WP_101618207.1\|1138792_1141231_+	hypothetical protein	NA	NA	NA	NA
WP_000019402.1\|1141691_1142672_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
WP_101617926.1\|1143627_1144266_-	DNA-binding response regulator	NA	NA	NA	NA
WP_101617928.1\|1144386_1147815_+	two-component system sensor histidine kinase/response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	5.9e-42	29.7
WP_044799339.1\|1147776_1148070_-	hypothetical protein	NA	NA	NA	NA
WP_101617930.1\|1148841_1150089_+	cysteine desulfurase-like protein	NA	NA	NA	NA
WP_011704959.1\|1150142_1151204_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_011704960.1\|1151214_1151685_-	chemotaxis protein CheD	NA	NA	NA	NA
WP_101617932.1\|1151695_1152499_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_019706001.1\|1154258_1155206_-\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
WP_016349735.1\|1155886_1156459_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_101617608.1\|1156471_1158394_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_101617609.1\|1158409_1160623_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_101617611.1\|1160649_1160976_-	anti-sigma factor antagonist	NA	NA	NA	NA
WP_011704967.1\|1160990_1161359_-	response regulator	W8CYM9	Bacillus_phage	1.0e-16	40.5
WP_101617613.1\|1161368_1162583_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.2e-11	33.1
WP_101617615.1\|1162886_1163975_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_017782062.1\|1164178_1165120_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016349742.1\|1165247_1165856_+	LysE family translocator	NA	NA	NA	NA
WP_101617617.1\|1165958_1167818_+	U32 family peptidase	Q6DW11	Phage_TP	2.5e-15	40.2
WP_101617619.1\|1168584_1169061_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-21	52.9
WP_101617620.1\|1169057_1170617_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_101617621.1\|1170826_1171228_+	hypothetical protein	NA	NA	NA	NA
WP_101617623.1\|1171297_1172851_-	carboxypeptidase M32	NA	NA	NA	NA
WP_101617624.1\|1172878_1173460_-	DNA endonuclease SmrA	NA	NA	NA	NA
WP_011704978.1\|1173613_1173799_-	DUF3149 domain-containing protein	NA	NA	NA	NA
WP_101617626.1\|1173931_1174825_-	TraB/GumN family protein	NA	NA	NA	NA
WP_101617628.1\|1174912_1175245_+	DUF1904 domain-containing protein	NA	NA	NA	NA
WP_043159901.1\|1175402_1176230_-	short-chain dehydrogenase	NA	NA	NA	NA
WP_049048448.1\|1176348_1177794_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_026383935.1\|1177942_1180912_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.6

DBSCAN-SWA_3

2454721 : 2518332

Catovirus(12.5%)

tRNA,integrase,transposase

attL 2487234:2487251|attR 2518999:2519016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101616750.1\|2454721_2455666_-\|tRNA	tRNA dihydrouridine(16) synthase DusC	NA	NA	NA	NA
WP_011706066.1\|2455875_2456253_+	DUF454 domain-containing protein	NA	NA	NA	NA
WP_073350350.1\|2456282_2456930_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.3e-30	42.7
WP_101616752.1\|2457112_2459659_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.0e-43	36.3
WP_011706069.1\|2459782_2460112_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_019706001.1\|2460915_2461863_-\|transposase	IS30-like element ISAs2 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.4e-31	31.4
WP_011706072.1\|2464106_2465177_+	transcriptional regulator	NA	NA	NA	NA
WP_017408387.1\|2465261_2465684_+	CBS domain-containing protein	NA	NA	NA	NA
WP_101617337.1\|2465909_2469809_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	2.8e-56	27.3
WP_101617335.1\|2469875_2470742_+	hypothetical protein	NA	NA	NA	NA
WP_011706076.1\|2470767_2471136_+	50S ribosomal protein L25	NA	NA	NA	NA
WP_101617333.1\|2471329_2474512_+	sensor histidine kinase	A0A1V0SGX0	Hokovirus	9.0e-61	31.0
WP_101617332.1\|2474508_2475510_+	HD domain-containing protein	W8CYM9	Bacillus_phage	1.6e-11	30.4
WP_024945381.1\|2475499_2476144_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_101617330.1\|2476171_2477272_-\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_049049560.1\|2477268_2478306_-	selenide, water dikinase SelD	NA	NA	NA	NA
WP_101617328.1\|2478688_2479873_-	acyltransferase	NA	NA	NA	NA
WP_101617326.1\|2480133_2480778_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_101617324.1\|2481262_2482456_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_073350327.1\|2482561_2483992_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-26	33.4
WP_005300975.1\|2484077_2484350_+	acylphosphatase	NA	NA	NA	NA
WP_073350325.1\|2484435_2485071_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_073350323.1\|2485289_2487323_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
2487234:2487251	attL	NA	NA	NA	NA
WP_073350321.1\|2487509_2488592_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_011706091.1\|2488701_2489346_+	uridine kinase	A0A1V0SAA3	Catovirus	1.4e-32	38.5
WP_011706092.1\|2489409_2489991_+	deoxycytidine triphosphate deaminase	I4AZP2	Saccharomonospora_phage	1.4e-28	40.8
WP_101617322.1\|2490024_2490117_-	hypothetical protein	NA	NA	NA	NA
WP_073350319.1\|2490398_2491868_+	inorganic phosphate transporter	NA	NA	NA	NA
WP_000429836.1\|2492224_2492659_-	mercuric resistance operon regulatory protein	NA	NA	NA	NA
WP_001294663.1\|2492730_2493081_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000732292.1\|2493094_2493370_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001340589.1\|2493405_2493828_+	mercury transporter MerC	NA	NA	NA	NA
WP_000105636.1\|2493879_2495574_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
WP_001277456.1\|2495591_2495954_+	transcriptional regulator	NA	NA	NA	NA
WP_000993386.1\|2495950_2496187_+	mercury resistance protein	NA	NA	NA	NA
WP_000204520.1\|2496183_2496891_+	EAL domain-containing protein	NA	NA	NA	NA
WP_000935451.1\|2496929_2498645_+\|transposase	transposase	NA	NA	NA	NA
WP_000344784.1\|2498647_2499508_+	transposition protein TniB	NA	NA	NA	NA
WP_000194037.1\|2501899_2502655_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
WP_041206683.1\|2502669_2504211_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
WP_001163403.1\|2505356_2506139_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-33	35.0
WP_000376623.1\|2506314_2506815_-	N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|2506833_2507013_+	hypothetical protein	NA	NA	NA	NA
WP_083557448.1\|2507324_2508509_+	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_073350311.1\|2508596_2509262_-	type B chloramphenicol O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	1.2e-23	42.4
WP_071534640.1\|2509684_2509879_+	hypothetical protein	NA	NA	NA	NA
WP_073352450.1\|2509839_2511312_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_034019298.1\|2512497_2513058_-	ETC complex I subunit	NA	NA	NA	NA
WP_073350309.1\|2513267_2513621_-	N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|2513639_2513819_+	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|2513748_2514588_-	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000679427.1\|2514581_2514929_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001206316.1\|2515092_2515884_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000845048.1\|2516029_2517043_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004193519.1\|2516981_2517596_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001161490.1\|2517771_2518332_+\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
2518999:2519016	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2915057 : 2961107

uncultured_Mediterranean_phage(13.33%)

tRNA,plate,transposase,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017409658.1\|2915057_2915816_-\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_101615138.1\|2916000_2917521_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-88	42.6
WP_011705745.1\|2917542_2918031_-\|bacteriocin	bacteriocin production protein	NA	NA	NA	NA
WP_039214580.1\|2918217_2919513_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.0e-92	49.9
WP_101615136.1\|2919556_2919787_+	hypothetical protein	NA	NA	NA	NA
WP_101615134.1\|2919852_2921217_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-79	42.1
WP_011705742.1\|2921342_2921951_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_024944039.1\|2922028_2924551_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	4.7e-89	48.4
WP_005300047.1\|2924752_2925244_-	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_101615131.1\|2925393_2925624_+	alanine dehydrogenase	NA	NA	NA	NA
WP_101615129.1\|2926229_2927180_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.4e-62	44.5
WP_011705738.1\|2927237_2928485_+	diguanylate cyclase response regulator	A0A127AWB9	Bacillus_phage	6.5e-15	32.2
WP_016350454.1\|2928595_2929066_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_029303253.1\|2929085_2929793_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_011705735.1\|2929789_2930506_+\|tRNA	arginyl-tRNA-protein transferase	NA	NA	NA	NA
WP_005300033.1\|2930575_2930794_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_024944043.1\|2930863_2933116_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	9.2e-169	43.7
WP_005300028.1\|2933175_2933493_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.4e-14	49.4
WP_005300025.1\|2933721_2933940_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-17	63.2
WP_101615128.1\|2934047_2934911_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.8e-27	31.2
WP_041206683.1\|2935961_2937503_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
WP_000194037.1\|2937517_2938273_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
WP_101617446.1\|2939185_2939371_-	hypothetical protein	NA	NA	NA	NA
WP_101617444.1\|2942279_2944325_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.1e-33	26.4
WP_017411057.1\|2944335_2944623_-	type VI secretion system PAAR protein	G4KK81	Yersinia_phage	2.3e-08	39.4
WP_101617441.1\|2944880_2946311_-	hypothetical protein	NA	NA	NA	NA
WP_101617439.1\|2946357_2949843_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_101617438.1\|2949884_2951330_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_101617436.1\|2951338_2951944_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_101617434.1\|2951943_2953482_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_101617431.1\|2953484_2956127_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	6.3e-92	33.4
WP_011705720.1\|2956147_2956858_-	chemotaxis protein MotB	NA	NA	NA	NA
WP_101617428.1\|2956949_2958284_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_011705718.1\|2958286_2958802_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_011705717.1\|2958801_2960052_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_011705716.1\|2960108_2961107_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_5

3969820 : 3977724

Staphylococcus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081396127.1\|3969820_3970405_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.3e-30	48.7
WP_101614011.1\|3970488_3971700_+\|protease	serine protease	V5LS29	Emiliania_huxleyi_virus	4.0e-09	26.9
WP_016351734.1\|3971762_3972872_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.9e-65	39.0
WP_101614009.1\|3973013_3973667_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.7e-20	36.4
WP_101614008.1\|3973721_3974831_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.6e-49	35.2
WP_010675395.1\|3974927_3975377_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_029304291.1\|3975499_3975832_-	hypothetical protein	NA	NA	NA	NA
WP_101614006.1\|3975907_3976387_-	hypothetical protein	NA	NA	NA	NA
WP_011707102.1\|3976470_3977724_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.3e-100	53.5

DBSCAN-SWA_6

4097655 : 4144043

Ralstonia_phage(14.29%)

transposase,tRNA,integrase,protease

attL 4115410:4115469|attR 4144749:4144816

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101616342.1\|4097655_4099071_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_017410937.1\|4099261_4101433_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-27	36.5
WP_011707208.1\|4101531_4102200_+	opacity-associated protein OapA	NA	NA	NA	NA
WP_011707209.1\|4102472_4102682_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.4e-15	57.1
WP_017410935.1\|4103869_4104415_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	5.5e-27	37.5
WP_024945878.1\|4104461_4105541_+	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_011707212.1\|4105446_4106442_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_029299157.1\|4106438_4106690_+	DUF2132 domain-containing protein	NA	NA	NA	NA
WP_011707214.1\|4106694_4106946_+	DUF2960 domain-containing protein	NA	NA	NA	NA
WP_101616344.1\|4106948_4107347_+	hypothetical protein	NA	NA	NA	NA
WP_101616347.1\|4107460_4108030_-	DUF417 domain-containing protein	NA	NA	NA	NA
WP_101616349.1\|4108072_4108507_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_101616351.1\|4108515_4109433_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_017410927.1\|4109493_4109988_-	hypothetical protein	NA	NA	NA	NA
WP_101616354.1\|4110159_4112133_+	PAS domain S-box protein	G3MA91	Bacillus_virus	8.4e-09	24.7
WP_101616356.1\|4112200_4112707_-	ribonuclease E inhibitor RraB	NA	NA	NA	NA
WP_101616358.1\|4112970_4115265_+\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA
4115410:4115469	attL	NA	NA	NA	NA
WP_101616360.1\|4116115_4117735_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_000019402.1\|4118266_4119247_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	1.6e-186	99.7
WP_107979069.1\|4119315_4119897_-	hypothetical protein	NA	NA	NA	NA
WP_031285326.1\|4120052_4121000_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_029304362.1\|4122225_4122759_+	hypothetical protein	NA	NA	NA	NA
WP_029304363.1\|4122755_4123058_+	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.0e-07	39.2
WP_101618074.1\|4123080_4123707_+	hypothetical protein	NA	NA	NA	NA
WP_101618072.1\|4123703_4124138_+	DUF2787 domain-containing protein	NA	NA	NA	NA
WP_107979070.1\|4124354_4124534_-	hypothetical protein	NA	NA	NA	NA
WP_101618067.1\|4124630_4125872_+\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	1.5e-27	30.9
WP_101618065.1\|4125962_4126385_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_101618063.1\|4126654_4127428_+	hypothetical protein	NA	NA	NA	NA
WP_107979071.1\|4127748_4128594_+	hypothetical protein	A0A0R6PH67	Moraxella_phage	6.1e-33	30.5
WP_000194037.1\|4128653_4129409_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
WP_041206683.1\|4129423_4130965_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
WP_101618267.1\|4131386_4132055_+	TM2 domain-containing protein	NA	NA	NA	NA
WP_107979072.1\|4132067_4132757_+	hypothetical protein	NA	NA	NA	NA
WP_107979073.1\|4132917_4134354_+	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	2.0e-07	32.3
WP_101616365.1\|4135889_4136375_-	hypothetical protein	NA	NA	NA	NA
WP_101616366.1\|4136362_4137988_-	thiamine biosynthesis protein ThiF	NA	NA	NA	NA
WP_101616368.1\|4137993_4139142_-	hypothetical protein	NA	NA	NA	NA
WP_101616423.1\|4139151_4140138_-	patatin	A0A1B2LRS3	Wolbachia_phage	6.7e-23	26.7
WP_101616370.1\|4140453_4140699_-	hypothetical protein	NA	NA	NA	NA
WP_101616372.1\|4140685_4142878_-	DUF927 domain-containing protein	NA	NA	NA	NA
WP_101616374.1\|4142891_4144043_-\|integrase	site-specific integrase	Q4ZCC1	Staphylococcus_virus	6.4e-09	24.4
4144749:4144816	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP028567

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1387 : 60517

Escherichia_phage(22.22%)

integrase,transposase

attL 16718:16734|attR 58091:58107

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041206683.1\|1387_2929_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
WP_053821788.1\|4476_6120_-	phosphoethanolamine--lipid A transferase MCR-5.1	NA	NA	NA	NA
WP_099108050.1\|6138_6681_-	chromate resistance protein ChrB	NA	NA	NA	NA
WP_003055107.1\|6920_7481_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.8e-50	86.2
WP_026383935.1\|7483_10453_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.6
WP_101618219.1\|10488_10893_+	hypothetical protein	NA	NA	NA	NA
WP_101618217.1\|11012_12179_+\|transposase	transposase	A0A077SLN2	Escherichia_phage	3.4e-151	69.9
WP_101618215.1\|12281_13457_+	hypothetical protein	NA	NA	NA	NA
WP_101618213.1\|13770_14016_+	plasmid replication protein RepB	NA	NA	NA	NA
WP_107979020.1\|14120_14348_-	hypothetical protein	NA	NA	NA	NA
WP_003089120.1\|14358_14757_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_003089115.1\|14831_15182_+	mercury transporter MerT	NA	NA	NA	NA
WP_003150552.1\|15194_15470_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_003089113.1\|15477_15690_+	hypothetical protein	NA	NA	NA	NA
WP_101618198.1\|15702_18696_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	8.2e-258	47.4
16718:16734	attL	NA	NA	NA	NA
WP_003150546.1\|18699_19110_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_003089107.1\|19109_19349_-	hypothetical protein	NA	NA	NA	NA
WP_101618187.1\|20041_22927_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-190	39.9
WP_000904906.1\|23052_23667_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.3e-37	48.6
WP_001082319.1\|23732_24536_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_000480968.1\|24535_25372_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_028697649.1\|25478_25955_+	TnpR	NA	NA	NA	NA
WP_000557454.1\|26029_26890_+	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
WP_000587837.1\|26902_27445_+	hypothetical protein	NA	NA	NA	NA
WP_000951934.1\|27926_28118_-	hypothetical protein	NA	NA	NA	NA
WP_001330846.1\|28123_28369_+	hypothetical protein	NA	NA	NA	NA
WP_000080860.1\|28419_29556_+	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_100229849.1\|31613_33644_+	restriction endonuclease subunit M	A0A220A2U5	Liberibacter_phage	8.9e-22	25.3
WP_100229850.1\|33640_34690_+	DUF1016 domain-containing protein	Q9JMP5	Wolbachia_phage	4.0e-34	33.1
WP_025760282.1\|34686_36012_+	hypothetical protein	NA	NA	NA	NA
WP_100229851.1\|36008_39257_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_076611309.1\|39249_40554_+\|transposase	ISL3 family transposase ISSm4	A0A2D1GQC1	Lysinibacillus_phage	7.2e-57	31.0
WP_074148850.1\|41028_41250_-	resolvase	NA	NA	NA	NA
WP_000935452.1\|41181_42486_+\|integrase	integrase	NA	NA	NA	NA
WP_001067855.1\|42532_43237_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018329.1\|43426_44242_-	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
WP_001067855.1\|44392_45097_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001381192.1\|45587_46580_+	transposition protein TniB	NA	NA	NA	NA
WP_000376623.1\|46548_47049_-	N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|47067_47247_+	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|47176_48016_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|48009_48357_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001206316.1\|48520_49312_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_063857839.1\|49429_50296_-	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-12	A0A077SL40	Escherichia_phage	1.2e-55	44.5
WP_088813959.1\|50343_51905_-\|transposase	IS3-like element ISAs20 family transposase	NA	NA	NA	NA
WP_023622803.1\|52091_52646_-	aminoglycoside N-acetyltransferase AAC(6')-IIa	NA	NA	NA	NA
WP_000777555.1\|52754_53228_-	trimethoprim-resistant dihydrofolate reductase DfrA1	G3MBI7	Bacillus_virus	3.7e-19	32.1
WP_052484405.1\|53370_53703_-	quaternary ammonium compound efflux SMR transporter QacK	NA	NA	NA	NA
WP_032495607.1\|53950_54607_-	quinolone resistance pentapeptide repeat protein QnrVC6	NA	NA	NA	NA
WP_014454105.1\|54883_55438_-	aminoglycoside N-acetyltransferase AAC(6')-Ib'	NA	NA	NA	NA
WP_002075255.1\|55617_56631_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
WP_088821991.1\|56569_56860_+\|transposase	transposase	NA	NA	NA	NA
WP_039272634.1\|56894_57488_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.2e-40	49.7
WP_039272567.1\|57484_60517_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
58091:58107	attR	NA	NA	NA	NA

DBSCAN-SWA_2

72874 : 111966

Acidithiobacillus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041206683.1\|72874_74416_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.2e-128	47.2
WP_000194037.1\|74430_75186_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.4e-59	51.5
WP_101618142.1\|75502_76561_+	hypothetical protein	NA	NA	NA	NA
WP_101618144.1\|76811_77774_+	DUF3150 domain-containing protein	NA	NA	NA	NA
WP_101618145.1\|77834_79685_+	VWA domain-containing protein	NA	NA	NA	NA
WP_101618147.1\|79941_80994_+	hypothetical protein	NA	NA	NA	NA
WP_101618149.1\|81109_81595_+	hypothetical protein	NA	NA	NA	NA
WP_001809438.1\|82112_83144_+\|transposase	IS630-like element ISAhy2 family transposase	NA	NA	NA	NA
WP_021141311.1\|83560_84697_+\|transposase	ISAs1-like element ISAs12 family transposase	NA	NA	NA	NA
WP_101618125.1\|85538_85871_-	hypothetical protein	NA	NA	NA	NA
WP_101618123.1\|86049_88050_+	hypothetical protein	NA	NA	NA	NA
WP_101618122.1\|88108_89383_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_101618120.1\|89547_91209_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_107979024.1\|91171_91651_-	hypothetical protein	NA	NA	NA	NA
WP_021141311.1\|91928_93065_+\|transposase	ISAs1-like element ISAs12 family transposase	NA	NA	NA	NA
WP_107979025.1\|93092_94046_+	DNA cytosine methyltransferase	NA	NA	NA	NA
WP_101618247.1\|94143_94638_+	hypothetical protein	NA	NA	NA	NA
WP_099993964.1\|94938_95955_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
WP_101618269.1\|96094_96766_+	phosphatase	NA	NA	NA	NA
WP_005342491.1\|96859_97810_-\|transposase	IS1595-like element ISKpn3 family transposase	NA	NA	NA	NA
WP_101618231.1\|98132_99782_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_101618233.1\|99842_100487_-	fructose-6-phosphate aldolase	NA	NA	NA	NA
WP_005342491.1\|100798_101749_+\|transposase	IS1595-like element ISKpn3 family transposase	NA	NA	NA	NA
WP_043133530.1\|102325_102883_+	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_043133533.1\|102903_103884_+	PTS sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_081934683.1\|103909_104275_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_043133536.1\|104361_105138_+	sorbitol-6-phosphate dehydrogenase	W8CYX9	Bacillus_phage	6.9e-07	46.3
WP_043133537.1\|105239_105596_+	glucitol operon activator	NA	NA	NA	NA
WP_043133538.1\|105696_106461_+	DNA-binding transcriptional repressor	NA	NA	NA	NA
WP_043133539.1\|106493_107459_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.6e-37	33.1
WP_011191341.1\|108577_109852_-\|transposase	IS4-like element ISApu2 family transposase	NA	NA	NA	NA
WP_004099020.1\|110008_110380_+	hypothetical protein	NA	NA	NA	NA
WP_011191342.1\|110697_111966_+\|transposase	IS4 family transposase ISApu1	NA	NA	NA	NA

DBSCAN-SWA_3

136851 : 183850

Saccharomonospora_phage(33.33%)

integrase,transposase

attL 136011:136029|attR 151838:151856

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
136011:136029	attL	NA	NA	NA	NA
WP_046400746.1\|136851_138417_-\|transposase	IS21 family transposase ISAs27	K4I413	Acidithiobacillus_phage	2.9e-121	45.8
WP_101617249.1\|138585_139965_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_101617251.1\|139974_142572_+\|integrase	integrase	NA	NA	NA	NA
WP_101617253.1\|142574_143234_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_101617255.1\|143582_144632_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_101617257.1\|144674_145682_+	hypothetical protein	NA	NA	NA	NA
WP_101617259.1\|146311_148909_+	hypothetical protein	NA	NA	NA	NA
WP_101617261.1\|149616_150375_+	hypothetical protein	NA	NA	NA	NA
WP_101617263.1\|150678_150936_+	hypothetical protein	NA	NA	NA	NA
WP_101617265.1\|151204_151492_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_101617266.1\|151479_151773_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_021141234.1\|151908_153135_-	hypothetical protein	O80301	Enterobacteria_phage	7.7e-154	78.6
151838:151856	attR	NA	NA	NA	NA
WP_010674034.1\|153192_153597_+\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
WP_107979027.1\|153655_154192_+	hypothetical protein	NA	NA	NA	NA
WP_101618136.1\|155194_155866_-	protein RepA	A0A077SLP3	Escherichia_phage	1.0e-30	35.7
WP_101618134.1\|157092_157497_-	hypothetical protein	NA	NA	NA	NA
WP_101618140.1\|157889_158096_-	hypothetical protein	NA	NA	NA	NA
WP_101618132.1\|158164_158617_-	hypothetical protein	NA	NA	NA	NA
WP_101618130.1\|158699_159167_-	hypothetical protein	NA	NA	NA	NA
WP_101618129.1\|159503_159932_+	hypothetical protein	NA	NA	NA	NA
WP_101618128.1\|160009_160432_+	hypothetical protein	NA	NA	NA	NA
WP_010674034.1\|160550_160955_-\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
WP_021141234.1\|161012_162239_+	hypothetical protein	O80301	Enterobacteria_phage	7.7e-154	78.6
WP_107979028.1\|162255_162552_+	hypothetical protein	NA	NA	NA	NA
WP_101618058.1\|162961_163306_+	hypothetical protein	NA	NA	NA	NA
WP_101618054.1\|163691_164111_-	transcriptional regulator	NA	NA	NA	NA
WP_101618052.1\|164295_164622_-	hypothetical protein	NA	NA	NA	NA
WP_101618050.1\|164621_165005_-	hypothetical protein	NA	NA	NA	NA
WP_101618048.1\|165689_165953_+	hypothetical protein	NA	NA	NA	NA
WP_101618046.1\|165980_166325_+	hypothetical protein	NA	NA	NA	NA
WP_101618044.1\|166401_166986_+	hypothetical protein	NA	NA	NA	NA
WP_101618042.1\|167272_167575_+	hypothetical protein	NA	NA	NA	NA
WP_101618059.1\|167940_168753_+	chromosome partitioning protein ParA	Q8JL10	Natrialba_phage	1.9e-15	30.4
WP_101618040.1\|168759_169047_+	hypothetical protein	NA	NA	NA	NA
WP_101618038.1\|169962_170367_-\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	53.6
WP_107979029.1\|170424_171651_+\|transposase	transposase	O80301	Enterobacteria_phage	5.0e-153	78.3
WP_101617939.1\|171865_172381_-	hypothetical protein	NA	NA	NA	NA
WP_101617941.1\|172787_174197_-	hypothetical protein	NA	NA	NA	NA
WP_101617943.1\|175057_175390_+	hypothetical protein	NA	NA	NA	NA
WP_101617945.1\|175965_176349_+	hypothetical protein	NA	NA	NA	NA
WP_101617946.1\|176376_177786_-\|transposase	transposase	I4AZI9	Saccharomonospora_phage	8.9e-29	29.2
WP_088212901.1\|177785_178088_-	hypothetical protein	NA	NA	NA	NA
WP_101617948.1\|178166_178631_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.3e-34	51.5
WP_101617950.1\|178787_179441_+	hypothetical protein	NA	NA	NA	NA
WP_101617952.1\|179452_180019_+	single-stranded DNA-binding protein	A0A2I7R8Y7	Vibrio_phage	4.2e-46	70.7
WP_101617954.1\|180072_180414_+	hypothetical protein	A0A2I7R6Q9	Vibrio_phage	3.3e-06	40.2
WP_101617956.1\|180559_181195_+	SAM-dependent DNA methyltransferase	NA	NA	NA	NA
WP_101617958.1\|181578_181944_+	hypothetical protein	NA	NA	NA	NA
WP_010674034.1\|182161_182566_-\|transposase	IS200/IS605-like element ISAs26 family transposase	I4AZM1	Saccharomonospora_phage	1.1e-32	54.4
WP_021141234.1\|182623_183850_+	hypothetical protein	O80301	Enterobacteria_phage	7.7e-154	78.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028565

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028568

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP028567

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection