CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP027064	Klebsiella variicola strain WCHKV030666 chromosome, complete genome	3 crisprs	csa3,cas3,DEDDh,DinG,cas3HD,WYL	0	1	9	0
NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	1 crisprs	DEDDh	0	12	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027064_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027064_1

3996511-3996619

Orphan

Consensus_repeat	Method
AGGGAGAGGGAGCACACCCTAAAAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027064_1

>merge|NZ_CP027064|1|3996511-3996619|CRISPRCasFinder
AGGGAGAGGGAGCACACCCTAAAAAAGGCCATTGTCATTGCCTTTTTGCGTTTACCTTGCCCTCACCCCAACCCTCTCCCACAGGGAGAGGGAGCAAACCCTAAAAAAG

>NZ_CP027064|1|1|3996511-3996619|CRISPRCasFinder
AGGGAGAGGGAGCACACCCTAAAAAAG	GCCATTGTCATTGCCTTTTTGCGTTTACCTTGCCCTCACCCCAACCCTCTCCCAC
AGGGAGAGGGAGCAAACCCTAAAAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027064.2\|WP_023287364.1\|3990510_3991320_+\|inositol-monophosphatase	unknown	unknown	gnl\|CDD\|223559
NZ_CP027064.2\|WP_002894035.1\|3999201_4000200_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP027064.2\|WP_016160472.1\|3995273_3996473_+\|S-methyl-5-thioribose-kinase	unknown	unknown	gnl\|CDD\|236561
NZ_CP027064.2\|WP_008805601.1\|3991430_3992789_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340870
NZ_CP027064.2\|WP_008805595.1\|4000196_4001699_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP027064.2\|WP_032734954.1\|4001862_4002951_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|182570
NZ_CP027064.2\|WP_101837264.1\|3998116_3999181_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP027064.2\|WP_022065143.1\|3996771_3998013_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227601
NZ_CP027064.2\|WP_023339778.1\|3985563_3986826_+\|cytosine-permease	unknown	unknown	gnl\|CDD\|236821
NZ_CP027064.2\|WP_050887523.1\|3984503_3985112_-\|methylthioribulose-1-phosphate-dehydratase	unknown	unknown	gnl\|CDD\|236415
NZ_CP027064.2\|WP_008805603.1\|3989405_3990389_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380501
NZ_CP027064.2\|WP_008805600.1\|3992814_3994083_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366031
NZ_CP027064.2\|WP_012542475.1\|3986822_3988058_+\|PucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377939
NZ_CP027064.2\|WP_023322216.1\|3994143_3995172_-\|S-methyl-5-thioribose-1-phosphate-isomerase	unknown	unknown	gnl\|CDD\|273112
NZ_CP027064.2\|WP_008805590.1\|4004903_4007009_-\|carbon-starvation-protein-CstA	unknown	unknown	gnl\|CDD\|184976
NZ_CP027064.2\|WP_008805604.1\|3988054_3989293_+\|cytosine-deaminase	unknown	unknown	gnl\|CDD\|181713
NZ_CP027064.2\|WP_086892982.1\|4004212_4004617_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP027064.2\|WP_022065145.1\|4003935_4004238_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
NZ_CP027064.2\|WP_012968723.1\|4003008_4003752_+\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235500
NZ_CP027064.2\|WP_002893903.1\|4004613_4004811_-\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|225434

Protein	Function_ID	Function_description	E-value
NZ_CP027064.2\|WP_023287364.1\|3990510_3991320_+\|inositol-monophosphatase	gnl\|CDD\|223559	COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism].	5.05569e-72
NZ_CP027064.2\|WP_002894035.1\|3999201_4000200_-\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	1.16774e-68
NZ_CP027064.2\|WP_016160472.1\|3995273_3996473_+\|S-methyl-5-thioribose-kinase	gnl\|CDD\|236561	PRK09550, mtnK, methylthioribose kinase; Reviewed.	0
NZ_CP027064.2\|WP_008805601.1\|3991430_3992789_+\|MFS-transporter	gnl\|CDD\|340870	cd17312, MFS_OPA_SLC37, Organophosphate:Pi antiporter/Solute Carrier family 37 of the Major Facilitator Superfamily of transporters. Organophosphate:Pi antiporters (OPA) are integral membrane proteins responsible for the transport of specific organophosphates or sugar phosphates across biological membranes with the simultaneous translocation of inorganic phosphate into the opposite direction. The OPA family is also called solute carrier family 37 (SLC37) in vertebrates. Members include glucose-6-phosphate (Glc6P) transporter (also called translocase or exchanger), glycerol-3-phosphate permease, 2-phosphonopropionate transporter, phosphoglycerate transporter, as well as membrane sensor protein UhpC from Escherichia coli. UhpC is both a sensor and a transport protein; it recognizes external Glc6P and induces transport by UhpT, and it can also transport Glc6P. Vertebrates contain four SLC37 or sugar-phosphate exchange (SPX) proteins: SLC37A1 (SPX1), SLC37A2 (SPX2), SLC37A3 (SPX3), and SLC37AA4 (SPX4). The OPA/SLC37 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.48585e-128
NZ_CP027064.2\|WP_008805595.1\|4000196_4001699_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP027064.2\|WP_032734954.1\|4001862_4002951_+\|oxidoreductase	gnl\|CDD\|182570	PRK10586, PRK10586, putative oxidoreductase; Provisional.	0
NZ_CP027064.2\|WP_101837264.1\|3998116_3999181_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	3.13592e-122
NZ_CP027064.2\|WP_022065143.1\|3996771_3998013_-\|hypothetical-protein	gnl\|CDD\|227601	COG5276, COG5276, Uncharacterized conserved protein [Function unknown].	5.2802e-149
NZ_CP027064.2\|WP_023339778.1\|3985563_3986826_+\|cytosine-permease	gnl\|CDD\|236821	PRK11017, codB, cytosine permease; Provisional.	0
NZ_CP027064.2\|WP_050887523.1\|3984503_3985112_-\|methylthioribulose-1-phosphate-dehydratase	gnl\|CDD\|236415	PRK09220, PRK09220, methylthioribulose 1-phosphate dehydratase.	6.59552e-138
NZ_CP027064.2\|WP_008805603.1\|3989405_3990389_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380501	cd06278, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	4.29827e-95
NZ_CP027064.2\|WP_008805600.1\|3992814_3994083_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366031	pfam00328, His_Phos_2, Histidine phosphatase superfamily (branch 2). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches.The smaller branch 2 contains predominantly eukaryotic proteins. The catalytic functions in members include phytase, glucose-1-phosphatase and multiple inositol polyphosphate phosphatase. The in vivo roles of the mammalian acid phosphatases in branch 2 are not fully understood, although activity against lysophosphatidic acid and tyrosine-phosphorylated proteins has been demonstrated.	3.61435e-59
NZ_CP027064.2\|WP_012542475.1\|3986822_3988058_+\|PucR-family-transcriptional-regulator	gnl\|CDD\|377939	pfam07905, PucR, Purine catabolism regulatory protein-like family. The bacterial proteins found in this family are similar to the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR). PucR is thought to be a transcriptional activator involved in the induction of the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression. The other members of this family are also annotated as being putative regulatory proteins.	1.78324e-33
NZ_CP027064.2\|WP_023322216.1\|3994143_3995172_-\|S-methyl-5-thioribose-1-phosphate-isomerase	gnl\|CDD\|273112	TIGR00512, methylthioribose-1-phosphate_isomerase_predicted, S-methyl-5-thioribose-1-phosphate isomerase. The delineation of this family was based in part on a discussion and neighbor-joining phylogenetic study, by Kyrpides and Woese, of archaeal and other proteins homologous to the alpha, beta, and delta subunits of eukaryotic initiation factor 2B (eIF-2B), a five-subunit molecule that catalyzes GTP recycling for eIF-2. This clade is now recognized to include the methionine salvage pathway enzyme MtnA. [Amino acid biosynthesis, Aspartate family].	3.06749e-150
NZ_CP027064.2\|WP_008805590.1\|4004903_4007009_-\|carbon-starvation-protein-CstA	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0
NZ_CP027064.2\|WP_008805604.1\|3988054_3989293_+\|cytosine-deaminase	gnl\|CDD\|181713	PRK09230, PRK09230, cytosine deaminase; Provisional.	0
NZ_CP027064.2\|WP_086892982.1\|4004212_4004617_+\|transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.74755e-10
NZ_CP027064.2\|WP_022065145.1\|4003935_4004238_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	9.18558e-09
NZ_CP027064.2\|WP_012968723.1\|4003008_4003752_+\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	1.08671e-86
NZ_CP027064.2\|WP_002893903.1\|4004613_4004811_-\|YbdD/YjiX-family-protein	gnl\|CDD\|225434	COG2879, COG2879, Uncharacterized small protein [Function unknown].	1.33159e-37

>NZ_CP027064.2|WP_016160472.1|3995273_3996473_+|S-methyl-5-thioribose-kinase
MSQYHTFTAHDAVAYAQQFAGIDNPSELVSAQEVGDGNLNLVFKVFDRQGVSRAIVKQALPYVRCVGESWPLTLDRARLEAQTLVAHYQHSPQHTVKIHHFDPELAVMVMEDLSDHRIWRGELIANVYYPQAARQLGDYLAQVLFHTSDFYLHPHEKKAQVAQFSNPAMCEITEDLFFNDPYQIHERNNYPAELEADVAVLRDDAQLKLAVAALKHRFFAHAEALLHGDIHSGSIFVAEGSLKAIDAEFGYFGPIGFDIGTAIGNLLLNYCGLPGQLGIRDAAAAREQRLNDIHQLWTTFAERFQALAAEKTRDAALAYPGYASAFLKKVWADAVGFCGSELIRRSVGLSHVADIDTIQDDAMRHECLRHAITLGKALIVLAERIDSVDELLARVRQYS
>NZ_CP027064.2|WP_023322216.1|3994143_3995172_-|S-methyl-5-thioribose-1-phosphate-isomerase
MQTLQTTSLRVSENQLFILDQQALPQEKRWLAADNVALLVDHIHALRVRGAPLIGLSASLLLALLAQRGLNRDALQQALETLRAARPTAVNLMNNLDRMKQALAREDYPQALEAEALRLVEEDKQLCDRIAEAGSALVKPGSRLLTHCNTGGLATAGVGTALGVIALAHRQGKVASVWVDETRPLLQGGRLTAWELGELGVPYQLITDSMAASLMAQGQVDAVWVGADRIAANGDVANKIGTYSLAVLAHYHQIPFYVAAPQTTLDRHCPNGAAIPIEQRAAAEVTGVAGSFGAVQWAPTGAAVYNPAFDVTPAGLVSGWVLDSGVVTPAQVAAGAFAPDNG
>NZ_CP027064.2|WP_008805600.1|3992814_3994083_+|histidine-phosphatase-family-protein
MMPARHQGLLRLFIACALPLLALQSAAAADWQLEKVVELSRHGIRPPTAGNREAIEAATGRPWTEWTTHDGELTGHGYAAVVNKGREEGQHYRQLGLLQAGCPTAESIYVRASPLQRTRATAQALVDGAFPGCGVAIHYVSGDADPLFQTDKFAATQTDPARQLAAVKEKAGDLAQRRQALAPAIQLLQQAVCQADKPCPIFDTPWQVEQSKSGKTTISGLSVMANMVETLRLGWSENLPLSQLAWGKITQARQITALLPLLTENYDLSNDVLYTAQKRGSVLLNAMLDGVKPEANPNVRWLLLVAHDTNIAMVRTLMNFSWQLPGYSRGNIPPGSSLVLERWRNAKSGERYLRVYFQAQGLDDLRRLQTPDAQHPMLRQEWRQPGCRQTDVGTLCPFQAAITALGQRIDRSSAPAVAMVLP
>NZ_CP027064.2|WP_008805601.1|3991430_3992789_+|MFS-transporter
MSGIIAFFRASPPKAGAAFDEQRFRRVRWQTFIAMTLAYVTFYVCRLSFTVAKSALVDLGITPTELGMIGSTLFFSYAIGKLVNGFIADHANVVRYMSLGLLLSAGMNLMMGMTTNALLLAIFWGINGWAQSMGVGPCAVSLARWYGVKERGTFYGIWSTAHNIGEAVTYMVIAAVIAGFGWQMGYLSTAALGAAGVVLLVLFMHDSPQSSGFPSINVIRDEPQEEAEARGSVFKNQLLALRNPALWTLALASAFMYIDRYAVNSWGIFFLEQDKAYSTLEASGIIGVNAIAGIAGTIIAGMLSDRFFPRNRSVMAGFISLLNTAGFALMLWSPHNYYTDILAMIIFGATIGALTCFLGGLIAVDISSRKAAGAALGTIGIASYAGAGLGEFLTGIIIDKTAILENGKTLYDFSTLALFWVGTGLGSALLCFTTAAIVARRHAVERQTSFSS
>NZ_CP027064.2|WP_023287364.1|3990510_3991320_+|inositol-monophosphatase
MQSQESEALQARYRLACELAKAGAELAFEYYQQREALTVDHKGDDLQDVVSVADKRVEAFVKQRIQSAFPQDGFLGEESGTRLPDARILWVVDPIDGTSCFLNGLHTWCLSLAIVADGEPVIGVVYDPNHRELFHALRGHGAWLNDAPIRPHPATTVKEGVMGVGTSHRVTPADFLPFLQALLSDGGMFIRNGSGALMSAWAAAGRLIGYYEPHMNPWDALPGLVLMREAGGASNDFLAQEGIQRGNPLLLASQTLYPQLKKMIPQPLH
>NZ_CP027064.2|WP_008805603.1|3989405_3990389_+|LacI-family-DNA-binding-transcriptional-regulator
MSDKKWIKAEDVARLAGVSRSAVSRTFTPGASVSEKTRQKVLSAAEALGYQVNIIARTMITGSSNFIGIVTAGFDNPFRSKLLAPLVHQLALNGFMPLLMNADDPQQLAPSLKQLLSYHVAGVIITSGAPPLSLAEEYLARKIPVTLINRHADLAGCDRVCSDNAQGAKLVADLFSRRGWQQVGFIGENRENFSTRQRYEAFIARTSGMAVSSRFCDGGGYQAGYQAARELVAENPGVQALFCATDMLALGALDGLRDAPAPLPAIVGFDDIPQADWQPYQLTTVQQNTALLAHHAVDLLMTRIARFSLPSRHREVPVKLIIRHSAK
>NZ_CP027064.2|WP_008805604.1|3988054_3989293_+|cytosine-deaminase
MKIINARLRRQEALFTLDLQDGMIHRISAQAAMQSADAGDIDAQGRLAIPPFVEPHIHLDATLTAGEPEWNRSGTLFEGITRWSQRKASITPEDTRQRALKTIGMLRDFGVQHVRTHVDVTDPSLAALKALLAVKQEAADLIDLQIVAFPQEGIESYPDGRGLMTRAIEMGADVVGGIPHYENTRDKGVSSVMFLMDLAQRYGRLVDVHCDEIDDPQSRFLEVLAEEARVRGMGAQVTASHTCAMGSYDNAYCSKLFRLLKASGINFISCPTESIHLQGRFDSWPKRRGVTRVAELDRAGINVCFAQDSIQDPWYPLGNGNILRILDAGLHICHMLGYDDLQRCLDFVTDNSARALCLGDNYGLAEGRPANLLILDAENDYEAVRRQARVLTSIRHGKVILQREVEHIRYPA
>NZ_CP027064.2|WP_012542475.1|3986822_3988058_+|PucR-family-transcriptional-regulator
MSLTVSELLALEGLSALRLRAGKQGLQRAVRWYYVAENEHIAEWIMGGELVFITGINHPRDEANLIQLLMEGKQRGIAGMVILTGEAYIHAIPATLIALADELGIPLIEQPYLLKMVIVTERIGTALVRSENALQSQRDILMQLVTGDYPDLQMLHQRALHQQLDFTRPLRLAALRLEGLSRLFRQFPPEQAEAWLLQAHRSVRQQLQQQLNQQGNPFPLLERSNMFLFLLPDEEGEGFQQKKWLQQWLQALADGEEGLSLLCGLSAPVRQLQGYPRALSQARQALDLCDTLRPTQRISDYQQLGFIKLLSAVSDPALLNDFMHDTLGCLIEPGRKAPWLLLETLETLLQENGNVVRAADRLGLHRNTLHQRIQRIEKLTGYPVSHPQFHLNASVALVIWRLSQNHLQDPP
>NZ_CP027064.2|WP_023339778.1|3985563_3986826_+|cytosine-permease
MSNSNDFPLVEAPAAGRKGVFSIAMVLFSFTFFTGTMFAGGKLGVSFSIVNLLWIAVIGNALLALYAASLGWIAARSGLNTVLMGRFCFGEIGSKLADFILGFAELGWYAWGTATVAISLVKILALPEALTQPLMVLFGILFCVTALVGYKGLDALSRLSVPLMFVLLMVSMYLALHHAGGWQAMTHIAPSDTMTWSAAITMVFGTFASGATQATNWTRLANSSRTAILASMGSFLIGNGLMIVAGAWCAIVYQQADIVEVLILQGLSVAAVIMLCLNLLTIQGPTIYNVSAAACHLLRSERRRTLTIAAAGVGIVLAIGGMYEMLIPFLVLLGSIIPPIGGVILADYWFARGGRYPLLQNARLPRFNWLGLGAYAAGAVVAYLSPWIAPLVGITVSALVYIVLSLLSKRQPAAVAEQEP
>NZ_CP027064.2|WP_050887523.1|3984503_3985112_-|methylthioribulose-1-phosphate-dehydratase
MWQERLAQLVTTCHWIGAKGWAPATGGNMSVRQDDTWCWLSESGRDKGSLTTEDFLQVEIATNQAPSGRKPSAETGLHTLVYRLFPESNVVLHVHTVNATVLSRIEKSDTLALQGYEMQKTLSGQHSHLDTVPVAIFDNDQDIDALAARIADYAQTRPLRYGFLLRGHGLTCWGKDIQEARRQLEGLEFLFECELMRRRYEP
>NZ_CP027064.2|WP_022065143.1|3996771_3998013_-|hypothetical-protein
MSALPSPEYSRNMRLIGHSDQGGRPDGVQLMVHRGFAYIGHMVSQGFSVVDVRDPTRPTTVNYIAAPPGTWNVHLQAHDDLLLVINARDLFADARFADEKVYYTRSVGDTVSDVQDKGWSAGLRIFDISTPAQPREISFLSLNGIGIHRIWYVGGRWAYVSALIDGFTDYIFLTIDLADPRKPEVAGRWWLPGMHQAGGETPDWPQGKRYALHHAIIAGDTAYGSWRDGGLTLLDVKDRTQPTLISHRNWSPPFGGGTHTALPLPDRDLLVVLDEAVLDNQEDGEKLIWLFDIREPANPVSISTFPQPDEIDYVAKGAHFGPHNLHENRPGSFVSSTLIFATYQNAGVRAYDISNPYRPLETGALVPAAPKTMMDTRPGRPQVIQSCDVFVDAQGIIYSTDYNGGLSVIEYLG
>NZ_CP027064.2|WP_101837264.1|3998116_3999181_-|sugar-ABC-transporter-substrate-binding-protein
MKKIAFSLMTLGLLQSTAALATAPTPVPAAIAEHSGPIRIAVIRNLGSDDNTTQFVSGALQEGKKLGFKISTFLSNGDDAKFQDFVNQAISQKYDGIILSQGRDPYSTALVKKAVDAGIKVAVFDTAVSGEIPGVTVSQQDDASLTELSFGQLVKDFNGKANIVKLWVAGFPPMERRQAAYQTLLKQNPGIKELESIGAVSSDVQGDTANKVGAILAKYPKGKIDAIWGTWDAFSQGAYKALKENGRTEIKLYSIDISNQDLQLMREAGSPWKVSVAVDPKLIGATNVRLIANKIAGEPTPATYDFKAAAIPQALLAAQPGAVNVASLGKIIPGWGQTEDFIAPWFATLEAKNK
>NZ_CP027064.2|WP_002894035.1|3999201_4000200_-|ABC-transporter-permease
MSKALAVNATVSGRQRFFDFLYKWGMLLTVVLLVAVFGLASDNFLDPFNIINILRSIAIVTVIAIGVSISLTIGGFDLSVGSTASLANALVISLFVWHGLGTTEAILITLALCTLVGLFNAFLIVVLRIPDMLATLASLFVIQGVAMTYSYGGSITENMVLPSGEMAEGTIPAAFGALGQVPTIVIIMLVVTLVAQLALSFTTHGRRMYAIGGNPEAARLSGLRITRYKVAAYVIASLLAGLGGILLASRIGSSQVNAGGGYLMDAVAAAWIGFSLAGSGKPNALGTLVGAVILGVLSNGLVMLSVPYYAMDIIKGLVLAGALALTYFQRRT
>NZ_CP027064.2|WP_008805595.1|4000196_4001699_-|sugar-ABC-transporter-ATP-binding-protein
MSANRLEMHNISLAFSGFQALNKVDFTLHGGSVHALTGANGAGKSTLMAVLCGTHAHYEGEVTINNQPVTIRSPRDAKQLGIHLVQQEVDVALVPGLSIAENIMLDRLAEPGMAFRWSRVRQLAREALAQLDVALDVRRSIDSCTLAEKQQILLARALSHHCRFLILDEPTAPLDQHESERLFAVVRRLQQQGIGVVFISHRIHELKAICDTLTVLRDGRLIESGPMAPLSGEQIVEKMLGHELSDIFPPPRPPHGEEVLLQIDGLHDEALLQDISLRLRKGEILGIAGLAGAGKTELCKALFGASKSRVQRGELNGQPWRPRDPADSVGRGLALVPEERRKEGIFIEEPIAMNLAVSADNSFSRWSLFGHRQAWRWAEEVIARLGVRATGPGQMLRRLSGGNQQKVAIGKWLRSHANVLIFDEPTKGVDVKAKTDLFMLIDGLAREGKGVIYASGEFAELVGLCDRICVLWDGRIVAEIPGAEAREETLLYYSTGGAAA
>NZ_CP027064.2|WP_032734954.1|4001862_4002951_+|oxidoreductase
MSNSDIRVVPGPANYFSHPGSLERLSDFFSADQLSRAVWVYGERALAGAEPFLPAAFYLPEAKKIRFPGHCSERDVAALVQASGDDRAVVIGVGGGALLDSAKVLARRLGVPLVAIPTIAATCAAWTPLSVWYSDAGQALNFEIFDDANFLVLVEPRIILNAPAEYLLAGIGDTLAKWYEAVVLAPQPEALPLTVRLGINGALAIRDVLLASSETALADQSRGDLTQAFRDVVEAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTDKFLHGTKVAYGILVQSALLAQDDVLAQLVQAYQRFNLPTTLAALEVDINNRTELDRVIAHTLRPGESIHYLPVTLTPEVLRAAFEKVEYFSR
>NZ_CP027064.2|WP_012968723.1|4003008_4003752_+|3-oxoacyl-ACP-reductase-FabG
MQIDLTGKKALVTGASRGLGRAIALSLARAGADVVITYEKSADKAQAVADEIKALGRHGEAVQADSASAQAIQDAVTHAARSLGGLDILVNNAGIARGGPLESMTLADIDALINVNIRGVVIATQEALVHMADGGRIINIGSCLANRVAMPGIAVYAMTKSALNALTRGLARDLGPRGITVNLVHPGPTNSDMNPEDGEQAEAQRQMIAVGHYGQPEDIAAAVTFLASPAAGQISGTGLDVDGGLNA
>NZ_CP027064.2|WP_022065145.1|4003935_4004238_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKIVWSKTADKPFSKIDNRYKSRIKSRLEKMDDKASPISDIKKLSSPENHYRLRLGDYRVIYTFGDPPGDTCYVVAVKRRTTTTYLHEEDTEYDYSVHQG
>NZ_CP027064.2|WP_086892982.1|4004212_4004617_+|transcriptional-regulator
MTIQYIKDEEGKDQYVVIPYSDYFRMRLALLEYDDEDESNWEDIPYESDIYDNVMLPGEVCDVMHKENVSLQAAWRILRGLSQQEVAAKLGISQSAVSQLEALDSRPQKRTREKLAAIYGCTQEQISLYLPKEG
>NZ_CP027064.2|WP_002893903.1|4004613_4004811_-|YbdD/YjiX-family-protein
MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTYEEFFRERQDARYGGKGGAKCC
>NZ_CP027064.2|WP_008805590.1|4004903_4007009_-|carbon-starvation-protein-CstA
MNNSGKYLIWTLLSVIGAFALGYIALNRGEQINALWIVVAAVCVYLIAYRFYGLYIAKTVLGVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGMIWILAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVLALVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYIRYLRPGRIGEVSVIGLVMLVFAIISGGWVAESPTWAPWFDYTGVQLTWILVGYGFVAAVLPVWLLLAPRDYLSTFLKIGTIVGLAIGILIMRPTLTMPALTKFVDGTGPVWSGNLFPFLFITIACGAVSGFHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVAACIIDPGVYFAMNSPMAVLAPAGTTDVVASAAQVVSGWGFSITPDTLHQIASEVGEQSIISRAGGAPTLAVGMAYILHGSLGGLMDVSFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVISPGLKKTSSLPANLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQRYAWVALLPTSWLLICTLTAGWQKSFSPDTKVGFLAIANKFQAMIDSGNIPPQYTESQLAQLVFNNRLDAGLTIFFMIVVVVLALFSIKTALAALKEDKPTAKETPYQAMPADAQTITAQAKRAH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP027064_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027064_2

4460151-4460288

Orphan

Consensus_repeat	Method
TGCCGGGTGGCGGCTGCGCCTGACCCGGCCTACAAAACCGAAGCAGCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027064_2

>merge|NZ_CP027064|2|4460151-4460288|CRISPRCasFinder
TGCCGGGTGGCGGCTGCGCCTGACCCGGCCTACAAAACCGAAGCAGCAGACCCGGCAAGCGCAGCGCCACCGGGCACGGAGCCGCTTTATGCCGGGTGGCGGCTGCGCCTGACCCGGCCTACAAAACTGAAGCAGCAG

>NZ_CP027064|2|2|4460151-4460288|CRISPRCasFinder
TGCCGGGTGGCGGCTGCGCCTGACCCGGCCTACAAAACCGAAGCAGCAG	ACCCGGCAAGCGCAGCGCCACCGGGCACGGAGCCGCTTTA
TGCCGGGTGGCGGCTGCGCCTGACCCGGCCTACAAAACTGAAGCAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027064.2\|WP_002889733.1\|4455347_4455806_-\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236395
NZ_CP027064.2\|WP_008805263.1\|4466787_4467528_+\|murein-L,D-transpeptidase	unknown	unknown	gnl\|CDD\|225577
NZ_CP027064.2\|WP_046620372.1\|4463790_4465029_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	unknown	unknown	gnl\|CDD\|235425
NZ_CP027064.2\|WP_032734852.1\|4459234_4460095_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176522
NZ_CP027064.2\|WP_008805262.1\|4467498_4468266_-\|class-II-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|372525
NZ_CP027064.2\|WP_086892933.1\|4460533_4461757_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	unknown	unknown	gnl\|CDD\|235481
NZ_CP027064.2\|WP_012968886.1\|4465032_4466376_-\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	unknown	unknown	gnl\|CDD\|235426
NZ_CP027064.2\|WP_016160342.1\|4449894_4451178_+\|4-aminobutyrate--2-oxoglutarate-transaminase	unknown	unknown	gnl\|CDD\|236149
NZ_CP027064.2\|WP_012542786.1\|4453997_4455242_-\|esterase-FrsA	unknown	unknown	gnl\|CDD\|235337
NZ_CP027064.2\|WP_008805261.1\|4468340_4468922_-\|D-sedoheptulose-7-phosphate-isomerase	unknown	unknown	gnl\|CDD\|179012
NZ_CP027064.2\|WP_046620375.1\|4463003_4463798_-\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	unknown	unknown	gnl\|CDD\|235423
NZ_CP027064.2\|WP_008805269.1\|4458018_4459074_-\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|235035
NZ_CP027064.2\|WP_002889793.1\|4453541_4453940_-\|sigma-factor-binding-protein-Crl	unknown	unknown	gnl\|CDD\|182882
NZ_CP027064.2\|WP_012968882.1\|4456063_4457521_+\|cytosol-nonspecific-dipeptidase	unknown	unknown	gnl\|CDD\|184986
NZ_CP027064.2\|WP_002889716.1\|4462372_4463011_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	unknown	unknown	gnl\|CDD\|236457
NZ_CP027064.2\|WP_046620380.1\|4452759_4453452_+\|DNA-binding-transcriptional-regulator-CsiR	unknown	unknown	gnl\|CDD\|183181
NZ_CP027064.2\|WP_004204638.1\|4460315_4460531_-\|(Na+)-NQR-maturation-NqrM	unknown	unknown	gnl\|CDD\|225538
NZ_CP027064.2\|WP_012542788.1\|4457563_4458016_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|182099
NZ_CP027064.2\|WP_002889795.1\|4451313_4452714_+\|GABA-permease	unknown	unknown	gnl\|CDD\|182297
NZ_CP027064.2\|WP_004177335.1\|4461769_4462366_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	unknown	unknown	gnl\|CDD\|235074

Protein	Function_ID	Function_description	E-value
NZ_CP027064.2\|WP_002889733.1\|4455347_4455806_-\|xanthine-phosphoribosyltransferase	gnl\|CDD\|236395	PRK09177, PRK09177, xanthine-guanine phosphoribosyltransferase; Validated.	2.19173e-113
NZ_CP027064.2\|WP_008805263.1\|4466787_4467528_+\|murein-L,D-transpeptidase	gnl\|CDD\|225577	COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown].	1.11512e-109
NZ_CP027064.2\|WP_046620372.1\|4463790_4465029_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	gnl\|CDD\|235425	PRK05349, PRK05349, Na(+)-translocating NADH-quinone reductase subunit B; Provisional.	0
NZ_CP027064.2\|WP_032734852.1\|4459234_4460095_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176522	cd08580, GDPD_Rv2277c_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial protein Rv2277c and similar proteins. Members in this subfamily are bacterial homologous of mammalian GDE4, a transmembrane protein whose cellular function has not yet been elucidated.	1.51689e-127
NZ_CP027064.2\|WP_008805262.1\|4467498_4468266_-\|class-II-glutamine-amidotransferase	gnl\|CDD\|372525	pfam13230, GATase_4, Glutamine amidotransferases class-II. This family captures members that are not found in pfam00310.	5.55311e-144
NZ_CP027064.2\|WP_086892933.1\|4460533_4461757_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	gnl\|CDD\|235481	PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional.	0
NZ_CP027064.2\|WP_012968886.1\|4465032_4466376_-\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	gnl\|CDD\|235426	PRK05352, PRK05352, Na(+)-translocating NADH-quinone reductase subunit A; Provisional.	0
NZ_CP027064.2\|WP_016160342.1\|4449894_4451178_+\|4-aminobutyrate--2-oxoglutarate-transaminase	gnl\|CDD\|236149	PRK08088, PRK08088, 4-aminobutyrate--2-oxoglutarate transaminase.	0
NZ_CP027064.2\|WP_012542786.1\|4453997_4455242_-\|esterase-FrsA	gnl\|CDD\|235337	PRK05077, frsA, esterase FrsA.	0
NZ_CP027064.2\|WP_008805261.1\|4468340_4468922_-\|D-sedoheptulose-7-phosphate-isomerase	gnl\|CDD\|179012	PRK00414, gmhA, D-sedoheptulose 7-phosphate isomerase.	3.16987e-148
NZ_CP027064.2\|WP_046620375.1\|4463003_4463798_-\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	gnl\|CDD\|235423	PRK05346, PRK05346, Na(+)-translocating NADH-quinone reductase subunit C; Provisional.	7.92377e-155
NZ_CP027064.2\|WP_008805269.1\|4458018_4459074_-\|DNA-polymerase-IV	gnl\|CDD\|235035	PRK02406, PRK02406, DNA polymerase IV; Validated.	0
NZ_CP027064.2\|WP_002889793.1\|4453541_4453940_-\|sigma-factor-binding-protein-Crl	gnl\|CDD\|182882	PRK10984, PRK10984, sigma factor-binding protein Crl.	2.69204e-83
NZ_CP027064.2\|WP_012968882.1\|4456063_4457521_+\|cytosol-nonspecific-dipeptidase	gnl\|CDD\|184986	PRK15026, PRK15026, aminoacyl-histidine dipeptidase; Provisional.	0
NZ_CP027064.2\|WP_002889716.1\|4462372_4463011_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	gnl\|CDD\|236457	PRK09292, PRK09292, Na(+)-translocating NADH-quinone reductase subunit D; Validated.	1.0782e-142
NZ_CP027064.2\|WP_046620380.1\|4452759_4453452_+\|DNA-binding-transcriptional-regulator-CsiR	gnl\|CDD\|183181	PRK11534, PRK11534, DNA-binding transcriptional regulator CsiR; Provisional.	3.15737e-150
NZ_CP027064.2\|WP_004204638.1\|4460315_4460531_-\|(Na+)-NQR-maturation-NqrM	gnl\|CDD\|225538	COG2991, COG2991, Uncharacterized protein conserved in bacteria [Function unknown].	1.19399e-28
NZ_CP027064.2\|WP_012542788.1\|4457563_4458016_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|182099	PRK09831, PRK09831, GNAT family N-acetyltransferase.	2.6206e-89
NZ_CP027064.2\|WP_002889795.1\|4451313_4452714_+\|GABA-permease	gnl\|CDD\|182297	PRK10197, PRK10197, GABA permease.	0
NZ_CP027064.2\|WP_004177335.1\|4461769_4462366_-\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	gnl\|CDD\|235074	PRK02830, PRK02830, Na(+)-translocating NADH-quinone reductase subunit E; Provisional.	4.25239e-127

>NZ_CP027064.2|WP_032734852.1|4459234_4460095_+|glycerophosphodiester-phosphodiesterase
MKKRLTALCLLATSSALANPQLIAHRGGTGDAPENTLPAIKLALENHAEAIWVTVQLSRDGVPVLYRSSDLSALTNAEGKVSSLTAAELAKVDAGWKWGDDSHPWRGKQATIPTLQSVLQQWPHTFFYIDIKSPDAEPAVMGERLLAVLKATDSLDRVRVYSTDDRYIAALPSAIPRFVTRSETRTKLATISLSHQCQLSSQHEGEQWYGLELKRKVEVVEKFTLGEGISPATLTWDKEAMDCFRSQGKAHIIFFGINSAEDYRTAKELGADGVMVDSPAQAKSWQ
>NZ_CP027064.2|WP_008805269.1|4458018_4459074_-|DNA-polymerase-IV
MRKIIHVDMDCFFAAVEMRDNPALRDIPLAIGGSRVQRGVISTANYPARKFGVRSAMPTATALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVSDSVHCHGSATLIAQEIRQTIERELHLTASAGVAPVKFLAKIASDMNKPNGQFVIAPHQVAEFVRALPLAKIPGVGKVSAAKLENMGLRTCGDVQNSDLAMLLKRFGKFGRILWERSHGIDEREIHNDRQRKSVGVERTLAEDIHEWSACEAIIENLYPELERRLAKVKPDLLIARQGIKLKFNDFQLTTQEHVWPRLNKEDLIATAHKAWDERRGGRGVRLVGLHVTLLDPQLERQLLLGI
>NZ_CP027064.2|WP_012542788.1|4457563_4458016_-|GNAT-family-N-acetyltransferase
MHIRAYRDSDLPLLCQIFLRAVQETASRDYTPAQIAAWAQVDETRWRQKLADSVGRVAVVNNQPVGFITAIGTHIDLLFVSPDHARQGIGGALIEALCAQYPAQILTVDASITAKPCFTAHGFKVVAEQRVAARGEWFINYRMEKRVALR
>NZ_CP027064.2|WP_012968882.1|4456063_4457521_+|cytosol-nonspecific-dipeptidase
MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIMGWAKEKGLHAERDQVGNILIRKGATAGMENRKPVALQAHLDMVPQKNNDTVHDFAKDPIQPYIDGEWVKARGTTLGADNGIGMASALAVLADDSVAHGPLEVLLTMTEEAGMDGAFGLQANWLQADILINTDSEEEGEIYMGCAGGIDFTSNLALTREAIPAGFQSFKVTLKGLKGGHSGGDIHLGLGNANKLLSRFLAGHADELDLRLVDFNGGTLRNAIPREAYATVAVAADKADALKALVNTYQALLKNELEAKEKNLVVLLEAVDNDKAALTQASRDGFIRLLNATPNGVIRNSDVAKGVVETSLNVGVVTMTDDNVQIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHSPDEQVHIESVGQYWTLLTELLKAIPAK
>NZ_CP027064.2|WP_002889733.1|4455347_4455806_-|xanthine-phosphoribosyltransferase
MSEKYVVTWDMLQIHARKLASRLLPVEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIAGR
>NZ_CP027064.2|WP_012542786.1|4453997_4455242_-|esterase-FrsA
MSQANLSETLFKPRFKHPETSTLVRRFSAGKPQAMQSALSGNHVDHWYRLINRLMWIWRGVTPQEILDVQARIVMSEAERTDPELFDTVIGYRGGNWIFEWAKEAMQWQQKAGQEADPLLSGRHWLHASNLYSIAAYPHIKGDELAEQAQALANRAYEEAAQRLPGSLRELEFTIPGGSPITGFLHMPKGDGPFPTVLMCGGLDSLQTDYYNLYENYFSPLGIAMLTIDMPSIGFSSKWTLNQDTSLLHQHALRHLENVPWVDHTRVAAFGFRFGANIAVRLGYLEPQRLKAVACLGPVVHGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELNRYSLKTQGLLGRRCPTPMLSGFWKDDPFSPEEESRLITSSSADGKLLEIPFNPVYRNFDHALRQIARWINHRFG
>NZ_CP027064.2|WP_002889793.1|4453541_4453940_-|sigma-factor-binding-protein-Crl
MTLPSGHLKSKLIKKFTALGPYIREEQCHDNRFFFDCLAVCVNVKPAPEKREFWGWWMEMEAQESRFTYSYQFGLFNKEGSWQAVDIDDPEVSDRLEKTLREFHERAAALLTTFNLKLEPADDFSEPVRLRA
>NZ_CP027064.2|WP_046620380.1|4452759_4453452_+|DNA-binding-transcriptional-regulator-CsiR
MTAIPQATAIDGYRWLKNDIIRGVYQPDEKLRMSLLTSRYELGVGPLREALSQLVAERLVTVVNQKGYRVAPMSEQELLDIFDARANMEAMLVRLAIERGGDEWEAELLARAHLLNKLESCDASERLLDEWDQRHQAFHTAIVAGCGSQYLLQMRERLFDLAARYRFIWLRTTVLSVEMLEDKHVQHQTLLDTILARDAERASALMREHLLTPIPIIQQAMAGKLSPQAG
>NZ_CP027064.2|WP_002889795.1|4451313_4452714_+|GABA-permease
MGQLSQSQDLGAGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVMIMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAIILHSWVPGVPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIVLGAVAITGFYPYAEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNSVIWRISIFYLCSIFIVVALIPWNMPGLKSIGSYRSVLELLHIPYAKLIMDGVILLSVTSCLNSALYTASRMLYSLSRRGDAPAIMGRTNRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVFKFLIDSSGAIALLVYLVIAVSQLRMRKILQAQGGEIRLRMWLYPYLTWLVIAFITFVLVVMLFRPAQQLEVISTGLLALGIICTVPIMSRWKKLVLWQKLPLQNTR
>NZ_CP027064.2|WP_016160342.1|4449894_4451178_+|4-aminobutyrate--2-oxoglutarate-transaminase
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHPQVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSDDEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEEHPEIGDVRGLGAMIAIELFEEGDRSKPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADCFTEAKQA
>NZ_CP027064.2|WP_004204638.1|4460315_4460531_-|(Na+)-NQR-maturation-NqrM
MLTVFVATFVIFALVILGMSLGYLVKRKSIQGSCGGISSLGLEKVCDCPEPCDARKKRLAREAQRQQRRIL
>NZ_CP027064.2|WP_086892933.1|4460533_4461757_-|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F
MEIILGVVMFTLIVLVLSGLILAARSKLVNAGDVVIEINNEADKQIRTPAGDKLLNTLSSNGIFVSSACGGGGSCGQCRVTIKEGGGDILPTELSHITKREAKEGCRLACQVAVKQNMKIELPEEIFGVKKWECEVISNDNKATFIKELKLRVPDGEAVPFRAGGYIQIECPSHKVGYADFDIPDEYRSDWDKFNLFRYVSEVKEPTLRAYSMANYPEEKGIIMLNVRIATPPPKVPDAPPGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMVFIGGGAGMAPMRSHIFDQLKRLHSTRKISFWYGARSLREMFYDDEFEQLARDNPNFTFHVALSDPLPEDNWTGHTGFIHNVLYENYLRDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDENIMLDDFGG
>NZ_CP027064.2|WP_004177335.1|4461769_4462366_-|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E
MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGIREKMKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL
>NZ_CP027064.2|WP_002889716.1|4462372_4463011_-|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D
MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAFVMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMAIIASLVIVVDQLLRAFAYETSKQLSVFVGLIITNCIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGSGKLFGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE
>NZ_CP027064.2|WP_046620375.1|4463003_4463798_-|Na(+)-translocating-NADH-quinone-reductase-subunit-C
MAEKKSNDSIGKTLLVVLVLCLVCSIVVAGSAVGLKSRQQAQRALDKQRNILAVAGLIQPGMDADAVAETFAARISPRLVNLATGELLEKDPAKFNQAQALKDPQQSIALDASQDPAGIKRRSNLAEIYLVRDAQQKIEQMVLPIYGNGLWSMMYAFVALDVDGRTVKGITYYDQGETPGLGGEVENPNWRQQFIGKQVLDDNGMPALRVVKGGARAGDLHAVDGLSGATLTSNGVQHSFDFWMGELGFGPFLKKVREGELNNG
>NZ_CP027064.2|WP_046620372.1|4463790_4465029_-|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B
MGLKHLIEKLEPHFTHGGKLEKYYPLYEAAATIFYTPGQVTRGAAHVRDAIDLKRMMILVWFAVFPAMFWGMYNVGLQTIPALHKLYGAEQLQPVIANNWHYSVAQWLGVSFSADAGWLSMMTLGAVFFLPIYITVFIVGGFWEVLFAIVRKHEINEGFFVTSILFALIVPPTLPLWQAALGISFGVVIAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTAADGFSGATPLSQWASGGGEALVNVATGIPVSWMDAFLGNIPGSIGEVSTLMILIGGAIILFGRVASWRIVAGVMIGMIATATLFNVIGSDTNPMFSMPWYWHLVLGGFAFGMMFMATDPVSASFTDKGKWSYGVLIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDYLVVQANIKRRKSRG
>NZ_CP027064.2|WP_012968886.1|4465032_4466376_-|Na(+)-translocating-NADH-quinone-reductase-subunit-A
MIKITKGLDLPIAGMPLQQISPAPAVKRVALLGEEYVGMRPAMAVKEGDRVKKGQILFEDKKTPGVYFTAPASGVVSAIHRGERRVLQSVVIDIEGNDAVAFTRYAADALAELPRDTVQQQLLASGLWTALRTRPFSKTPRPGSVPAAIFVNAMDTNPLAAEPQPIILAERAAFDAGLTVLTRLTDGKVHVCQPSGGKLGGHPAGQVCFNQFSGPHPAGLPGTHIHFLEPVSLNKQVWHLNYQDAIAIGQLFLEGELNCERVIALGGPQVKSPRLVKTTLGASLDDLLAGELEEGENRVISGSVLSGTRAHGPHAFLGRFHLQVSVVREGREKELFGWVMPGKEKFSITRTTLGHFFKRKRFHFSTDTNGGERAMVPIGNYERVMPLDILPTILLRDLLAGDSDSAQALGCLELDEEDLALCTYVCPGKYEYGPALRSVLTQIEQEG
>NZ_CP027064.2|WP_008805263.1|4466787_4467528_+|murein-L,D-transpeptidase
MRKIALFIAMLLLPCVSFAGLLSSNSPTTPVSKEYKQQLMGSPVYIEIFKEERMLDLYVKMGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYSVTRSQLKPDSRFYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALVFGQPSVQVSIYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPIVSVTDGRYVVSKPLSHEVVQPQLASNYTLPETK
>NZ_CP027064.2|WP_008805262.1|4467498_4468266_-|class-II-glutamine-amidotransferase
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFQSPIAKLVQDYPIKSCSVVAHIRQANRGMVALENTHPFTRELWGRNWTYAHNGQLKGYKSLKTGNFHPVGETDSEKAFCWLLHRLTERYPRTPGNMLGVFKYIATLAGELREKGVFNMLLSDGRYVMAFCSTNLHWITRRAPFGVAKLLDQDVEIDFQRETTPNDVVTVIATQPLTANETWHKIMPGEWALFCLGERVV
>NZ_CP027064.2|WP_008805261.1|4468340_4468922_-|D-sedoheptulose-7-phosphate-isomerase
MYQDLIRNELNEAAETLANFLQDEANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEYVFSRYVESVGRAGDVLLGISTSGNSGNVIKAIEAARAQGMKVITLTGKDGGKMAGSADVEIRVPHFGYADRIQEIHIKVIHILIMLIEKEMVKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP027064_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027064_3

4765145-4765269

Orphan

Consensus_repeat	Method
GTTTGCTCCCTCTCCCACCGGGAGAGGGTTGGGGTGAGGGCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027064_3

>merge|NZ_CP027064|3|4765145-4765269|CRISPRCasFinder
GTTTGCTCCCTCTCCCACCGGGAGAGGGTTGGGGTGAGGGCAAGGTAAATGCAAAAAGGCAACGCAAGTTGCCTTTTTTAGGGTTTGCTCCCTCTCCCACCGGGAGAGGGTTGGGGTGAGGGCAA

>NZ_CP027064|3|3|4765145-4765269|CRISPRCasFinder
GTTTGCTCCCTCTCCCACCGGGAGAGGGTTGGGGTGAGGGCAA	GGTAAATGCAAAAAGGCAACGCAAGTTGCCTTTTTTAGG
GTTTGCTCCCTCTCCCACCGGGAGAGGGTTGGGGTGAGGGCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027064.2\|WP_012542917.1\|4758045_4758519_-\|protein-CreA	unknown	unknown	gnl\|CDD\|236752
NZ_CP027064.2\|WP_101837538.1\|4755919_4757344_-\|two-component-system-sensor-histidine-kinase-CreC	unknown	unknown	gnl\|CDD\|236846
NZ_CP027064.2\|WP_072121941.1\|4754500_4755856_-\|cell-envelope-integrity-protein-CreD	unknown	unknown	gnl\|CDD\|236960
NZ_CP027064.2\|WP_101837536.1\|4772848_4774171_-\|thymidine-phosphorylase	unknown	unknown	gnl\|CDD\|180276
NZ_CP027064.2\|WP_008807513.1\|4757343_4758033_-\|two-component-system-response-regulator-CreB	unknown	unknown	gnl\|CDD\|236838
NZ_CP027064.2\|WP_002887802.1\|4765284_4766517_-\|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR	unknown	unknown	gnl\|CDD\|236151
NZ_CP027064.2\|WP_002887784.1\|4774284_4775064_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|235387
NZ_CP027064.2\|WP_008807515.1\|4758728_4759598_+\|MDR-efflux-pump-AcrAB-transcriptional-activator-RobA	unknown	unknown	gnl\|CDD\|185076
NZ_CP027064.2\|WP_086892916.1\|4761275_4763213_-\|murein-transglycosylase	unknown	unknown	gnl\|CDD\|183236
NZ_CP027064.2\|WP_008807516.1\|4759594_4760242_-\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase-GpmB	unknown	unknown	gnl\|CDD\|179583
NZ_CP027064.2\|WP_012542918.1\|4760857_4761187_-\|trp-operon-repressor	unknown	unknown	gnl\|CDD\|179289
NZ_CP027064.2\|WP_002887789.1\|4770750_4771470_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NZ_CP027064.2\|WP_016160266.1\|4767930_4768902_-\|phosphoserine-phosphatase	unknown	unknown	gnl\|CDD\|182988
NZ_CP027064.2\|WP_043875815.1\|4769653_4770670_+\|lipoate--protein-ligase-LplA	unknown	unknown	gnl\|CDD\|179655
NZ_CP027064.2\|WP_008807517.1\|4760355_4760871_+\|non-canonical-purine-NTP-phosphatase	unknown	unknown	gnl\|CDD\|235336
NZ_CP027064.2\|WP_012968984.1\|4763441_4765109_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP027064.2\|WP_101837537.1\|4771572_4772796_-\|phosphopentomutase	unknown	unknown	gnl\|CDD\|235430
NZ_CP027064.2\|WP_012542923.1\|4775480_4776266_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|171118
NZ_CP027064.2\|WP_032732481.1\|4769006_4769654_+\|YtjB-family-periplasmic-protein	unknown	unknown	gnl\|CDD\|236885
NZ_CP027064.2\|WP_002887800.1\|4766538_4767921_-\|DNA-repair-protein-RadA	unknown	unknown	gnl\|CDD\|273067

Protein	Function_ID	Function_description	E-value
NZ_CP027064.2\|WP_012542917.1\|4758045_4758519_-\|protein-CreA	gnl\|CDD\|236752	PRK10756, PRK10756, protein CreA.	4.50228e-120
NZ_CP027064.2\|WP_101837538.1\|4755919_4757344_-\|two-component-system-sensor-histidine-kinase-CreC	gnl\|CDD\|236846	PRK11100, PRK11100, sensory histidine kinase CreC; Provisional.	0
NZ_CP027064.2\|WP_072121941.1\|4754500_4755856_-\|cell-envelope-integrity-protein-CreD	gnl\|CDD\|236960	PRK11715, PRK11715, cell envelope integrity protein CreD.	0
NZ_CP027064.2\|WP_101837536.1\|4772848_4774171_-\|thymidine-phosphorylase	gnl\|CDD\|180276	PRK05820, deoA, thymidine phosphorylase; Reviewed.	0
NZ_CP027064.2\|WP_008807513.1\|4757343_4758033_-\|two-component-system-response-regulator-CreB	gnl\|CDD\|236838	PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional.	2.77583e-155
NZ_CP027064.2\|WP_002887802.1\|4765284_4766517_-\|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR	gnl\|CDD\|236151	PRK08099, PRK08099, multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR.	0
NZ_CP027064.2\|WP_002887784.1\|4774284_4775064_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|235387	PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional.	0
NZ_CP027064.2\|WP_008807515.1\|4758728_4759598_+\|MDR-efflux-pump-AcrAB-transcriptional-activator-RobA	gnl\|CDD\|185076	PRK15121, PRK15121, MDR efflux pump AcrAB transcriptional activator RobA.	0
NZ_CP027064.2\|WP_086892916.1\|4761275_4763213_-\|murein-transglycosylase	gnl\|CDD\|183236	PRK11619, PRK11619, lytic murein transglycosylase; Provisional.	0
NZ_CP027064.2\|WP_008807516.1\|4759594_4760242_-\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase-GpmB	gnl\|CDD\|179583	PRK03482, PRK03482, phosphoglycerate mutase GpmB.	6.63469e-161
NZ_CP027064.2\|WP_012542918.1\|4760857_4761187_-\|trp-operon-repressor	gnl\|CDD\|179289	PRK01381, PRK01381, trp operon repressor.	3.49334e-51
NZ_CP027064.2\|WP_002887789.1\|4770750_4771470_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	7.43873e-174
NZ_CP027064.2\|WP_016160266.1\|4767930_4768902_-\|phosphoserine-phosphatase	gnl\|CDD\|182988	PRK11133, serB, phosphoserine phosphatase; Provisional.	0
NZ_CP027064.2\|WP_043875815.1\|4769653_4770670_+\|lipoate--protein-ligase-LplA	gnl\|CDD\|179655	PRK03822, lplA, lipoate-protein ligase A; Provisional.	0
NZ_CP027064.2\|WP_008807517.1\|4760355_4760871_+\|non-canonical-purine-NTP-phosphatase	gnl\|CDD\|235336	PRK05074, PRK05074, non-canonical purine NTP phosphatase.	7.98477e-112
NZ_CP027064.2\|WP_012968984.1\|4763441_4765109_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0
NZ_CP027064.2\|WP_101837537.1\|4771572_4772796_-\|phosphopentomutase	gnl\|CDD\|235430	PRK05362, PRK05362, phosphopentomutase; Provisional.	0
NZ_CP027064.2\|WP_012542923.1\|4775480_4776266_-\|metal-dependent-hydrolase	gnl\|CDD\|171118	PRK11449, PRK11449, metal-dependent hydrolase.	2.7717e-150
NZ_CP027064.2\|WP_032732481.1\|4769006_4769654_+\|YtjB-family-periplasmic-protein	gnl\|CDD\|236885	PRK11246, PRK11246, YtjB family periplasmic protein.	6.63302e-147
NZ_CP027064.2\|WP_002887800.1\|4766538_4767921_-\|DNA-repair-protein-RadA	gnl\|CDD\|273067	TIGR00416, DNA_repair_protein_RadA_homolog, DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus (SP:P45266) and in Listeria monocytogenes (SP:Q48761) . for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)). [DNA metabolism, DNA replication, recombination, and repair].	0

>NZ_CP027064.2|WP_012968984.1|4763441_4765109_+|energy-dependent-translational-throttle-protein-EttA
MAQFVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGAGKSTLLRIMAGIDTEIEGEARPQPGIKIGYLPQEPQLNPEHTVRESVEEAVAEVVNALKGLDEVYAKYAEPDADFDKLAAQQGKFEEIIQAHDGHNLNVQLERAADALRLPDWDAKIANLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDFEGTVVAITHDRYFLDNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASQEAARRKSIEKELEWVRQGAKGRQSKGKARLARFEELNNVEYQKRNETNELFIPPGARLGDKVLEVSHLRKSYGDRVLIDDLSFSVPKGAIVGIIGPNGAGKSTLFRMMSGQEQPDSGTITLGETVKLASVDQFRDAMDNSKTVWEEVSGGLDIMKIGNTEMPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKLLQVGGNVLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGKVEFFEGNFTEYEEYKKRTLGADALEPKRIKYKRIAK
>NZ_CP027064.2|WP_086892916.1|4761275_4763213_-|murein-transglycosylase
MEKAKKMAWRLLAASVGLLTLSQLAHADSLDEQRNRYAQIKQAWDNRQMDVVDQLMPTLSTYPLYPYLQYRQITDDLMNQPALVVKNFIDANPTLPPARSLRSRFVNELARRSDWRGLLAFSPDKPTSTEAQCNYYYAKLSVGQSQEAWSGAKDLWLTGKNQPGACEPLFSAWRDSGQQDPLAYLERIRLAMKAGNIGLVKSLAQQMPGNYQSIASAVVALANDPNSVLTFARTTGATDFTRQMAAVAFASVARQDVENARLMIPSLVQAQQLNEDQTQELRDIVAWRLMGTDVTEEQAIWRDDAIMRSQSTPLVERRVRMALGTGDRHGLNTWLARLPMEAKEKDEWRYWQADLLLERGRDEEAQAILRSLMQQRGFYPMVAAQRLGEEYTFRIDKVSGTIDPALASGPEMARVRELMYWNMDNTARTEWANLVTSRTKSQQAQLARYAFDQHWWDLSVQATIAGKLWDQLEERFPLAYNDLFARYISGKDIPQSYAMAIARQESAWNPKVRSPVGASGLMQIMPGTATHTVSMFSIPGYSGPSQLLDPETNINIGTSYLQYVYQQFGNNRIYASAAYNAGPGRVRTWQGNSAGRIDAVAFVESIPFSETRGYVKNVLSYDAYYRYFMGQQDKLFSDAEWRQRY
>NZ_CP027064.2|WP_012542918.1|4760857_4761187_-|trp-operon-repressor
MTQQSPYSAAVAEQRHQEWLRFVALLQQAYAEDLHLPLLQLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLKSAPAELRQWLEQTLLTSDK
>NZ_CP027064.2|WP_008807517.1|4760355_4760871_+|non-canonical-purine-NTP-phosphatase
MHHVVSATTNPAKIQAILQAFNEIFGEGSCHIESVSVESGVPEQPFGSEETRAGARNRVANARLVQPSADFWVAIEAGIDDGSTFSWVVIESADRRGEARSATLPLPEVILEQVRAGEALGPVMSQYTGIDQIGRKEGAIGVFTGGKLTRSSVYHQAVVLALSPFHNAIYR
>NZ_CP027064.2|WP_008807516.1|4759594_4760242_-|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase-GpmB
MLQVYLVRHGETQWNAERRIQGQSDSPLTAHGERQAWQVGERARTLGITHIITSDLGRTRRTAEIIAEACGCSVIADARLRELDMGVLEKRHIDSLSDEEEGWRRQLVNGTPDGRIPQGESMQELSERMHAALASCLELPAGSRPLLVSHGIALGCLVSTILGLPAYAERRLRLRNCSISRVDYQQSPWLASGWVVETAGDVSHLDAPAMDELQR
>NZ_CP027064.2|WP_008807515.1|4758728_4759598_+|MDR-efflux-pump-AcrAB-transcriptional-activator-RobA
MDQAGIIRDLLSWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFSLTPALYRRSPDWSSFGMRPPLRLGEFTLPKHEFVALPTTQLLGVTQSYTCKLEEISDFRNQMRVQFWRDFLGNSPSIPPVLYGLHEPRPSLEKDDEQEVFYTTALTPEMANGHLQNAHPVTLEGGEYVMFTYEGLGTGLQEFILTVYGTCMPMLNLTRRKGLDIERFYPEDENRDQATPIQLRCEYLIPIRR
>NZ_CP027064.2|WP_012542917.1|4758045_4758519_-|protein-CreA
MKYKKFAMGLLLLAGCQMAQAEQIGSVDTVFKWLGPDHKIVVEAFDDPDVQNVTCYISRAKTGGIKGGLGLAEDTSDAAISCQQVGPIELTDKIKNGKSQGDVVFQKRTSLVFKKLQVVRFYDAKRNALVYLTYSDKVVDGSPKNAISAVPIMPWNK
>NZ_CP027064.2|WP_008807513.1|4757343_4758033_-|two-component-system-response-regulator-CreB
MQQPRIWLVEDEQSIADTLVYPLQQEGFQVTVFGRGLPALEAAAHQAPDVAILDVGLPDISGFELCRRMLTRYPALPVLFLTARSDEVDKLLGLEIGADDYIAKPFSPREVCARVRTVLRRLQKFAAPSPVVRVGEFVLDEQAASISWFGQPLNLTRYEFLLLKTLLHAPGRVFSRQQLMELVWSDAWESLDRTVDTHIKTLRAKLRAVNPEVTPINTHRGMGYSLGRG
>NZ_CP027064.2|WP_101837538.1|4755919_4757344_-|two-component-system-sensor-histidine-kinase-CreC
MRIGMRLLLGYFLIVAIAAWFVLSIFVQEVKPGVRRATEGTLNDTATLLAALAREDLLAANPQQGRLAQAFQQLNQQPINAHIGGIKKVRNEYRVYLTDARGKVVFDSSGQATGQDYSRWNDVWLTLRGQYGARSTRSDPHDETSSVMYIAAPVMDKGRIIGVLSVGKPNLAMTPVIKRSERRILWAGGALLGIALLIGVGVVWWINFSIGKLVRYADSVTAERPLPLPEVGSSELRKLAQALESMRVKLEGKNAIENYVYDLTHELKSPLAAIRGAAEILREGPPPEVAARFTDNILAQNTRMQLLVERLLQQARLENRLEIKPQPVSIDALYQRLTEERDIALAAKAITLRWRESGMLVNGDGELLAQALGNLLDNAIDFTPQGGEIALAAEKRNEEVQLSVIDNGCGIPDYALERIFERFYSLPREDGHKSSGLGLAFVREVARLHHGDINLHNRPEGGVVATLRLHRPFT
>NZ_CP027064.2|WP_072121941.1|4754500_4755856_-|cell-envelope-integrity-protein-CreD
MKSPLFWKITTLIGCVVLLSLPLMMVRELINERADYRSEVVDAIEQSTSGSQKLAGPLIAIPVTETLTRMENQKEVNYQRSWVYYWLPESLAVTGKQTVESRRVGIYSGQVWHNALQIKASFDPLRLAALRKTNIVLGPPRLVVSVGDARGIGAIHAPEVNGNVLSVEPGLGISGDGAGIHMPMPALAEDNKPLEIAFSLDLNGTGEFSLVPIGRNSELQLTSNWPHPGFLGSFLPTQREVSAAGYRAHWQSSWFANDMGSYFKDDMEIPWSRLPAFSADVMSLADQYQLTDRATKYAILLIGLTFMAFFVFESLTRRPLHPMQYLLVGLSLVLFYLVLLALSEHVGFTAAWLAASLSGAVMNGVYLQAVLRGWRNSLLFVAALLLLDGVMWFLLHSEDSALLLGTGVLVLALSVLMFLTRRVDWYALSLPKGSAPPPPAADDDKLRLWKE
>NZ_CP027064.2|WP_002887802.1|4765284_4766517_-|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR
MSSFDYLKSAIKQKGCTLQQVAEASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRRQKSVGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRELFEESAMSQQPTVPDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSHGIRAFMSEKGIEPNRIYTSEEADAPQYLEHLGIETVLIDPKRTFMNISGGQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVSTQAFCLKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQSLLVSLLKENEIEFVHVKESDYDARFLRCVELVKQLMGEQG
>NZ_CP027064.2|WP_002887800.1|4766538_4767921_-|DNA-repair-protein-RadA
MAKAPKRAFVCNECGADYPRWQGQCSACHAWNTITEMRIAASPQVARNERLSGYAGNAGVSKVQKLSDISLEALPRFSTGFKEFDRVLGGGVVPGSAILIGGNPGAGKSTLLLQTLCKLAEGMKTLYVTGEESLQQVAMRAHRLGLPTANLNMLSETSIEQICQIADEEKPQLMVIDSIQVMHMADVQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVTKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVSNPSAIFLSRGDEITSGSSVMVVWEGTRPLLVEIQALVDHSMMSNPRRVAVGLEQNRLAILLAVLHRHGGLQMADQDVFVNVVGGVKVTETSADLALLLAMVSSLRDRPLPQDLVVFGEVGLAGEIRPVPSGQERISEAAKHGFRRAIVPAANVPKKVPEGMQIFGVKKLSDALSVFDDL
>NZ_CP027064.2|WP_016160266.1|4767930_4768902_-|phosphoserine-phosphatase
MPNSLTWCDLPEDVSLWPGLPLSLSGDEVMPLDYHAGRSGWLLYGRGLNKRRLTDWQRELGAALVIVASWVVEDYQVIRLAGSLTPRATRLAHEAGLDVAPLGKIPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGTGELVSEVTERAMRGELDFTASLRQRVATLKDADASILLQVRDALPLMPGLAQLVLKLETLGWKVAIASGGFTFFAEYLRDKLHLDAVFANELEIRDGKLTGNVLGDIVDAKYKANTLRKLAEKYEIPTAQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNEQAEVTIRHADLMGVFCILSGSMNQK
>NZ_CP027064.2|WP_032732481.1|4769006_4769654_+|YtjB-family-periplasmic-protein
MVRAKLKFRLHRAVIVLICLALLVALMQGASWFSQNSQKQRNPQLEELARTLAQQVVLNLVPLMRSETPDEKRINQLLTQLTHNSRVLDAGVYDEQGDLVTRSGESVEVRDRLALDGKKAGGYFNQQIVEPVPGKNGPLGYLRLTLDTHTLATEAKQVDNTTNILRLMLLLSLAIGVVLTRTLLQGKRTRWQQSPFLLTANKPVEDEDDEKKGNL
>NZ_CP027064.2|WP_043875815.1|4769653_4770670_+|lipoate--protein-ligase-LplA
MSTLRLLLSDSYDPWFNLAVEECIFRQMPATQRVLFLWRNADTVVIGRAQNPWKECNTRRMEEDHVRLARRSSGGGAVFHDLGNTCFTFMAGKPEYDKTVSTAIVLAALNSLGVTAEASGRNDLVVKTDSGDRKVSGSAYRETIDRGFHHGTLLLNADLSRLANYLNPDQKKLQAKGITSVRGRVANLVELLPGITHQHICEAIQEAFFNHYGERVDAEVISPDNTPDLPNFAETFARQSSWEWNFGQAPAFSHLLDERFRWGGVELHFDVEKGHITRAQAFTDSLNPAPLEALAARLVGCQYRAEVLQQQCEALVGDFPEQEAELKELSAWMAGAVR
>NZ_CP027064.2|WP_002887789.1|4770750_4771470_-|purine-nucleoside-phosphorylase
MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRLRFKDHDFAAIADFGMVRNAVDAAKALGVDARVGNIFSADLFYTPDPSMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGDKE
>NZ_CP027064.2|WP_101837537.1|4771572_4772796_-|phosphopentomutase
MKRAFIMVLDSFGIGATEDADRFGDVGADTMGHIAEACAKGEADNGRKGPLNLPNLTRLGLVKAHEGSTGKIAAGMDGNAEVIGAYAWAHELSSGKDTPSGHWEIAGVPVLFDWGYFSDHENSFPQELLDKLVKRANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQIACHEETFGLDKLYELCEIAREELTEGGYNIGRVIARPFIGDKAGNFQRTGNRHDLAVEPPAPTVLQKLVDEKNGHVVSVGKIADIYANCGITKKVKAAGLDALFDATIKEMKEAGDETIVFTNFVDFDSSWGHRRDVAGYAAGLELFDRRLPELMELVGEDDILILTADHGCDPTWTGTDHTREHIPVLVYGPKVKPGSLGHRETFADIGQTIAKYFGTSDMEYGKAMF
>NZ_CP027064.2|WP_101837536.1|4772848_4774171_-|thymidine-phosphorylase
MFLAQEIIRKKRDGHVLSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLTMAMRDSGTVLNWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYDHYLPTAMLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFTDMARLGDHVDGQRPLAVIHAKDENSWQEAAKAVKAAIKLDDKAPEITPTVYRRITE
>NZ_CP027064.2|WP_002887784.1|4774284_4775064_-|deoxyribose-phosphate-aldolase
MTDLKASSLRALKLMDLTTLNDDDTNEKVIALCHQAKTPVGNTAAVCIYPRFIPIARKTLNEQGTPDIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFELVKACKEACAAANVLLKVIIETGELKEEALIRKASEISIKAGADFIKTSTGKVPVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRSAEDAQQFLAIADELFGADWADSRHYRFGASSLLASLLKALGHGDGKSASSY
>NZ_CP027064.2|WP_012542923.1|4775480_4776266_-|metal-dependent-hydrolase
MSHRFIDTHCHFDFPPFAEDETASLARAAQAGVGQIIVPAISAARFNRVLALAAQHEALYAALGMHPIVIEQHADEGLAQLERCLSLRPPKLVAVGEIGLDLYRDDPQFDRQQALLEEQLRLAKRYDLPVILHSRRTHDKLAMLLKKHALPRTGVVHGFAGSLQQAERFVQLGYKIGVGGTITYPRASKTREVMARLPLSALLLETDAPDMPLNGFQGQPNRPEQVARVFDALCELRAEPAPTIEAAVLANTKSLFSALAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027064_3	3.1\|4765188\|39\|NZ_CP027064\|CRISPRCasFinder	4765188-4765226	39	CP052361	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-5, complete sequence	5211-5249	9	0.769
NZ_CP027064_3	3.1\|4765188\|39\|NZ_CP027064\|CRISPRCasFinder	4765188-4765226	39	CP052429	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-2, complete sequence	1930-1968	9	0.769
NZ_CP027064_3	3.1\|4765188\|39\|NZ_CP027064\|CRISPRCasFinder	4765188-4765226	39	NZ_KU295136	Escherichia coli strain BK28610 plasmid pBK28610, complete sequence	14121-14159	9	0.769
NZ_CP027064_3	3.1\|4765188\|39\|NZ_CP027064\|CRISPRCasFinder	4765188-4765226	39	NZ_CP010366	Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-13.828kb, complete sequence	4109-4147	9	0.769

1. spacer 3.1|4765188|39|NZ_CP027064|CRISPRCasFinder matches to CP052361 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-5, complete sequence) position: , mismatch: 9, identity: 0.769

---ggtaaatgcaaaaaggcaacgcaagttgccttttttagg	CRISPR spacer
ccggctgaa---aaaaaggcaccgcaaggtgccttttttaca	Protospacer
   * *.**   ********* ****** *********** .

2. spacer 3.1|4765188|39|NZ_CP027064|CRISPRCasFinder matches to CP052429 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-2, complete sequence) position: , mismatch: 9, identity: 0.769

---ggtaaatgcaaaaaggcaacgcaagttgccttttttagg	CRISPR spacer
ccggctgaa---aaaaaggcaccgcaaggtgccttttttaca	Protospacer
   * *.**   ********* ****** *********** .

3. spacer 3.1|4765188|39|NZ_CP027064|CRISPRCasFinder matches to NZ_KU295136 (Escherichia coli strain BK28610 plasmid pBK28610, complete sequence) position: , mismatch: 9, identity: 0.769

--ggtaaatgcaaaaaggcaacgcaagttgccttttttagg	CRISPR spacer
cggctgaa--aaaaaaggcaccgcaaggtgccttttttaca	Protospacer
  * *.**   ********* ****** *********** .

4. spacer 3.1|4765188|39|NZ_CP027064|CRISPRCasFinder matches to NZ_CP010366 (Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-13.828kb, complete sequence) position: , mismatch: 9, identity: 0.769

--ggtaaatgcaaaaaggcaacgcaagttgccttttttagg	CRISPR spacer
cggctgaa--aaaaaaggcaccgcaaggtgccttttttaca	Protospacer
  * *.**   ********* ****** *********** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1187604 : 1196691

Enterobacteria_phage(85.71%)

integrase

attL 1192539:1192554|attR 1204795:1204810

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101837368.1\|1187604_1189938_-	DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	81.6
WP_004098169.1\|1189951_1190272_-	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_101837369.1\|1190268_1190496_-	hypothetical protein	NA	NA	NA	NA
WP_077267896.1\|1190492_1191041_-	ash family protein	Q7M2A7	Enterobacteria_phage	9.1e-30	65.8
WP_064160085.1\|1191037_1191304_-	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	4.4e-30	71.6
WP_101837370.1\|1191843_1192581_+	glycoprotein 3	Q7M2A2	Enterobacteria_phage	1.7e-71	59.8
1192539:1192554	attL	NA	NA	NA	NA
WP_004136116.1\|1192577_1192823_+	hypothetical protein	Q7M294	Enterobacteria_phage	1.9e-19	58.0
WP_101837371.1\|1192840_1193407_+	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	3.3e-59	64.9
WP_087847021.1\|1194061_1195480_+	hypothetical protein	NA	NA	NA	NA
WP_065806331.1\|1195491_1196691_-\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	9.1e-107	50.6
1204795:1204810	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1646672 : 1653598

Planktothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032736203.1\|1646672_1647536_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
WP_012967575.1\|1647546_1648320_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-26	37.2
WP_012541062.1\|1648559_1649453_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	3.6e-15	29.8
WP_008804076.1\|1649698_1651060_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.0e-207	94.8
WP_004201558.1\|1651376_1652099_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_008804077.1\|1652095_1653598_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.6e-30	28.3

DBSCAN-SWA_3

1925970 : 1991774

Enterobacteria_phage(39.39%)

plate,protease,integrase,capsid,tRNA,terminase,head,portal,tail

attL 1927841:1927857|attR 1963434:1963450

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008804296.1\|1925970_1926666_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_008804297.1\|1926704_1927286_+	Slp family lipoprotein	NA	NA	NA	NA
WP_032701002.1\|1927491_1929177_+	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.0e-34	26.2
1927841:1927857	attL	NA	NA	NA	NA
WP_032746810.1\|1929246_1930374_+	ribonuclease D	NA	NA	NA	NA
WP_004103270.1\|1930450_1930720_-	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_008804300.1\|1930723_1931536_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_008804301.1\|1931559_1932261_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004203320.1\|1932387_1932669_+	hypothetical protein	NA	NA	NA	NA
WP_012967776.1\|1932685_1933345_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_008804304.1\|1933439_1933886_+	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_032733265.1\|1933894_1934239_-	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_008804305.1\|1934389_1934920_-	disulfide bond formation protein DsbB	NA	NA	NA	NA
WP_012967777.1\|1935048_1936599_-	sodium/proton antiporter NhaB	NA	NA	NA	NA
WP_012541278.1\|1936847_1937567_+	fatty acid metabolism transcriptional regulator FadR	NA	NA	NA	NA
WP_004203310.1\|1937641_1939174_-	SpoVR family protein	NA	NA	NA	NA
WP_008804309.1\|1939495_1940794_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_012967778.1\|1940803_1941874_+	catabolic alanine racemase DadX	NA	NA	NA	NA
WP_101837125.1\|1942015_1942456_-	DUF1640 domain-containing protein	NA	NA	NA	NA
WP_101837126.1\|1942448_1942946_-	hypothetical protein	NA	NA	NA	NA
WP_101837127.1\|1942947_1943916_-\|integrase	tyrosine-type recombinase/integrase	A0A0F7LBR0	Escherichia_phage	8.4e-79	46.0
WP_101837128.1\|1943980_1944280_-	helix-turn-helix transcriptional regulator	Q1JS37	Enterobacteria_phage	4.5e-23	56.2
WP_032737939.1\|1944361_1944628_+	hypothetical protein	NA	NA	NA	NA
WP_101837251.1\|1944656_1944869_+	DUF4761 domain-containing protein	NA	NA	NA	NA
WP_101837129.1\|1944885_1945428_+	hypothetical protein	NA	NA	NA	NA
WP_101837130.1\|1945414_1945600_-	hypothetical protein	NA	NA	NA	NA
WP_101837252.1\|1945807_1946080_+	hypothetical protein	NA	NA	NA	NA
WP_101837131.1\|1946148_1946373_+	hypothetical protein	NA	NA	NA	NA
WP_101837132.1\|1946369_1946948_+	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	1.1e-33	41.1
WP_101837133.1\|1946958_1947927_+	DNA adenine methylase	A0A0M4QWR0	Salmonella_phage	1.4e-78	51.5
WP_101837134.1\|1948228_1949245_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	8.0e-96	52.9
WP_101837135.1\|1949237_1951847_+	replication endonuclease	A0A0M4RTM8	Salmonella_phage	2.5e-194	52.5
WP_101837136.1\|1952482_1953181_+	DNA methylase	A0A0M4S5U3	Salmonella_phage	2.3e-94	72.1
WP_101837137.1\|1953209_1953584_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_101837138.1\|1953669_1953933_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5NR91	Burkholderia_phage	3.2e-09	40.2
WP_101837139.1\|1954490_1955543_-\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	9.3e-140	69.8
WP_101837140.1\|1955542_1957264_-	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	2.9e-223	65.5
WP_101837141.1\|1957424_1958258_+\|capsid	GPO family capsid scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	3.2e-95	64.1
WP_101837142.1\|1958282_1959332_+\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	4.4e-105	54.5
WP_101837143.1\|1959378_1960293_+\|terminase	terminase	B9A7B6	Serratia_phage	4.7e-87	76.5
WP_101837144.1\|1960395_1960893_+\|head	head completion/stabilization protein	B9A7B7	Serratia_phage	4.5e-60	70.3
WP_040150909.1\|1960892_1961093_+\|tail	tail protein	A0A0A7NV57	Enterobacteria_phage	5.1e-15	66.2
WP_044784790.1\|1961083_1961365_+	hypothetical protein	B9A7B8	Serratia_phage	1.4e-18	57.1
WP_101837145.1\|1961361_1961913_+	lysozyme	Q1I0Z1	Pasteurella_virus	1.7e-28	40.8
WP_101837146.1\|1961909_1962305_+	DUF2570 domain-containing protein	NA	NA	NA	NA
WP_101837147.1\|1962449_1962908_+\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	4.0e-31	46.4
WP_101837148.1\|1962904_1963546_+	phage virion morphogenesis protein	A0A0A7NV60	Enterobacteria_phage	2.0e-44	47.3
1963434:1963450	attR	NA	NA	NA	NA
WP_063106279.1\|1963545_1964130_+\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	1.2e-64	63.5
WP_063106280.1\|1964126_1964495_+\|plate	baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	8.0e-30	58.3
WP_101837149.1\|1964481_1965381_+\|plate	baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	2.5e-93	62.9
WP_101529203.1\|1965373_1965976_+\|tail	phage tail protein I	A0A218M4J3	Erwinia_phage	5.1e-42	48.1
WP_101837150.1\|1968402_1969476_+\|tail	phage tail protein	E5G6P0	Salmonella_phage	4.5e-33	47.0
WP_023279573.1\|1969603_1970092_-\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	6.8e-53	61.1
WP_101837151.1\|1970101_1972822_-\|tail	phage tail tape measure protein	F1BUT7	Erwinia_phage	1.2e-127	47.7
WP_071836356.1\|1972802_1972979_-\|tail	GpE family phage tail protein	O80316	Escherichia_phage	3.0e-11	71.4
WP_101837152.1\|1972975_1973275_-\|tail	phage tail protein	B9A7B2	Serratia_phage	3.7e-33	75.8
WP_063106287.1\|1973329_1973845_-\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	3.4e-63	68.2
WP_101529200.1\|1973844_1975026_-\|tail	phage tail protein	A0A0A7NV69	Enterobacteria_phage	2.6e-154	68.8
WP_101837253.1\|1975179_1976334_+	phage late control D family protein	B9A7A9	Serratia_phage	1.3e-179	81.2
WP_087796135.1\|1976378_1976627_+	hypothetical protein	NA	NA	NA	NA
WP_101837153.1\|1976642_1976852_+	hypothetical protein	NA	NA	NA	NA
WP_008804311.1\|1976982_1978716_-	potassium/proton antiporter	NA	NA	NA	NA
WP_008804312.1\|1978808_1979723_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_008804313.1\|1979898_1980510_+	membrane-bound lytic murein transglycosylase EmtA	A0A0H3V0Q1	Geobacillus_virus	3.0e-05	40.7
WP_048964631.1\|1980558_1981383_-	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_012541282.1\|1981395_1982247_-	hypothetical protein	NA	NA	NA	NA
WP_086892582.1\|1982426_1984547_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_048964632.1\|1984807_1986541_-	alpha,alpha-trehalase	NA	NA	NA	NA
WP_072123014.1\|1986539_1986767_+	hypothetical protein	NA	NA	NA	NA
WP_044649605.1\|1986738_1987653_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004180417.1\|1987836_1989276_+	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_002910835.1\|1989269_1990199_+	alpha-E domain-containing protein	NA	NA	NA	NA
WP_008804319.1\|1990195_1991011_+	transglutaminase family protein	NA	NA	NA	NA
WP_008804320.1\|1991027_1991774_+\|protease	proteasome-type protease	NA	NA	NA	NA

DBSCAN-SWA_4

2758011 : 2768892

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101837240.1\|2758011_2761119_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.3
WP_008804978.1\|2761173_2762439_+	MFS transporter	NA	NA	NA	NA
WP_023322574.1\|2762469_2763558_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	6.3e-208	98.3
WP_008804980.1\|2763644_2763905_-	hypothetical protein	A0A077SK33	Escherichia_phage	3.0e-39	95.3
WP_023297577.1\|2764199_2765060_+	class A beta-lactamase LEN-16	A0A077SL40	Escherichia_phage	1.8e-144	90.6
WP_008804982.1\|2765077_2765839_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	2.1e-133	99.2
WP_008804983.1\|2766099_2767002_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	1.1e-157	98.7
WP_023322572.1\|2767013_2768279_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	6.8e-230	97.6
WP_012541792.1\|2768271_2768892_+	aldolase	A0A077SK32	Escherichia_phage	5.7e-113	98.1

DBSCAN-SWA_5

2860194 : 2902502

Salmonella_phage(34.04%)

holin,tail,integrase,head

attL 2858369:2858383|attR 2862806:2862820

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2858369:2858383	attL	NA	NA	NA	NA
WP_046619555.1\|2860194_2861295_+\|integrase	site-specific integrase	A0A1W6JP34	Morganella_phage	1.2e-116	57.1
WP_101837248.1\|2861380_2861698_-	hypothetical protein	K7PGV5	Enterobacterial_phage	6.9e-22	51.0
WP_101837249.1\|2861697_2861937_-	hypothetical protein	K7P7N3	Enterobacteria_phage	2.8e-15	51.9
WP_072060349.1\|2862195_2862570_+	hypothetical protein	NA	NA	NA	NA
WP_105322436.1\|2862607_2864977_-	SGNH/GDSL hydrolase family protein	A0A286S1P0	Klebsiella_phage	4.8e-19	46.4
2862806:2862820	attR	NA	NA	NA	NA
WP_058343134.1\|2865087_2865270_-	hypothetical protein	NA	NA	NA	NA
WP_101837483.1\|2865269_2866151_-	hypothetical protein	A0A2H4IYR0	uncultured_Caudovirales_phage	4.3e-29	61.1
WP_032454856.1\|2866150_2866924_-	DUF2612 domain-containing protein	A0A2H4J1A9	uncultured_Caudovirales_phage	1.1e-76	54.1
WP_025269941.1\|2866920_2868117_-	hypothetical protein	A0A0M4RD32	Salmonella_phage	6.6e-158	72.9
WP_004152573.1\|2868116_2868470_-	hypothetical protein	A0A2H4J629	uncultured_Caudovirales_phage	2.3e-50	80.3
WP_101837484.1\|2868471_2869125_-	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	5.9e-60	63.5
WP_064168817.1\|2869187_2869550_-	hypothetical protein	NA	NA	NA	NA
WP_064168818.1\|2869553_2869790_-	hypothetical protein	NA	NA	NA	NA
WP_101837485.1\|2869786_2870347_-	hypothetical protein	NA	NA	NA	NA
WP_101837486.1\|2870484_2870829_-	hypothetical protein	A0A2H4J1A5	uncultured_Caudovirales_phage	8.8e-23	48.7
WP_046659638.1\|2870825_2871854_-	hypothetical protein	A0A2H4J1B2	uncultured_Caudovirales_phage	2.3e-98	53.8
WP_004152568.1\|2871856_2872159_-	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	2.0e-26	55.2
WP_101837487.1\|2872159_2872759_-	hypothetical protein	A0A2H4J1B3	uncultured_Caudovirales_phage	7.6e-54	57.6
WP_101837488.1\|2872758_2874684_-	hypothetical protein	A0A0M4REK7	Salmonella_phage	2.1e-182	71.3
WP_064165570.1\|2874673_2874826_-	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	5.4e-17	82.0
WP_000393949.1\|2874867_2875317_-	hypothetical protein	A0A0M4S6U8	Salmonella_phage	1.1e-36	55.3
WP_032454867.1\|2875320_2875761_-	DUF3277 family protein	A0A0M5M1K6	Salmonella_phage	2.8e-61	78.8
WP_101837489.1\|2875771_2876923_-	DUF3383 family protein	A0A0M4RD26	Salmonella_phage	1.6e-177	81.5
WP_064144275.1\|2876924_2877476_-	hypothetical protein	A0A2H4J1A0	uncultured_Caudovirales_phage	1.5e-40	44.9
WP_101837490.1\|2877468_2877873_-\|head,tail	head-tail adaptor	A0A2H4J1A4	uncultured_Caudovirales_phage	2.4e-43	70.8
WP_101837491.1\|2877872_2878379_-	hypothetical protein	A0A2H4J488	uncultured_Caudovirales_phage	5.3e-16	36.6
WP_101837492.1\|2878375_2878795_-	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	2.2e-39	60.7
WP_048265720.1\|2878763_2879045_-	hypothetical protein	NA	NA	NA	NA
WP_064162782.1\|2879084_2880026_-	DUF2184 domain-containing protein	A0A2H4J191	uncultured_Caudovirales_phage	9.2e-139	78.1
WP_025269955.1\|2880037_2880532_-	hypothetical protein	A0A2H4JHM9	uncultured_Caudovirales_phage	1.4e-50	63.4
WP_101837493.1\|2880535_2881738_-	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	5.3e-107	54.1
WP_101837494.1\|2881789_2882338_-	hypothetical protein	A0A0M4REK0	Salmonella_phage	1.4e-49	56.9
WP_101837495.1\|2882393_2883845_-	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	3.2e-191	69.0
WP_101837530.1\|2883848_2885462_-	TerL protein	A0A0M5M1R6	Salmonella_phage	5.2e-275	82.9
WP_029498730.1\|2885555_2885747_+	YegP family protein	NA	NA	NA	NA
WP_101837496.1\|2886006_2886480_-	DUF2280 domain-containing protein	H9C190	Pectobacterium_phage	3.9e-53	68.4
WP_101837497.1\|2886511_2887147_-	hypothetical protein	I6S676	Salmonella_phage	2.3e-101	81.6
WP_130997663.1\|2887228_2887447_-	hypothetical protein	NA	NA	NA	NA
WP_101837498.1\|2887702_2888092_-	DUF2570 domain-containing protein	U5P0U9	Shigella_phage	2.0e-23	49.6
WP_101837531.1\|2888088_2888586_-	lysozyme	A0A1V0E5Q7	Salmonella_phage	6.9e-77	81.8
WP_012542609.1\|2888563_2888833_-\|holin	holin	K7P6H9	Enterobacteria_phage	2.8e-32	78.3
WP_124060769.1\|2888992_2889514_-	hypothetical protein	NA	NA	NA	NA
WP_101837499.1\|2889882_2890461_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	7.1e-49	56.1
WP_101837500.1\|2890457_2891117_-	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	2.2e-99	78.1
WP_023158891.1\|2891113_2891419_-	DUF968 domain-containing protein	Q6V7S4	Burkholderia_virus	1.2e-23	57.4
WP_046619486.1\|2891940_2892186_-	hypothetical protein	NA	NA	NA	NA
WP_101837501.1\|2892261_2892585_-	hypothetical protein	C6ZR26	Salmonella_phage	2.3e-12	51.2
WP_101837502.1\|2892581_2892944_-	hypothetical protein	NA	NA	NA	NA
WP_101837503.1\|2892936_2894001_-	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	7.4e-145	72.4
WP_101837504.1\|2893997_2894786_-	hypothetical protein	A4JX52	Burkholderia_virus	2.9e-61	50.2
WP_046619476.1\|2894778_2895000_-	hypothetical protein	NA	NA	NA	NA
WP_101837505.1\|2894999_2895395_-	hypothetical protein	NA	NA	NA	NA
WP_101837506.1\|2895421_2896471_-	hypothetical protein	K7PLZ7	Enterobacterial_phage	2.7e-30	49.6
WP_101837507.1\|2896467_2896722_-	hypothetical protein	NA	NA	NA	NA
WP_101837508.1\|2896917_2897238_-	hypothetical protein	A0A0M4RU01	Salmonella_phage	6.5e-36	68.9
WP_032428570.1\|2897277_2897499_-	helix-turn-helix domain-containing protein	Q716D6	Shigella_phage	8.2e-14	55.7
WP_101837509.1\|2897597_2898230_+	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	1.9e-34	36.9
WP_101837510.1\|2898647_2898872_+	hypothetical protein	NA	NA	NA	NA
WP_101837511.1\|2899083_2899377_+	host cell division inhibitory peptide Kil	NA	NA	NA	NA
WP_124053771.1\|2899449_2899671_+	hypothetical protein	NA	NA	NA	NA
WP_101837512.1\|2899679_2900243_+	hypothetical protein	A0A088C4R7	Shewanella_sp._phage	6.3e-26	38.3
WP_101837513.1\|2900239_2900464_+	hypothetical protein	A0A286S2B3	Klebsiella_phage	2.3e-19	63.5
WP_101837514.1\|2900460_2900805_+	hypothetical protein	NA	NA	NA	NA
WP_101837515.1\|2900797_2901421_+	hypothetical protein	NA	NA	NA	NA
WP_101837516.1\|2901417_2902122_+	hypothetical protein	A0A1W6JP46	Morganella_phage	5.4e-27	34.2
WP_016530209.1\|2902241_2902502_+	hypothetical protein	A0A1L5C290	Pseudoalteromonas_phage	1.5e-11	43.7

DBSCAN-SWA_6

3021084 : 3080494

Salmonella_phage(26.92%)

holin,coat,terminase,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101837573.1\|3021084_3022149_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.1e-14	32.2
WP_101139497.1\|3022616_3024956_-	SGNH/GDSL hydrolase family protein	A0A286S1P0	Klebsiella_phage	4.0e-50	76.3
WP_101837555.1\|3025032_3028101_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	96.5
WP_064149192.1\|3028097_3028478_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.0e-69	95.2
WP_101837556.1\|3028487_3028970_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	2.0e-81	94.4
WP_004190622.1\|3029150_3029615_-	hypothetical protein	A0A286S298	Klebsiella_phage	3.0e-58	68.4
WP_101837565.1\|3029614_3032413_-\|tail	phage tail protein	A0A2H4J107	uncultured_Caudovirales_phage	4.1e-94	32.6
WP_108112584.1\|3033306_3033828_-	zinc ribbon domain-containing protein	S4TR42	Salmonella_phage	8.1e-28	57.3
WP_101837557.1\|3034136_3034550_-	hypothetical protein	NA	NA	NA	NA
WP_101837558.1\|3034549_3035284_-	hypothetical protein	NA	NA	NA	NA
WP_142777051.1\|3035881_3036079_-	hypothetical protein	NA	NA	NA	NA
WP_026005925.1\|3036216_3036699_-	hypothetical protein	NA	NA	NA	NA
WP_101837560.1\|3036739_3037672_-	hypothetical protein	A0A0D4DBN5	Acinetobacter_phage	3.4e-24	27.3
WP_004190640.1\|3037695_3038088_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_012967909.1\|3038084_3038636_-	hypothetical protein	G8C7Q1	Escherichia_phage	5.9e-29	39.9
WP_101837561.1\|3038637_3039021_-	glutamate 5-kinase	A0A0S2SYG4	Pseudomonas_phage	2.4e-21	46.0
WP_101837562.1\|3039022_3039433_-	protein singed	A0A0H5AUF0	Pseudomonas_phage	1.0e-09	39.0
WP_072122527.1\|3039436_3039649_-	hypothetical protein	G8C7P8	Escherichia_phage	1.2e-09	53.7
WP_101837563.1\|3039688_3040825_-\|coat	P22 coat - protein 5 family protein	G8C7P7	Escherichia_phage	5.3e-157	76.2
WP_004184465.1\|3040912_3041677_-	hypothetical protein	G8C7P6	Escherichia_phage	1.1e-76	59.4
WP_101837564.1\|3041783_3042896_-	hypothetical protein	I6PD76	Cronobacter_phage	3.4e-108	53.3
WP_040217570.1\|3042879_3044304_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	1.3e-192	71.5
WP_064142012.1\|3044308_3045613_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	1.7e-146	60.3
WP_101139502.1\|3045590_3046586_-\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	3.8e-34	43.8
WP_016160813.1\|3047146_3047392_-	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	5.5e-35	97.5
WP_077249691.1\|3047546_3047738_-	hypothetical protein	NA	NA	NA	NA
WP_042921403.1\|3048666_3049026_-	hypothetical protein	NA	NA	NA	NA
WP_139015922.1\|3049579_3049699_+	small membrane protein	NA	NA	NA	NA
WP_133124690.1\|3050007_3050280_-	hypothetical protein	NA	NA	NA	NA
WP_032735912.1\|3050377_3050662_-	hypothetical protein	G8C7W3	Escherichia_phage	8.6e-32	74.5
WP_012967895.1\|3050747_3050930_+	hypothetical protein	NA	NA	NA	NA
WP_101139504.1\|3051135_3051762_-	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	9.9e-89	75.8
WP_015958299.1\|3051761_3052043_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.2e-32	73.1
WP_004213330.1\|3052029_3052425_-	membrane protein	G8C7V8	Escherichia_phage	1.5e-45	73.1
WP_050888101.1\|3053116_3053503_+	hypothetical protein	NA	NA	NA	NA
WP_099761808.1\|3053527_3053749_-	hypothetical protein	NA	NA	NA	NA
WP_101139505.1\|3053877_3054675_-	antitermination protein	H6WRZ1	Salmonella_phage	5.4e-116	77.0
WP_105322434.1\|3054677_3054809_-	YlcG family protein	A0A0M5M7B2	Salmonella_phage	2.3e-08	73.7
WP_101837395.1\|3054805_3055162_-	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	4.7e-43	66.9
WP_101139507.1\|3055158_3055455_-	DUF1364 domain-containing protein	A0A0U2KD41	Escherichia_phage	3.5e-36	72.9
WP_073984484.1\|3055457_3055664_-	hypothetical protein	H6WRY8	Salmonella_phage	2.1e-24	74.2
WP_015958295.1\|3055663_3056260_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	4.2e-89	79.6
WP_050888087.1\|3056295_3056529_-	hypothetical protein	A0A0M4R5D9	Salmonella_phage	2.9e-17	54.5
WP_132349619.1\|3056625_3056892_+	hypothetical protein	NA	NA	NA	NA
WP_004179624.1\|3057008_3057452_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_101139508.1\|3057605_3059591_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	2.2e-206	53.5
WP_050888085.1\|3059587_3059845_-	hypothetical protein	NA	NA	NA	NA
WP_073984483.1\|3059844_3060423_-	ead/Ea22-like family protein	NA	NA	NA	NA
WP_050888084.1\|3060445_3060682_-	hypothetical protein	S4TVX5	Salmonella_phage	5.1e-14	51.5
WP_101139509.1\|3061267_3061603_-	DUF977 family protein	H6WRX9	Salmonella_phage	5.8e-11	43.0
WP_101139510.1\|3061610_3062360_-	ATP-binding protein	S4TNF5	Salmonella_phage	1.3e-116	81.1
WP_041937713.1\|3062362_3063202_-	hypothetical protein	Q8HA96	Salmonella_phage	1.5e-23	51.3
WP_101837396.1\|3063267_3064062_-	ParB/RepB/Spo0J family partition protein	C7BGF1	Burkholderia_phage	1.8e-63	51.3
WP_101139512.1\|3064190_3064727_-	hypothetical protein	K7PJT7	Enterobacteria_phage	5.0e-65	72.3
WP_023322439.1\|3064717_3064957_-	hypothetical protein	A0A0M4QX15	Salmonella_phage	4.4e-29	79.2
WP_101139513.1\|3065060_3065447_+	helix-turn-helix domain-containing protein	A0A0M4R5D1	Salmonella_phage	4.7e-57	92.1
WP_133124691.1\|3065597_3066506_+	hypothetical protein	A4KWU2	Enterobacteria_phage	1.6e-71	47.4
WP_133124692.1\|3067014_3067278_+	hypothetical protein	NA	NA	NA	NA
WP_064142429.1\|3067241_3067511_-	hypothetical protein	NA	NA	NA	NA
WP_004179600.1\|3067801_3067993_+	YebW family protein	NA	NA	NA	NA
WP_101139515.1\|3068001_3068157_+	hypothetical protein	K7P7H7	Enterobacteria_phage	9.8e-14	71.2
WP_101139516.1\|3068294_3071399_+	exodeoxyribonuclease	H6WRX1	Salmonella_phage	1.1e-292	58.5
WP_071582744.1\|3071411_3072500_+	recombinase RecT	H6WRX0	Salmonella_phage	6.1e-102	53.0
WP_085848752.1\|3072534_3072888_+	hypothetical protein	NA	NA	NA	NA
WP_101139518.1\|3072880_3073492_+	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	3.2e-39	74.2
WP_101139519.1\|3073488_3073797_+	hypothetical protein	I6PD68	Cronobacter_phage	4.2e-24	56.9
WP_004179594.1\|3073804_3074044_+	DUF4060 family protein	M9P0E0	Enterobacteria_phage	9.4e-32	84.6
WP_004179593.1\|3074108_3074321_+	DUF1233 family excisionase	A0A0U2RY08	Escherichia_phage	8.4e-24	71.8
WP_101139520.1\|3074321_3075560_+	DUF3596 domain-containing protein	A0A0U2JGI6	Escherichia_phage	4.6e-162	67.1
WP_004203988.1\|3075608_3076544_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.4e-139	94.1
WP_101837397.1\|3076589_3077963_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.6e-53	32.3
WP_008805152.1\|3078488_3079472_-	zinc transporter ZntB	NA	NA	NA	NA
WP_071787535.1\|3079516_3079732_+	hypothetical protein	NA	NA	NA	NA
WP_086893113.1\|3079750_3080494_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.2e-17	30.9

DBSCAN-SWA_7

3394230 : 3423055

Enterobacteria_phage(24.14%)

protease,holin,terminase,capsid,head,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105322435.1\|3394230_3396576_-	SGNH/GDSL hydrolase family protein	A0A286S1P0	Klebsiella_phage	6.0e-46	73.6
WP_101837568.1\|3396650_3399728_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	62.0
WP_063105766.1\|3399724_3400105_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	2.7e-57	80.2
WP_021441639.1\|3400117_3400594_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	3.7e-51	65.8
WP_004884312.1\|3400580_3401054_-	hypothetical protein	A0A286S298	Klebsiella_phage	1.1e-55	62.7
WP_101837569.1\|3401075_3404462_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	2.5e-303	57.7
WP_016530182.1\|3404522_3404756_-	hypothetical protein	K7PH16	Enterobacteria_phage	1.9e-08	47.2
WP_023317588.1\|3404829_3405135_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	4.7e-28	64.6
WP_101837570.1\|3405137_3405542_-\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	1.7e-28	52.3
WP_101837571.1\|3405572_3406277_-	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	1.6e-79	65.7
WP_025713381.1\|3406333_3406681_-	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	1.8e-31	61.9
WP_040241939.1\|3406677_3407127_-	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	5.1e-63	82.6
WP_072071528.1\|3407123_3407462_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.2e-37	67.0
WP_032734570.1\|3407474_3407807_-\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	8.8e-12	31.6
WP_038808150.1\|3407812_3408067_-	hypothetical protein	NA	NA	NA	NA
WP_063105769.1\|3408112_3409333_-\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	1.7e-140	64.0
WP_025713387.1\|3409342_3410050_-\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	2.2e-68	63.5
WP_038808148.1\|3410025_3411345_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	3.8e-138	58.9
WP_025713389.1\|3411351_3413088_-\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	1.3e-138	45.3
WP_038808146.1\|3413041_3413506_-\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	4.8e-48	62.7
WP_063105770.1\|3413685_3414027_-	HNH endonuclease	K7P7P6	Enterobacteria_phage	2.1e-48	73.9
WP_065908532.1\|3414719_3414965_-	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.6e-34	95.1
WP_077249691.1\|3415119_3415311_-	hypothetical protein	NA	NA	NA	NA
WP_065908530.1\|3416235_3416601_-	hypothetical protein	NA	NA	NA	NA
WP_063105772.1\|3416809_3417160_-	hypothetical protein	R9TPM9	Aeromonas_phage	1.1e-09	37.7
WP_065908528.1\|3417156_3417654_-	lysozyme	A0A1V0E5Q7	Salmonella_phage	2.3e-80	86.4
WP_017880269.1\|3417653_3417869_-\|holin	holin	A5LH82	Enterobacteria_phage	7.9e-30	87.3
WP_141691361.1\|3418905_3419025_+	small membrane protein	NA	NA	NA	NA
WP_004147997.1\|3419789_3419993_+	hypothetical protein	NA	NA	NA	NA
WP_101837299.1\|3420236_3420839_-	hypothetical protein	H9C175	Pectobacterium_phage	1.2e-75	67.5
WP_101837298.1\|3420855_3421887_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	6.2e-96	49.6
WP_101837297.1\|3421886_3422090_-	hypothetical protein	NA	NA	NA	NA
WP_101837296.1\|3422086_3422479_-	DNA-binding protein	K7PHB4	Enterobacterial_phage	1.5e-10	34.7
WP_101837295.1\|3422519_3422810_-	hypothetical protein	H6WRY6	Salmonella_phage	6.1e-17	56.9
WP_012542186.1\|3422821_3423055_-	DinI family protein	K7PM44	Enterobacteria_phage	1.7e-25	71.1

DBSCAN-SWA_8

3684082 : 3693530

Brazilian_cedratvirus(16.67%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086893000.1\|3684082_3685804_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	2.0e-14	34.0
WP_008805841.1\|3685843_3686548_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_001040187.1\|3686899_3687118_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_012542332.1\|3687236_3689516_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.7e-165	42.0
WP_002896520.1\|3689546_3689864_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896516.1\|3690189_3690411_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_008805839.1\|3690477_3692418_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.9e-38	41.0
WP_008805838.1\|3692414_3693530_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7

DBSCAN-SWA_9

4197110 : 4210998

Morganella_phage(20.0%)

integrase

attL 4208299:4208312|attR 4209622:4209635

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101837451.1\|4197110_4197779_+	dTMP kinase	G3MB74	Bacillus_virus	9.4e-29	36.4
WP_148253307.1\|4197781_4198702_+	hypothetical protein	NA	NA	NA	NA
WP_148253309.1\|4198706_4199333_+	hypothetical protein	NA	NA	NA	NA
WP_101837452.1\|4200342_4203099_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	1.5e-285	54.8
WP_101837453.1\|4203091_4203442_-	hypothetical protein	A0A1B5FPL8	Escherichia_phage	6.4e-37	68.2
WP_101837454.1\|4203452_4204097_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.5e-28	37.2
WP_100697858.1\|4204089_4204305_-	hypothetical protein	NA	NA	NA	NA
WP_101837455.1\|4204310_4204622_-	ubiquinol-cytochrome C reductase	NA	NA	NA	NA
WP_101837470.1\|4204618_4205323_-	ash family protein	Q8SBF3	Shigella_phage	9.9e-21	57.3
WP_100697854.1\|4205454_4205634_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_101837456.1\|4205626_4206469_-	antA/AntB antirepressor family protein	A0A1U9AJ93	Stx1_converting_phage	1.2e-20	44.0
WP_101837457.1\|4206482_4206914_-	hypothetical protein	A0A1W6JPH9	Morganella_phage	5.0e-23	44.7
WP_101837458.1\|4206913_4207111_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	3.0e-07	43.6
WP_101837459.1\|4207310_4208192_-	hypothetical protein	NA	NA	NA	NA
4208299:4208312	attL	NA	NA	NA	NA
WP_101837471.1\|4208323_4209550_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.8e-127	53.9
WP_004143017.1\|4210131_4210998_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
4209622:4209635	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP027063

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027063_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027063_1

14334-14858

Orphan

Consensus_repeat	Method
ATCCTCAACGCTGGCGGGTAA	CRT

12 spacers

The CRISPR arrays of NZ_CP027063_1

>merge|NZ_CP027063|1|14334-14858|CRT
ATTCTCAACGCTGGCGGGTAAACGGATCCGCTACCGGTGCTCATCCTCAACGCTGGCGGACAAACAGGGCCGCTGCCGGTGCTCATCCTCAACGCTGGCGGGTAAACGTGACCGCTGACGGTAGCTATCCTCAACGCTGGCGGGTAAGCGTGGCCGCTGACGGTGGCTATCCTCAACGCTGGCGGGTAAACGTGGCCGCTGCCGGTGCTCATCCTCAACGCTGGCGGGCAAACGGGGCCGCTGACGGTGGCTATCCTCAACGCTGGCGGGTAAACGTGGCCGCTGCCGGTGCTCATCCTCAACGCTGGCGGGTAAACGTGGCCGCTGACGGTGGCTATCCTCAACGCTGGCGGGTAAACGGGACCGCTGCCGGTAGTCATCCTCAACGCTGGCGGGTAAGCGTGGCCGCTGTCGGTGGTCACCGTCAACGCTGGCGGGTAAACAGGGGCGATACCAGTGACCATCCTCAACGCTGACGGGTAAGCGTGGTCGCTGCTGGTGGTCATCCTCAACGCTGGCGGGTAA

>NZ_CP027063|1|1|14334-14858|CRT
ATTCTCAACGCTGGCGGGTAA	ACGGATCCGCTACCGGTGCTC
ATCCTCAACGCTGGCGGACAA	ACAGGGCCGCTGCCGGTGCTC
ATCCTCAACGCTGGCGGGTAA	ACGTGACCGCTGACGGTAGCT
ATCCTCAACGCTGGCGGGTAA	GCGTGGCCGCTGACGGTGGCT
ATCCTCAACGCTGGCGGGTAA	ACGTGGCCGCTGCCGGTGCTC
ATCCTCAACGCTGGCGGGCAA	ACGGGGCCGCTGACGGTGGCT
ATCCTCAACGCTGGCGGGTAA	ACGTGGCCGCTGCCGGTGCTC
ATCCTCAACGCTGGCGGGTAA	ACGTGGCCGCTGACGGTGGCT
ATCCTCAACGCTGGCGGGTAA	ACGGGACCGCTGCCGGTAGTC
ATCCTCAACGCTGGCGGGTAA	GCGTGGCCGCTGTCGGTGGTC
ACCGTCAACGCTGGCGGGTAA	ACAGGGGCGATACCAGTGACC
ATCCTCAACGCTGACGGGTAA	GCGTGGTCGCTGCTGGTGGTC
ATCCTCAACGCTGGCGGGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027063.3\|WP_004181762.1\|7931_8396_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004026549.1\|8855_9815_+\|DNA-replication-protein	unknown	unknown	gnl\|CDD\|368456
NZ_CP027063.3\|WP_004026547.1\|7641_7884_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_017146617.1\|18180_18384_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_063445086.1\|17141_17594_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_065809477.1\|12737_12992_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368385
NZ_CP027063.3\|WP_004118061.1\|20258_20663_+\|DUF2251-domain-containing-protein	unknown	unknown	gnl\|CDD\|370778
NZ_CP027063.3\|WP_014386529.1\|11424_12561_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271180
NZ_CP027063.3\|WP_004196935.1\|21799_23299_-\|kinase	unknown	unknown	gnl\|CDD\|365850
NZ_CP027063.3\|WP_011251311.1\|23326_25060_-\|protein-phosphatase-2C-domain-containing-protein	unknown	unknown	gnl\|CDD\|379325
NZ_CP027063.3\|WP_004186900.1\|14999_15884_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004181760.1\|9811_10570_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004186935.1\|10566_10890_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_040210113.1\|17836_18151_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004118062.1\|19432_19711_+\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
NZ_CP027063.3\|WP_032720951.1\|20938_21421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004026552.1\|11041_11359_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_016946353.1\|13077_14145_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_024198103.1\|8405_8813_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027063.3\|WP_004181742.1\|19126_19339_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP027063.3\|WP_011251311.1\|23326_25060_-\|protein-phosphatase-2C-domain-containing-protein	gnl\|CDD\|379325	pfam13672, PP2C_2, Protein phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.	1.62286e-50
NZ_CP027063.3\|WP_004026549.1\|8855_9815_+\|DNA-replication-protein	gnl\|CDD\|368456	pfam05472, Ter, DNA replicatioN-terminus site-binding protein (Ter protein). This family contains several bacterial Ter proteins. The Ter protein specifically binds to DNA replicatioN-terminus sites on the host and plasmid genome and then blocks progress of the DNA replication fork.	3.25998e-13
NZ_CP027063.3\|WP_004118062.1\|19432_19711_+\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	1.52423e-24
NZ_CP027063.3\|WP_065809477.1\|12737_12992_+\|hypothetical-protein	gnl\|CDD\|368385	pfam05321, HHA, Haemolysin expression modulating protein. This family consists of haemolysin expression modulating protein (HHA) homologs. YmoA and Hha are highly similar bacterial proteins downregulating gene expression in Yersinia enterocolitica and Escherichia coli, respectively.	1.38841e-16
NZ_CP027063.3\|WP_004118061.1\|20258_20663_+\|DUF2251-domain-containing-protein	gnl\|CDD\|370778	pfam10008, DUF2251, Uncharacterized protein conserved in bacteria (DUF2251). Members of this family of hypothetical bacterial proteins have no known function.	1.22058e-44
NZ_CP027063.3\|WP_014386529.1\|11424_12561_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271180	cd00799, INT_Cre_C, C-terminal catalytic domain of Cre recombinase (also called integrase). Cre-like recombinases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.	5.31033e-12
NZ_CP027063.3\|WP_004196935.1\|21799_23299_-\|kinase	gnl\|CDD\|365850	pfam00069, Pkinase, Protein kinase domain.	1.82465e-10

>NZ_CP027063.3|WP_016946353.1|13077_14145_+|hypothetical-protein
MRRNAQKWIPFGFDTDSNKIVDIASVENGLSCNCICLICGTSLIARQGQNKKWHFSHSTEVKGVCSELTLQHIKKYIKVKIQEKKYLALPHLLQGKEKGIVNLKNLAGGGIVCGLNADLTGICNDTTIGIFINDTSEDIQPNPDLLAQTDQLALVEIDAVRIESIIAPYRENGEGIKMMDAIEKLLFVSEEAKKWIYHPMMKKVKHHTLHQYRRELSTSGNQILALIPHELPISMNALPSSPAQQWHHLRATINLLCRLSRSDIPQGSIAFEELVYYIPRLLEASESINVAAYERWYDFYIRKKGEGVLNEAEIEFLSFIVKIINWNLSIHNLPTFDSKQAFRDWFLLNDPNKSL
>NZ_CP027063.3|WP_065809477.1|12737_12992_+|hypothetical-protein
MLKSPNAHSSLRETYLLKFRKCSTTETLDRVFERILDKLNDEGGDINKITSLNGSYDHRRAEIYMKKNYDKIPASVWHLIPDEI
>NZ_CP027063.3|WP_014386529.1|11424_12561_-|tyrosine-type-recombinase/integrase
MTDKTKLVAISRTDDMSALDALKLLRFRRYNTARSQLRVTSVWSAWCARHGLTPFPVTAVDVERYINGLNGSVKMATISHFIACLSSVNSSLGFPDFRNVLIKALVQVWRARENEKKIVTGQALPFLISDLNILRRSLHKSDDLRDIRDLAMIWVGFETLLRNVEIRRIKTGDLKWQNDTSCYLLDVMRTKTSLSSNLTFQLSPQCSQHVRRLIETVEYTDTETFGHRFLFQPVNIHTNRYFPSTSSKLSRGKSIDRMLVKAGFSEGLLTQLQNESKVSREDVGMLSSNSLNQAFARLWGIAGKVGDSNRQSGRYRTWTGHSVRVGGAIELFKAGYSLEKITEMGNWSDPKMVFRYIRGYLASEKAMVSFMRNHLDDI
>NZ_CP027063.3|WP_004026552.1|11041_11359_+|hypothetical-protein
MNNKRTITTREQIKINGEIRERTATHIVTGAHGYETLCISGYIVEHNEMGEVIHNSEKLAEDLLPVTCPTCRVIWYHTHEFTLDDFDSLSGKGDFVVTDLKELNI
>NZ_CP027063.3|WP_004186935.1|10566_10890_+|hypothetical-protein
MTYAIFLLVTAVCAFGLNYLTNKICSGTGMINQSGGSNVHALRCITSFLLLLVSLWLPVKPAVINLAVEFAALVNFIASVTLYTVANFRAKRRLKKQRKEEKAAQKG
>NZ_CP027063.3|WP_004181760.1|9811_10570_+|hypothetical-protein
MSRILTGICEADPARRLYKVAVSRGNTFLSAKERFRVQVCFKNAITHPDEDRLLAELLTVHHFLADTSILWHMEQKTYACTTTWATTSTWLPEIYQRQASTPNVVKIIKFMHARFPGLKTVAETNEQGYEQALTSVDFEIPYWPVLPKFESDIGTIQVTIAGMIRYTETMSNKDCKTPLDLMIKSFKSGLIPIEKMPLSKTERLMPLNINTAGKIFTHATWPRCRYIFVPDEAGVMKLVNVVKLRLKPLEEK
>NZ_CP027063.3|WP_004026549.1|8855_9815_+|DNA-replication-protein
MNTDFAHYNEEQLRKLGELHSLLRHSDIGSSYLATLPEPRSVEELNPPQEINVTHSVPDVDTLVDIYRQQRVDKVHVRDEHYSTKITRKYPGFVVVRNNHDQVMSLVGEINRLRDKFADAVKAITHYQDSRSEILHQVYPWLVTLQVSRNIRIVTEQIRSLGFTWQIPVIHKFTRLETVIDRLRREITELQPDISLTKQDVERLKQERTEEIMMLSLLNDEVSHDDENLRKFRLIRESNFPAVNVNIRYTSPEDPDDVHGPYKLNFRAPLPLILFSEPGRFNPLKNYVKGERQKRGDFNEKYRSVLPRIGLVEVIRESK
>NZ_CP027063.3|WP_024198103.1|8405_8813_+|hypothetical-protein
MSKVHCISGITWKNSDSASFKVYASIAAVLSLGLVTATVRNYEILQLTVPYTWYVFFTAFWLLFPSFTVSFREREGRLFTSMGFYGLKLVTLDRPVSDGYWLVTMEKNRYRLVRVCRDGRRQPVWLTFKSLPEFV
>NZ_CP027063.3|WP_004181762.1|7931_8396_+|hypothetical-protein
MRTSKLNMILKEEIVLGIYSWLHMTPVSMLVRNITSDQGGDYAIVRFTVDSRGVQMGPKAQGQLLCSFGFNVKESCEADPKDGPGLIKAEMMNGVMQLVPECIELTDSQTQAIRKEVTVFNRVCAMQLLGGHGNARSLWEKEILPRMKVRRQLH
>NZ_CP027063.3|WP_004026547.1|7641_7884_+|hypothetical-protein
MKLNETSGVCDDVHLNTFVIDPATARRFECVKEMVRKQGFNNITEPEIIDAILSEITAADAAGIFIEYKLKATKPLLSTD
>NZ_CP027063.3|WP_004186900.1|14999_15884_-|hypothetical-protein
MANDNNQLALIITEQDKSSGEVIHLVPNSKQSIQPKSLLRLGVFVPTVKDGSDPMARGHVIDATTELCRLSSIAGEGYEKISIFGPRLDMDTDFKVWLGIVDTLANTFLEPDGTVRVNFIDFAFSCGLATKRVDSRLRKRFSDSLTRIQHTHFQFIKNSTVEGKKVKIDMSLVSTSYYDEGTDEVIIRPNPDLNTLYRVDGKTRLYLKILKTLSRKESAQALYLYLVELPDHFYRIGFDRLRERLQLTSHKGAQNATIKKALEQLDEAGFLKYTIEKNRGDYVLVILSRNKKVT
>NZ_CP027063.3|WP_063445086.1|17141_17594_+|hypothetical-protein
MFLGGRCYTAKQLEKDYLSEVAGYSDDRWEAPQRAARLAAAVKRYKTSEMLRFIFATIAYDPDPDLTPLAVKRLCQALFGRTGSQWLIVEIFGVKGRQHRSVDSTPEAVEKMATRYRHAAELHWAATLAEIERVKRNYQTLVKASRKGEG
>NZ_CP027063.3|WP_040210113.1|17836_18151_-|hypothetical-protein
MRTTSITLCLVLASFGVSAKILADPDLTYQANKTCAKRDVLELKVPLEANNPSSPTWGLDKGMVQATIDALKENPDIAPTDSVACQQAAIKQYRAGQKHYSKLR
>NZ_CP027063.3|WP_017146617.1|18180_18384_-|hypothetical-protein
MSHGKCEPTNTNAADYKLYARFDAGETLESVLASPPTTKHNKVTSEGNIRTEHRMWIAWRKKHPRPL
>NZ_CP027063.3|WP_004181742.1|19126_19339_+|hypothetical-protein
MNIEAKQFLTGSGRRVLTNEGRQGMGGVAGVGSSTEKMLGYVAEAVFENCGQLDNQQLDDIISWIQLYKS
>NZ_CP027063.3|WP_004118062.1|19432_19711_+|DUF1778-domain-containing-protein
MKPEVREAPISIRAKKSQRDLIDMAASLVSKSLTDFMLEVACREAQDILLDQRLFLLNHNQFKAFIEELDAPITPERKTRIDNLMNRKSQWE
>NZ_CP027063.3|WP_004118061.1|20258_20663_+|DUF2251-domain-containing-protein
MTILVTLQAQLIVGEEQVIKSLAPEGMLAAVFEDDGRTGYFYALDESLEGNPILDAVHIYNVEDISDAHIPSDVKIGWSEDSQKCVLLINGYPHAAFDFVGKNGYCRSGYPPPINKVWSVSGHEWSDSVDDFFR
>NZ_CP027063.3|WP_032720951.1|20938_21421_-|hypothetical-protein
MRTHKLNKSRKLYRSDNTTTRHYSINPGGEYRWGRNRKKAEDELLAKRETMHGRQKRGRDYTPLFYFLVKQIGQPWDKVFSEVCGRLDTTEPVFWLVALHEHQKRDLVRIGDSSFYPGLFVDGNGILQQVNPSIMGKDVKVTCRCCTHTYMGEPVPGKYE
>NZ_CP027063.3|WP_004196935.1|21799_23299_-|kinase
MANIITCKTKDGKTIQYVDEVIGSGSMKDVYFSPDKSYVVAFYHKPQNEQARERINMITGRYRQNIFEQTGGDYWKGLFCWPTDVVEHADKVGIVVPAYQQHFFFRYGSKNNDFLGIKGREKEGKWFASANNQNKFLDPRERGNTLNYLKVCILLTRAVRRMHAAGLCHSDLSYKNVLIDPELGHACIIDVDGLVVPGKYPPDVVGTPDFIAPEVVKTSHLPKDDPRRVLPSIATDRHALSVLIYMYLLFRHPLRGGKIHDIDDEVRDEALSMGERALFIEHPTDRSNAVKVNQVSSFSLPWADPQKIPYTIMGPYLKPLFDRAFIDGLHDPSKRPTADEWESALVKTVDLIQPCQNNDCDQKWYVFNGKTKPVCPYCGTPYKGKLPILNLYSSRKAGTFRPDDHRLMVWSGQSLYAWHVNRLIAPNERTTDEQKKRVGYFVFHNDQWWLVNEGLSGLISLPDRKTVGIGEKLLLEDNTQFILSSEDGGRLVVVQLVVN
>NZ_CP027063.3|WP_011251311.1|23326_25060_-|protein-phosphatase-2C-domain-containing-protein
MSEFITPEHKIIALILEASGEPTDADKVCCLGNIPDVALAVRQLRETVIQHCASEAIPAENTQTVSECLTQPFSDNILPPQNSGESEADRPEIEPVHAATALQGNDKQEAHSEMVDDTASEGVQGHTEEVPDATGVLQTEASVTAQPEDMDKTSPVVSDNLSADSAVSALRPGEVPQRVENKTSPAPGKVPEVFIMLPNARAGEPYDVRLEIATDTGVEAEITEVNFSQDIGLIFDINERRLQGTPGQSGDFELTVKWSCSSHRDNEKKLLFVVNPDPKSLWKVIDPPSDAPFYKKSIDHQSVCRSGIHIAGASRRGRSHEHVGSFRDDDYYLNFSDVSGWSVLLVADGAGSAKYSREGSRIVSETVGNYLFNQFKTEKGLEIKNRVLRWNSEDQRAVWEFMNHHFRQAAVLAVNNISSAAILAEDKVKSFSTTLLATVTFRDGADLFAASFWLGDGAIAAYGPAGKVRVLGTPDSGEYAGQTRFLDADAVSDAGFSKRISIGKWNDISHLVLMTDGVSDPWFETDNGLQNPQKWDRLMAELSPLLTDPEHASAQLVEWLNYFSPGNHDDRTIIVLW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123178-123198	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39435-39455	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145355-145375	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	149908-149928	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150034-150054	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	344909-344929	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174177-174197	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14355-14375	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	44604-44624	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	44856-44876	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196253-196273	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45776-45796	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	44971-44991	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45097-45117	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94321-94341	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94573-94593	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134244-134264	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134496-134516	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162441-162461	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162693-162713	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166114-166134	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	300152-300172	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301738-301758	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231659-231679	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76440-76460	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7577-7597	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94393-94413	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MF150122	Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence	2520-2540	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153396-153416	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1552-1572	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117202-117222	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1930-1950	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	2056-2076	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294561-294581	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294813-294833	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	123053-123073	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181694-181714	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134688-134708	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	115131-115151	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107420-107440	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121187-121207	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156508-156528	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156634-156654	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	6021-6041	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200923-200943	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	126002-126022	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	157194-157214	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	157320-157340	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	87176-87196	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	87302-87322	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120755-120775	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	141279-141299	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118677-118697	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118951-118971	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188302-188322	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20570-20590	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127895-127915	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196803-196823	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	91095-91115	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12875-12895	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	13127-13147	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1887-1907	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192511-192531	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1594-1614	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144560-144580	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1594-1614	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212268-212288	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164786-164806	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134261-134281	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197989-198009	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	160155-160175	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1510-1530	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117160-117180	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294771-294791	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	123011-123031	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181652-181672	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134646-134666	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	115089-115109	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107378-107398	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121145-121165	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174135-174155	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	344951-344971	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149413-149433	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5979-5999	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119200-119220	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118635-118655	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118909-118929	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20528-20548	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196761-196781	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	91053-91073	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	13085-13105	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1552-1572	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144518-144538	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118906-118926	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1552-1572	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212226-212246	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164744-164764	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134219-134239	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197947-197967	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39477-39497	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145397-145417	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14397-14417	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	44646-44666	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	44898-44918	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34024-34044	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94363-94383	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134286-134306	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134538-134558	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162483-162503	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166156-166176	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	300194-300214	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301780-301800	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231701-231721	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76482-76502	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7619-7639	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326765-326785	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94435-94455	0	1.0
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153438-153458	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117118-117138	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134604-134624	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	115047-115067	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174093-174113	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	344993-345013	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149371-149391	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5937-5957	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200839-200859	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125918-125938	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120671-120691	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119158-119178	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188218-188238	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20486-20506	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196719-196739	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	91011-91031	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1803-1823	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1510-1530	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118864-118884	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1510-1530	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212184-212204	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164702-164722	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197905-197925	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123262-123282	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39519-39539	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145439-145459	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14439-14459	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166198-166218	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463002-463022	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301822-301842	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231743-231763	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76524-76544	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7661-7681	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326807-326827	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94477-94497	0	1.0
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153480-153500	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123304-123324	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123850-123870	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39561-39581	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39981-40001	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145481-145501	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145901-145921	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345035-345055	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345497-345517	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173589-173609	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174051-174071	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14481-14501	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196566-196586	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94951-94971	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163071-163091	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166240-166260	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166702-166722	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463044-463064	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463464-463484	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301864-301884	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302326-302346	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231785-231805	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232205-232225	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76566-76586	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77028-77048	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7703-7723	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8123-8143	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326849-326869	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327311-327331	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94519-94539	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94981-95001	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153522-153542	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153564-153584	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154003-154023	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1258-1278	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1426-1446	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117076-117096	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294183-294203	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122927-122947	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134142-134162	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134562-134582	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114585-114605	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	115005-115025	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149329-149349	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5414-5434	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5895-5915	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200797-200817	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125330-125350	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125876-125896	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120083-120103	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120629-120649	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118696-118716	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119116-119136	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188176-188196	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19963-19983	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196215-196235	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196677-196697	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90969-90989	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12497-12517	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1761-1781	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118822-118842	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211722-211742	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212142-212162	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164240-164260	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164660-164680	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197401-197421	0	1.0
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197863-197883	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123346-123366	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123892-123912	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39603-39623	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40023-40043	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214404-214424	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329221-329241	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145523-145543	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145943-145963	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	12824-12844	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345077-345097	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345539-345559	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173547-173567	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174009-174029	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14523-14543	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14607-14627	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202796-202816	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217763-217783	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196608-196628	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196692-196712	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45944-45964	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94993-95013	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163113-163133	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166282-166302	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166744-166764	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463086-463106	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463506-463526	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301906-301926	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302368-302388	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231827-231847	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232247-232267	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76608-76628	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77070-77090	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7745-7765	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8165-8185	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326891-326911	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327353-327373	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41915-41935	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94561-94581	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95023-95043	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153606-153626	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154045-154065	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1384-1404	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294141-294161	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122885-122905	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181526-181546	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134100-134120	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134520-134540	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114543-114563	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114963-114983	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107252-107272	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201325-201345	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121019-121039	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5372-5392	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200755-200775	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125288-125308	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125834-125854	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120041-120061	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120587-120607	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118654-118674	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188134-188154	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19921-19941	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196173-196193	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196635-196655	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90927-90947	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12455-12475	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1719-1739	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1426-1446	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144392-144412	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1426-1446	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134199-134219	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211680-211700	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212100-212120	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	209567-209587	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198418-198438	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164198-164218	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164618-164638	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134093-134113	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139598-139618	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197359-197379	0	1.0
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197821-197841	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116805-116825	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123640-123660	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123934-123954	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1216-1236	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	212327-212347	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39771-39791	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40065-40085	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	75554-75574	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	75502-75522	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	109389-109409	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	209956-209976	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294099-294119	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294393-294413	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181087-181107	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181213-181233	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145691-145711	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145985-146005	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134058-134078	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134352-134372	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114501-114521	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114795-114815	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	106813-106833	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	106939-106959	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150748-150768	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	162141-162161	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120622-120642	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120748-120768	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	131337-131357	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	158952-158972	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	159204-159224	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103159-103179	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103285-103305	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281390-281410	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	77117-77137	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14565-14585	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235190-235210	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235316-235336	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	44108-44128	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252382-252402	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252508-252528	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34531-34551	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34657-34677	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155794-155814	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202544-202564	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117988-118008	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	118114-118134	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24422-24442	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24548-24568	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5330-5350	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5624-5644	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125246-125266	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125540-125560	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125635-125655	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125761-125781	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71007-71027	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71133-71153	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	218346-218366	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	146350-146370	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45275-45295	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296739-296759	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34318-34338	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196356-196376	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196650-196670	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86336-86356	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	281828-281848	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46257-46277	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46383-46403	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27806-27826	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27932-27952	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183458-183478	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183584-183604	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45769-45789	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94741-94761	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95035-95055	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119999-120019	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120293-120313	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134915-134935	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	164013-164033	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6696-6716	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6822-6842	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118612-118632	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118906-118926	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198233-198253	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198359-198379	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162861-162881	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163155-163175	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140901-140921	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140943-140963	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	182448-182468	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82220-82240	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82346-82366	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205886-205906	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1594-1614	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108380-108400	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108506-108526	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118298-118318	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135057-135077	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135183-135203	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	158958-158978	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463254-463274	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463548-463568	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108421-108441	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108547-108567	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19879-19899	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20173-20193	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161455-161475	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161581-161601	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139466-139486	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139592-139612	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231995-232015	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232289-232309	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127013-127033	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66604-66624	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	179746-179766	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216162-216182	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216288-216308	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262125-262145	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262251-262271	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7913-7933	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8207-8227	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12413-12433	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12707-12727	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190410-190430	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190536-190556	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192133-192153	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192175-192195	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	212360-212380	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	105596-105616	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161582-161602	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143953-143973	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144079-144099	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	77782-77802	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	113436-113456	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	227094-227114	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118612-118632	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203837-203857	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166498-166518	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166624-166644	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166750-166770	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173123-173143	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173249-173269	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211638-211658	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211932-211952	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164156-164176	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164450-164470	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1594-1614	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133654-133674	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133780-133800	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	1216-1236	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139850-139870	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MH255828	Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence	169375-169395	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194250-194270	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194376-194396	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159482-159502	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	134966-134986	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153793-153813	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154087-154107	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133103-133123	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1594-1614	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1468-1488	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164384-164404	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164510-164530	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	220941-220961	0	1.0
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221067-221087	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123346-123366	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123892-123912	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39603-39623	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40023-40043	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214404-214424	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329221-329241	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145523-145543	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145943-145963	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	12824-12844	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345077-345097	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345539-345559	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173547-173567	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174009-174029	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14523-14543	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14607-14627	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202796-202816	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217763-217783	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196608-196628	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196692-196712	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45944-45964	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94993-95013	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163113-163133	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166282-166302	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166744-166764	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463086-463106	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463506-463526	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301906-301926	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302368-302388	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231827-231847	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232247-232267	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76608-76628	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77070-77090	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7745-7765	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8165-8185	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326891-326911	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327353-327373	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41915-41935	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94561-94581	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95023-95043	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153606-153626	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154045-154065	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1384-1404	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294141-294161	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122885-122905	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181526-181546	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134100-134120	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134520-134540	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114543-114563	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114963-114983	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107252-107272	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201325-201345	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121019-121039	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5372-5392	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200755-200775	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125288-125308	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125834-125854	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120041-120061	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120587-120607	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118654-118674	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188134-188154	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19921-19941	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196173-196193	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196635-196655	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90927-90947	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12455-12475	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1719-1739	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1426-1446	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144392-144412	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1426-1446	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134199-134219	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211680-211700	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212100-212120	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	209567-209587	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198418-198438	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164198-164218	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164618-164638	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134093-134113	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139598-139618	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197359-197379	0	1.0
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197821-197841	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116763-116783	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123724-123744	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123766-123786	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123976-123996	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39897-39917	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40107-40127	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294057-294077	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294267-294287	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122488-122508	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122530-122550	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145817-145837	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146027-146047	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134016-134036	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134226-134246	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114459-114479	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114669-114689	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173673-173693	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173715-173735	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345371-345391	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345413-345433	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14649-14669	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5246-5266	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5540-5560	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125204-125224	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125414-125434	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125456-125476	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45107-45127	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196440-196460	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196482-196502	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196734-196754	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94867-94887	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95077-95097	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119957-119977	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120167-120187	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120209-120229	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134747-134767	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118528-118548	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118822-118842	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162987-163007	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163197-163217	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166576-166596	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166618-166638	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118423-118443	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463380-463400	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463590-463610	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19837-19857	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20089-20109	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302200-302220	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302242-302262	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232121-232141	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232331-232351	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196299-196319	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196341-196361	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76902-76922	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76944-76964	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8039-8059	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8249-8269	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12371-12391	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12581-12601	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327185-327205	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327227-327247	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1258-1278	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94855-94875	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94897-94917	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118528-118548	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211596-211616	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211806-211826	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164114-164134	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164324-164344	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197485-197505	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197527-197547	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153919-153939	0	1.0
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154129-154149	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1174-1194	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1216-1236	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116679-116699	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116721-116741	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	212159-212179	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	108885-108905	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	109221-109241	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	209788-209808	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	293973-293993	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294015-294035	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210408-210428	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210744-210764	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122404-122424	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122446-122466	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	180919-180939	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	133932-133952	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	133974-133994	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114375-114395	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114417-114437	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	106645-106665	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180337-180357	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180673-180693	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	161973-161993	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201409-201429	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	159142-159162	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	158700-158720	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	158007-158027	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	157498-157518	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	158784-158804	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102991-103011	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173295-173315	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173337-173357	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345749-345769	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345791-345811	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281222-281242	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235022-235042	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	43940-43960	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117820-117840	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24254-24274	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200336-200356	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125078-125098	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125120-125140	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125162-125182	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125467-125487	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70839-70859	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	217842-217862	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	218178-218198	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119831-119851	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119873-119893	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119915-119935	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	163515-163535	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	163845-163865	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6528-6548	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198065-198085	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140733-140753	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	181944-181964	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	182280-182300	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82052-82072	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205718-205738	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	212494-212514	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118130-118150	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187715-187735	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	158790-158810	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108253-108273	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19753-19773	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19795-19815	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161287-161307	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139298-139318	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	195921-195941	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	195963-195983	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180345-180365	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180639-180659	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180933-180953	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90717-90737	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12287-12307	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12329-12349	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190242-190262	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191965-191985	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1174-1194	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1216-1236	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	212192-212212	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161078-161098	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161414-161434	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143785-143805	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	77614-77634	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	112932-112952	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	113268-113288	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1174-1194	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1216-1236	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203334-203354	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203670-203690	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166330-166350	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172955-172975	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134283-134303	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211512-211532	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211554-211574	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198502-198522	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164030-164050	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164072-164092	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133486-133506	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139682-139702	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MH255828	Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence	169210-169230	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194082-194102	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197107-197127	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197149-197169	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1300-1320	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124018-124038	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124060-124080	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124102-124122	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124144-124164	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40149-40169	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40191-40211	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	75670-75690	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	76006-76026	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214320-214340	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329137-329157	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146069-146089	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146111-146131	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	131505-131525	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	77285-77305	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14691-14711	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252676-252696	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34825-34845	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202712-202732	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217679-217699	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	146518-146538	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45443-45463	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196776-196796	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46551-46571	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28100-28120	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183752-183772	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95119-95139	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95161-95181	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	135083-135103	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163239-163259	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163281-163301	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108674-108694	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166954-166974	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166996-167016	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135351-135371	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463632-463652	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463674-463694	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302578-302598	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302620-302640	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232373-232393	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232415-232435	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216456-216476	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77280-77300	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77322-77342	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262419-262439	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8291-8311	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8333-8353	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327563-327583	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327605-327625	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	105764-105784	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	106098-106118	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41831-41851	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95233-95253	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95275-95295	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	135134-135154	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154171-154191	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154213-154233	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133271-133291	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133607-133627	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164678-164698	0	1.0
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221235-221255	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1132-1152	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116637-116657	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124186-124206	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40233-40253	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	293931-293951	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122362-122382	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146153-146173	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	133890-133910	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114333-114353	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173253-173273	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345833-345853	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14733-14753	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149287-149307	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5204-5224	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125036-125056	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45485-45505	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196818-196838	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95203-95223	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119789-119809	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	135125-135145	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163323-163343	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	167038-167058	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118088-118108	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463716-463736	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19711-19731	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302662-302682	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232457-232477	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	195879-195899	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77364-77384	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90675-90695	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8375-8395	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12245-12265	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327647-327667	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1132-1152	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95317-95337	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1132-1152	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211470-211490	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	163988-164008	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197065-197085	0	1.0
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154255-154275	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	124228-124248	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40275-40295	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146195-146215	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345875-345895	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173211-173231	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14775-14795	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252886-252906	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	35035-35055	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45527-45547	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196860-196880	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46761-46781	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28310-28330	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183962-183982	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95245-95265	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	135167-135187	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163365-163385	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108884-108904	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	167080-167100	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NC_016980	Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence	125582-125602	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463758-463778	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302704-302724	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232499-232519	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216666-216686	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77406-77426	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262629-262649	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8417-8437	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327689-327709	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95359-95379	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154297-154317	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164888-164908	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221445-221465	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116595-116615	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	187538-187558	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	293889-293909	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122320-122340	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	133848-133868	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114291-114311	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120496-120516	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102781-102801	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281012-281032	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	234812-234832	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117610-117630	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24044-24064	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149245-149265	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5162-5182	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200126-200146	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	124994-125014	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125257-125277	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70629-70649	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296613-296633	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119747-119767	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6318-6338	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118444-118464	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	197855-197875	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140523-140543	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	81842-81862	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205508-205528	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118046-118066	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187295-187315	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108043-108063	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161077-161097	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139088-139108	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	195837-195857	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90633-90653	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12203-12223	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190032-190052	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191755-191775	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143575-143595	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118444-118464	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166120-166140	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172745-172765	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211428-211448	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	163946-163966	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133276-133296	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	193872-193892	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197023-197043	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1090-1110	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116553-116573	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40317-40337	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	187496-187516	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	293847-293867	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122278-122298	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146237-146257	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	133806-133826	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114249-114269	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120454-120474	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102739-102759	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	280970-280990	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14817-14837	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	234770-234790	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252928-252948	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	35077-35097	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117568-117588	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24002-24022	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149203-149223	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5120-5140	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200084-200104	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125215-125235	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70587-70607	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45569-45589	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296571-296591	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196902-196922	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46803-46823	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28352-28372	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	184004-184024	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95287-95307	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	135209-135229	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6276-6296	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118402-118422	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	197813-197833	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163407-163427	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140481-140501	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	81800-81820	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205466-205486	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108926-108946	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118004-118024	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135603-135623	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187253-187273	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NC_016980	Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence	125624-125644	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463800-463820	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108001-108021	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161035-161055	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139046-139066	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232541-232561	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216708-216728	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262671-262691	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90591-90611	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8459-8479	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12161-12181	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	189990-190010	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191713-191733	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143533-143553	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118402-118422	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166078-166098	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172703-172723	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211386-211406	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	163904-163924	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133234-133254	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	193830-193850	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154339-154359	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1048-1068	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164930-164950	0	1.0
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221487-221507	0	1.0
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150916-150936	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46509-46529	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45937-45957	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MF150122	Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence	2940-2960	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1048-1068	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155626-155646	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200378-200398	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34486-34506	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86168-86188	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140775-140795	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187757-187777	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	126845-126865	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192007-192027	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159356-159376	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326723-326743	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	75628-75648	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	75964-75984	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214278-214298	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329095-329115	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	131463-131483	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	77243-77263	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252634-252654	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34783-34803	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202670-202690	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217637-217657	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	146476-146496	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28058-28078	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183710-183730	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108632-108652	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135309-135329	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66772-66792	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216414-216434	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262377-262397	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	105722-105742	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	106056-106076	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41789-41809	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	135092-135112	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133229-133249	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133565-133585	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164636-164656	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221193-221213	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	212201-212221	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	108927-108947	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	109263-109283	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	209830-209850	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210450-210470	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210786-210806	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180379-180399	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180715-180735	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	162015-162035	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201451-201471	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	159184-159204	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	158742-158762	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	158049-158069	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	158826-158846	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	159078-159098	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103033-103053	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281264-281284	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235064-235084	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	43982-44002	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117862-117882	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24296-24316	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125509-125529	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70881-70901	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	217884-217904	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	218220-218240	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	211110-211130	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	163557-163577	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	163887-163907	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6570-6590	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198107-198127	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	181986-182006	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	182322-182342	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82094-82114	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205760-205780	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	212536-212556	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	158832-158852	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108295-108315	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161329-161349	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139340-139360	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180387-180407	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180681-180701	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	180975-180995	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190284-190304	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	212234-212254	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161120-161140	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161456-161476	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	77656-77676	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	112974-112994	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	113310-113330	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203376-203396	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203712-203732	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166372-166392	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172997-173017	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134325-134345	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198544-198564	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139724-139744	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MH255828	Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence	169252-169272	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194124-194144	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.1\|14355\|21\|NZ_CP027063\|CRT	14355-14375	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	157152-157172	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	157278-157298	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1888-1908	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	2014-2034	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	187622-187642	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210870-210890	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180799-180819	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	1393-1413	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103201-103221	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235232-235252	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156088-156108	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156466-156486	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156592-156612	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24464-24484	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200881-200901	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125960-125980	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125677-125697	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71049-71069	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296781-296801	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296865-296885	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296907-296927	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	87134-87154	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	87260-87280	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120713-120733	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6738-6758	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198275-198295	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82262-82282	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188260-188280	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108463-108483	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161497-161517	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139508-139528	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127433-127453	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127853-127873	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190452-190472	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1845-1865	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166540-166560	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166666-166686	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166792-166812	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173165-173185	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194292-194312	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198862-198882	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198904-198924	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198946-198966	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159945-159965	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159987-160007	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	160071-160091	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	160113-160133	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123220-123240	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	149950-149970	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150076-150096	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150454-150474	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252466-252486	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34615-34635	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45818-45838	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27890-27910	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183542-183562	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45013-45033	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45139-45159	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45517-45537	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108464-108484	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135141-135161	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66184-66204	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216246-216266	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262209-262229	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_MF150122	Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence	2562-2582	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164468-164488	1	0.952
NZ_CP027063_1	1.2\|14397\|21\|NZ_CP027063\|CRT	14397-14417	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221025-221045	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173379-173399	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345707-345727	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196005-196025	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197191-197211	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166912-166932	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302536-302556	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77238-77258	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327521-327541	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95191-95211	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122969-122989	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181610-181630	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107336-107356	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121103-121123	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144476-144496	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134177-134197	1	0.952
NZ_CP027063_1	1.3\|14439\|21\|NZ_CP027063\|CRT	14439-14459	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45860-45880	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123724-123744	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123766-123786	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123976-123996	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123808-123828	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39897-39917	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40107-40127	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39939-39959	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145817-145837	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146027-146047	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145859-145879	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345371-345391	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345413-345433	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173673-173693	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173715-173735	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345455-345475	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173631-173651	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14649-14669	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196440-196460	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196482-196502	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196734-196754	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196524-196544	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94867-94887	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95077-95097	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94909-94929	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162987-163007	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163197-163217	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163029-163049	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166576-166596	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166618-166638	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166660-166680	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463380-463400	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463590-463610	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463422-463442	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302200-302220	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302242-302262	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302284-302304	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232121-232141	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232331-232351	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232163-232183	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76902-76922	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76944-76964	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76986-77006	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8039-8059	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8249-8269	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8081-8101	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327185-327205	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327227-327247	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327269-327289	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94855-94875	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94897-94917	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94939-94959	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153919-153939	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154129-154149	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153961-153981	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116763-116783	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294057-294077	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294267-294287	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294225-294245	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122488-122508	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122530-122550	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134016-134036	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134226-134246	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134184-134204	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114459-114479	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114669-114689	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114627-114647	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5246-5266	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5540-5560	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5456-5476	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125204-125224	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125414-125434	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125456-125476	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125372-125392	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119957-119977	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120167-120187	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120209-120229	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120125-120145	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118528-118548	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118822-118842	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118738-118758	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19837-19857	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20089-20109	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20005-20025	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20444-20464	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196299-196319	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196341-196361	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196257-196277	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12371-12391	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12581-12601	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12539-12559	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118528-118548	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211596-211616	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211806-211826	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211764-211784	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164114-164134	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164324-164344	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164282-164302	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197485-197505	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197527-197547	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197443-197463	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45107-45127	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134747-134767	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	MF185718	Arthrobacter phage Colucci, complete genome	3327-3347	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118423-118443	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150496-150516	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150538-150558	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150622-150642	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150664-150684	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150790-150810	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34066-34086	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34192-34212	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34234-34254	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34360-34380	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	45902-45922	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45643-45663	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45685-45705	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45811-45831	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66226-66246	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66268-66288	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66394-66414	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66478-66498	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66520-66540	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66646-66666	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1174-1194	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1300-1320	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181568-181588	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	107294-107314	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	121061-121081	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155752-155772	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155878-155898	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155920-155940	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156004-156024	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156046-156066	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86294-86314	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86420-86440	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86462-86482	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86546-86566	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86672-86692	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86714-86734	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	126971-126991	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127097-127117	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127139-127159	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127223-127243	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127349-127369	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127391-127411	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144434-144454	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	134135-134155	1	0.952
NZ_CP027063_1	1.4\|14481\|21\|NZ_CP027063\|CRT	14481-14501	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159609-159629	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214362-214382	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329179-329199	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	12782-12802	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202754-202774	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217721-217741	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46593-46613	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41873-41893	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122572-122592	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201367-201387	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5853-5873	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200294-200314	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119074-119094	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187463-187483	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187673-187693	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20402-20422	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143743-143763	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134241-134261	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	209609-209629	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198460-198480	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133444-133464	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139640-139660	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252718-252738	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252466-252486	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34867-34887	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34615-34635	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28142-28162	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27890-27910	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183794-183814	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183542-183562	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108716-108736	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108464-108484	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135393-135413	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135141-135161	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216498-216518	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216246-216266	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262461-262481	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262209-262229	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164720-164740	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164468-164488	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221277-221297	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221025-221045	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102949-102969	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103201-103221	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281180-281200	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	234980-235000	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235232-235252	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117778-117798	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24212-24232	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24464-24484	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125425-125445	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125677-125697	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70797-70817	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71049-71069	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6486-6506	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6738-6758	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198023-198043	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198275-198295	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140691-140711	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82010-82030	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82262-82282	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205676-205696	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108211-108231	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108463-108483	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161245-161265	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161497-161517	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139256-139276	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139508-139528	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190200-190220	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190452-190472	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191923-191943	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118780-118800	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166288-166308	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166540-166560	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166666-166686	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166792-166812	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172913-172933	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173165-173185	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194040-194060	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194292-194312	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150454-150474	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150580-150600	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34150-34170	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45517-45537	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45601-45621	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66184-66204	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66310-66330	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66436-66456	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117034-117054	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1384-1404	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	187622-187642	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210870-210890	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180799-180819	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	1393-1413	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155962-155982	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156088-156108	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296781-296801	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296865-296885	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296907-296927	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86504-86524	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86630-86650	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127181-127201	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127307-127327	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127433-127453	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198862-198882	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198904-198924	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198946-198966	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116763-116783	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123724-123744	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123766-123786	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123976-123996	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1300-1320	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39897-39917	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40107-40127	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294057-294077	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294267-294287	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145817-145837	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	146027-146047	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134016-134036	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134226-134246	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114459-114479	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114669-114689	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150538-150558	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150664-150684	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102907-102927	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281138-281158	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14649-14669	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	234938-234958	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252760-252780	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34909-34929	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155878-155898	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156004-156024	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117736-117756	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24170-24190	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5246-5266	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5498-5518	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5540-5560	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125204-125224	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125414-125434	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125456-125476	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125383-125403	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70755-70775	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45107-45127	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34234-34254	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196440-196460	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196482-196502	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196734-196754	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86420-86440	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86546-86566	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86672-86692	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46635-46655	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28184-28204	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183836-183856	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45685-45705	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94867-94887	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95077-95097	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119957-119977	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120167-120187	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120209-120229	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134747-134767	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6444-6464	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118528-118548	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118780-118800	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118822-118842	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	197981-198001	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162987-163007	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163197-163217	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140649-140669	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	81968-81988	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205634-205654	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108758-108778	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118423-118443	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135435-135455	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463380-463400	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463590-463610	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108169-108189	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19837-19857	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20089-20109	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161203-161223	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139214-139234	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232121-232141	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232331-232351	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127097-127117	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127223-127243	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127349-127369	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66268-66288	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66394-66414	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66520-66540	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216540-216560	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262503-262523	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8039-8059	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8249-8269	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12371-12391	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12581-12601	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190158-190178	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191881-191901	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143701-143721	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118528-118548	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166246-166266	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172871-172891	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211596-211616	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211806-211826	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164114-164134	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164324-164344	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133402-133422	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	193998-194018	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159609-159629	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153919-153939	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154129-154149	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164762-164782	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221319-221339	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122488-122508	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122530-122550	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173673-173693	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173715-173735	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345371-345391	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345413-345433	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200252-200272	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166576-166596	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166618-166638	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187421-187441	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187631-187651	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302200-302220	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302242-302262	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196299-196319	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196341-196361	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76902-76922	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76944-76964	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327185-327205	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327227-327247	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94855-94875	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94897-94917	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197485-197505	1	0.952
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197527-197547	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	214362-214382	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	329179-329199	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	12782-12802	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202754-202774	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	217721-217741	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46593-46613	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP042975	Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence	41873-41893	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122572-122592	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	201367-201387	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5853-5873	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200294-200314	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119074-119094	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187463-187483	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	187673-187693	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20402-20422	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143743-143763	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	134241-134261	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	209609-209629	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	198460-198480	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133444-133464	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139640-139660	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252718-252738	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252466-252486	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34867-34887	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34615-34635	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	28142-28162	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27890-27910	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183794-183814	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183542-183562	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108716-108736	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108464-108484	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135393-135413	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135141-135161	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216498-216518	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216246-216266	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262461-262481	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262209-262229	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164720-164740	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164468-164488	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221277-221297	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221025-221045	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	102949-102969	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103201-103221	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281180-281200	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	234980-235000	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235232-235252	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117778-117798	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24212-24232	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24464-24484	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125425-125445	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125677-125697	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	70797-70817	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71049-71069	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6486-6506	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6738-6758	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198023-198043	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198275-198295	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140691-140711	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82010-82030	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82262-82282	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205676-205696	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108211-108231	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108463-108483	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161245-161265	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161497-161517	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139256-139276	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139508-139528	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190200-190220	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190452-190472	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	191923-191943	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118780-118800	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166288-166308	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166540-166560	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166666-166686	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166792-166812	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	172913-172933	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173165-173185	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1342-1362	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK413719	Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194040-194060	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194292-194312	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150454-150474	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150580-150600	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34150-34170	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45517-45537	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45601-45621	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66184-66204	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66310-66330	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66436-66456	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117034-117054	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1384-1404	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1510-1530	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	187622-187642	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	210870-210890	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	180799-180819	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	1393-1413	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155962-155982	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	156088-156108	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296781-296801	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296865-296885	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296907-296927	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86504-86524	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86630-86650	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127181-127201	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127307-127327	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127433-127453	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198862-198882	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198904-198924	1	0.952
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	198946-198966	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	117076-117096	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	116805-116825	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123304-123324	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123850-123870	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123640-123660	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	123934-123954	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39561-39581	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39981-40001	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39771-39791	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	39855-39875	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	40065-40085	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294183-294203	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294099-294119	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294309-294329	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	294393-294413	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122927-122947	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145481-145501	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145901-145921	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145691-145711	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145775-145795	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	145985-146005	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134142-134162	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134562-134582	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134058-134078	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134268-134288	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	134352-134372	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114585-114605	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	115005-115025	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114501-114521	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114711-114731	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	114795-114815	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173589-173609	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	174051-174071	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345035-345055	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345497-345517	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173379-173399	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345707-345727	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14481-14501	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	14565-14585	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5414-5434	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5895-5915	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5330-5350	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP013713	Klebsiella pneumoniae strain J1 plasmid 2, complete sequence	5624-5644	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125330-125350	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125876-125896	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125246-125266	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	125540-125560	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026172	Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence	45275-45295	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196566-196586	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196356-196376	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	196650-196670	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94951-94971	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94741-94761	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	94825-94845	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	95035-95055	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120083-120103	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120629-120649	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	119999-120019	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	120293-120313	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026398	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence	134915-134935	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118696-118716	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	119116-119136	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118612-118632	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118906-118926	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163071-163091	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162861-162881	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	162945-162965	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	163155-163175	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166240-166260	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166702-166722	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	166912-166932	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052539	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence	118298-118318	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463044-463064	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463464-463484	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463254-463274	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463338-463358	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	463548-463568	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19963-19983	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19879-19899	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20047-20067	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	20173-20193	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	301864-301884	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302326-302346	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302536-302556	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231785-231805	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232205-232225	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	231995-232015	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232079-232099	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	232289-232309	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196215-196235	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196677-196697	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	196005-196025	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	76566-76586	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77028-77048	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77238-77258	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7703-7723	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8123-8143	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7913-7933	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	7997-8017	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	8207-8227	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12497-12517	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12413-12433	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12623-12643	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	12707-12727	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	326849-326869	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327311-327331	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327521-327541	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94519-94539	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	94981-95001	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95191-95211	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118822-118842	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118612-118632	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211722-211742	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	212142-212162	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211638-211658	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211848-211868	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	211932-211952	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164240-164260	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164660-164680	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164156-164176	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164366-164386	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	164450-164470	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197401-197421	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197863-197883	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	197191-197211	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153522-153542	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153564-153584	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154003-154023	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153793-153813	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	153877-153897	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032223	Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence	154087-154107	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1300-1320	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050068	Klebsiella aerogenes strain 035 plasmid p35, complete sequence	1426-1446	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP041093	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence	149329-149349	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	200797-200817	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	188176-188196	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90969-90989	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	1761-1781	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1258-1278	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	212327-212347	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	75554-75574	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	75502-75522	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	109389-109409	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	209956-209976	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181087-181107	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	181213-181233	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	106813-106833	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	106939-106959	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150748-150768	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	162141-162161	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120622-120642	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052325	Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence	120748-120768	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	131337-131357	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	158952-158972	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	159204-159224	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103159-103179	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	103285-103305	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	281390-281410	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	77117-77137	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235190-235210	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	235316-235336	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	44108-44128	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252382-252402	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	252508-252528	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34531-34551	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	34657-34677	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155794-155814	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	202544-202564	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	117988-118008	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	118114-118134	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24422-24442	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	24548-24568	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125635-125655	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	125761-125781	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71007-71027	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	71133-71153	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	218346-218366	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	146350-146370	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296739-296759	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34318-34338	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86336-86356	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	281828-281848	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46257-46277	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	46383-46403	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27806-27826	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	27932-27952	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183458-183478	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	183584-183604	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45769-45789	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	164013-164033	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6696-6716	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	6822-6842	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198233-198253	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	198359-198379	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140901-140921	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	140943-140963	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	182448-182468	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82220-82240	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	82346-82366	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	205886-205906	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	1594-1614	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108380-108400	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	108506-108526	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135057-135077	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135183-135203	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	158958-158978	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108421-108441	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	108547-108567	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161455-161475	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	161581-161601	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139466-139486	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	139592-139612	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	127013-127033	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66604-66624	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	179746-179766	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216162-216182	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	216288-216308	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262125-262145	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	262251-262271	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190410-190430	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	190536-190556	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192133-192153	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	192175-192195	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	212360-212380	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	105596-105616	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	161582-161602	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	143953-143973	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	144079-144099	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	77782-77802	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	113436-113456	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	227094-227114	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	203837-203857	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166498-166518	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166624-166644	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	166750-166770	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173123-173143	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	173249-173269	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	1594-1614	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133654-133674	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	133780-133800	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	1216-1236	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	139850-139870	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MH255828	Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence	169375-169395	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194250-194270	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	194376-194396	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	HG918041	Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence	159482-159502	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	134966-134986	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	133103-133123	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	1594-1614	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	1468-1488	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164384-164404	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	164510-164530	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	220941-220961	1	0.952
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	221067-221087	1	0.952
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	90759-90779	1	0.952
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	296823-296843	1	0.952
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	54843-54863	1	0.952
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	135561-135581	1	0.952
NZ_CP027063_1	1.11\|14775\|21\|NZ_CP027063\|CRT	14775-14795	21	NZ_CP032915	Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence	19669-19689	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	173169-173189	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP020848	Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence	345917-345937	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	482993-483013	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	564238-564258	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP018961	Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence	167122-167142	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP011314	Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence	302746-302766	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP044377	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence	195795-195815	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP044381	Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence	77448-77468	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP021699	Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence	327731-327751	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	1048-1068	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP044386	Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence	95401-95421	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_CP034046	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence	1048-1068	1	0.952
NZ_CP027063_1	1.12\|14817\|21\|NZ_CP027063\|CRT	14817-14837	21	NZ_MH733011	Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence	196981-197001	1	0.952
NZ_CP027063_1	1.5\|14523\|21\|NZ_CP027063\|CRT	14523-14543	21	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	732097-732117	2	0.905
NZ_CP027063_1	1.6\|14565\|21\|NZ_CP027063\|CRT	14565-14585	21	CP052400	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence	122614-122634	2	0.905
NZ_CP027063_1	1.7\|14607\|21\|NZ_CP027063\|CRT	14607-14627	21	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	732097-732117	2	0.905
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052327	Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence	118486-118506	2	0.905
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	CP052240	Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence	118486-118506	2	0.905
NZ_CP027063_1	1.8\|14649\|21\|NZ_CP027063\|CRT	14649-14669	21	MF185718	Arthrobacter phage Colucci, complete genome	3327-3347	2	0.905
NZ_CP027063_1	1.9\|14691\|21\|NZ_CP027063\|CRT	14691-14711	21	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	367841-367861	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_KX029332	Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence	1174-1194	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_LN824134	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671	150790-150810	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP015501	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence	155752-155772	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP042866	Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence	34360-34380	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP031582	Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence	86294-86314	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP004000	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence	45811-45831	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP032208	Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence	126971-126991	2	0.905
NZ_CP027063_1	1.10\|14733\|21\|NZ_CP027063\|CRT	14733-14753	21	NZ_CP027156	Klebsiella pneumoniae strain AR_0363 plasmid unnamed4	66646-66666	2	0.905

1. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

2. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

3. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

4. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

5. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

6. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

7. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

8. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

9. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

10. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

11. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

12. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

13. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

14. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

15. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

16. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

17. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

18. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

19. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

20. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

21. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

22. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

23. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

24. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

25. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

26. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

27. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

28. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MF150122 (Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

29. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

30. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

31. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

32. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

33. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

34. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

35. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

36. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

37. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

38. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

39. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

40. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

41. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

42. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

43. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

44. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

45. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

46. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

47. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

48. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

49. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

50. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

51. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

52. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

53. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

54. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

55. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

56. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

57. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

58. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

59. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

60. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

61. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

62. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

63. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

64. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

65. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

66. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

67. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

68. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

69. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

70. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

71. spacer 1.1|14355|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 0, identity: 1.0

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctaccggtgctc	Protospacer
*********************

72. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

73. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

74. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

75. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

76. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

77. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

78. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

79. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

80. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

81. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

82. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

83. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

84. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

85. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

86. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

87. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

88. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

89. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

90. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

91. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

92. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

93. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

94. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

95. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

96. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

97. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

98. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

99. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

100. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

101. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

102. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

103. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

104. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

105. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

106. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

107. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

108. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

109. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

110. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

111. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

112. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

113. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

114. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

115. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

116. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

117. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

118. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccggtgctc	Protospacer
*********************

119. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

120. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

121. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

122. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

123. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

124. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

125. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

126. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

127. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

128. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

129. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

130. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

131. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

132. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

133. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

134. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

135. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

136. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

137. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

138. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

139. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

140. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

141. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

142. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

143. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

144. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

145. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

146. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

147. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

148. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

149. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

150. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

151. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

152. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

153. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtagct	Protospacer
*********************

154. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

155. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

156. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

157. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

158. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

159. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

160. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

161. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

162. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

163. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

164. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

165. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

166. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

167. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

168. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

169. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

170. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

171. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

172. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

173. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

174. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

175. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

176. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

177. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

178. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

179. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

180. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

181. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

182. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

183. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

184. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

185. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

186. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

187. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

188. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

189. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

190. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

191. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

192. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

193. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

194. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

195. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

196. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

197. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

198. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

199. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

200. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

201. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

202. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

203. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

204. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

205. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

206. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

207. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

208. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

209. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

210. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

211. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

212. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

213. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

214. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

215. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

216. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

217. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

218. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

219. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

220. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

221. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

222. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
*********************

223. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

224. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

225. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

226. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

227. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

228. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

229. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

230. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

231. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

232. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

233. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

234. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

235. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

236. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

237. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

238. spacer 1.5|14523|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

239. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

240. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

241. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

242. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

243. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

244. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

245. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

246. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

247. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

248. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

249. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

250. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

251. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

252. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

253. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

254. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

255. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

256. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

257. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

258. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

259. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

260. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

261. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

262. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

263. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

264. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

265. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

266. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

267. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

268. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

269. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

270. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

271. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

272. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

273. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

274. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

275. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

276. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

277. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

278. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

279. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

280. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

281. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

282. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

283. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

284. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

285. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

286. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

287. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

288. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

289. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

290. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

291. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

292. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

293. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

294. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

295. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

296. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

297. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

298. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

299. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

300. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

301. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

302. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

303. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

304. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

305. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

306. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

307. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

308. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

309. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

310. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

311. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

312. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

313. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

314. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

315. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

316. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

317. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

318. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

319. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

320. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

321. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

322. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

323. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

324. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

325. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

326. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

327. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

328. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

329. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

330. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

331. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

332. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

333. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

334. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

335. spacer 1.6|14565|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

336. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

337. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

338. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

339. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

340. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

341. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

342. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

343. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

344. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

345. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

346. spacer 1.6|14565|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

347. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

348. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

349. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

350. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

351. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

352. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

353. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

354. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

355. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

356. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

357. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

358. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

359. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

360. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

361. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

362. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

363. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

364. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

365. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

366. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

367. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

368. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

369. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

370. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

371. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

372. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

373. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

374. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

375. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

376. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

377. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

378. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

379. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

380. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

381. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

382. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

383. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

384. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

385. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

386. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

387. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

388. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

389. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

390. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

391. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

392. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

393. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

394. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

395. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

396. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

397. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

398. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

399. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

400. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

401. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

402. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

403. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

404. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

405. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

406. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

407. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

408. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

409. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

410. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

411. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

412. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

413. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

414. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

415. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

416. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

417. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

418. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

419. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

420. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

421. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

422. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

423. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

424. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

425. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

426. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

427. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

428. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

429. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

430. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

431. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

432. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

433. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

434. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

435. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

436. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

437. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

438. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

439. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

440. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

441. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

442. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

443. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

444. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

445. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

446. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

447. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

448. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

449. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

450. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

451. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

452. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

453. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

454. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

455. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

456. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MH255828 (Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

457. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

458. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

459. spacer 1.6|14565|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

460. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

461. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

462. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

463. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

464. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

465. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

466. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

467. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

468. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

469. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

470. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 0, identity: 1.0

acggggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*********************

471. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

472. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

473. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

474. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

475. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

476. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

477. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

478. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

479. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

480. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

481. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

482. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

483. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

484. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

485. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

486. spacer 1.7|14607|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

487. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

488. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

489. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

490. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

491. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

492. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

493. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

494. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

495. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

496. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

497. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

498. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

499. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

500. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

501. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

502. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

503. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

504. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

505. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

506. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

507. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

508. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

509. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

510. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

511. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

512. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

513. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

514. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

515. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

516. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

517. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

518. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

519. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

520. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

521. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

522. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

523. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

524. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

525. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

526. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

527. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

528. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

529. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

530. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

531. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

532. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

533. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

534. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

535. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

536. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

537. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

538. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

539. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

540. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

541. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

542. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

543. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

544. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

545. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

546. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

547. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

548. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

549. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

550. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctc	Protospacer
*********************

551. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

552. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

553. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

554. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

555. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

556. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

557. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

558. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

559. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

560. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

561. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

562. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

563. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

564. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

565. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

566. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

567. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

568. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

569. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

570. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

571. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

572. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

573. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

574. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

575. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

576. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

577. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

578. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

579. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

580. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

581. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

582. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

583. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

584. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

585. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

586. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

587. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

588. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

589. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

590. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

591. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

592. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

593. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

594. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

595. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

596. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

597. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

598. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

599. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

600. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

601. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

602. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

603. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

604. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

605. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

606. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

607. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

608. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

609. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

610. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

611. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

612. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

613. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

614. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

615. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

616. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

617. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

618. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

619. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

620. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

621. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

622. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

623. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*********************

624. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

625. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

626. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

627. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

628. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

629. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

630. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

631. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

632. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

633. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

634. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

635. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

636. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

637. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

638. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

639. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

640. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

641. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

642. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

643. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

644. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

645. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

646. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

647. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

648. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

649. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

650. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

651. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

652. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

653. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

654. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

655. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

656. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

657. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

658. spacer 1.9|14691|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

659. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

660. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

661. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

662. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

663. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

664. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

665. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

666. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

667. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

668. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

669. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

670. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

671. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

672. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

673. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

674. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

675. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

676. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

677. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

678. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

679. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

680. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

681. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

682. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

683. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

684. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

685. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

686. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

687. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

688. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

689. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

690. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

691. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

692. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

693. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

694. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

695. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

696. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

697. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

698. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

699. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

700. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

701. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

702. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

703. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

704. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

705. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

706. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

707. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

708. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

709. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

710. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

711. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

712. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

713. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

714. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

715. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

716. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

717. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

718. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

719. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

720. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

721. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

722. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

723. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

724. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

725. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

726. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

727. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

728. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

729. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

730. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MH255828 (Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

731. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

732. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

733. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

734. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

735. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

736. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

737. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

738. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

739. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

740. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

741. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

742. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

743. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

744. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

745. spacer 1.9|14691|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

746. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

747. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

748. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

749. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

750. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

751. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

752. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

753. spacer 1.9|14691|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

754. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

755. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

756. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

757. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

758. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

759. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

760. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

761. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

762. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

763. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

764. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

765. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

766. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

767. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

768. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

769. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

770. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

771. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

772. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

773. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

774. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

775. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

776. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

777. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

778. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

779. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

780. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

781. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

782. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

783. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

784. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

785. spacer 1.9|14691|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

786. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

787. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

788. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

789. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

790. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

791. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

792. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

793. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

794. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

795. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 0, identity: 1.0

acgggaccgctgccggtagtc	CRISPR spacer
acgggaccgctgccggtagtc	Protospacer
*********************

796. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

797. spacer 1.10|14733|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

798. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

799. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

800. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

801. spacer 1.10|14733|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

802. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

803. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

804. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

805. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

806. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

807. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

808. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

809. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

810. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

811. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

812. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

813. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

814. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

815. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

816. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

817. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

818. spacer 1.10|14733|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

819. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

820. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

821. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

822. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

823. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

824. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

825. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

826. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

827. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

828. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

829. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

830. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

831. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

832. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

833. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

834. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

835. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggtc	Protospacer
*********************

836. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

837. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

838. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

839. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

840. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

841. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

842. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

843. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

844. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

845. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

846. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

847. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

848. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

849. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

850. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

851. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

852. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

853. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

854. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NC_016980 (Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

855. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

856. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

857. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

858. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

859. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

860. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

861. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

862. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

863. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

864. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

865. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

866. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

867. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

868. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

869. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

870. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

871. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

872. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

873. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

874. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

875. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

876. spacer 1.11|14775|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

877. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

878. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

879. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

880. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

881. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

882. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

883. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

884. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

885. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

886. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

887. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

888. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

889. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

890. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

891. spacer 1.11|14775|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

892. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

893. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

894. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

895. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

896. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

897. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

898. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

899. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

900. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

901. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

902. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

903. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

904. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

905. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

906. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

907. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

908. spacer 1.11|14775|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

909. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

910. spacer 1.11|14775|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

911. spacer 1.11|14775|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

912. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

913. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

914. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

915. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

916. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

917. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

918. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

919. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

920. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

921. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

922. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 0, identity: 1.0

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccagtgacc	Protospacer
*********************

923. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

924. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

925. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

926. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

927. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

928. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

929. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

930. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

931. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

932. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

933. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

934. spacer 1.12|14817|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

935. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

936. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

937. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

938. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

939. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

940. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

941. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

942. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

943. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

944. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

945. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

946. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

947. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

948. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

949. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

950. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

951. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

952. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

953. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

954. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

955. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

956. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

957. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

958. spacer 1.12|14817|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

959. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

960. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

961. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

962. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

963. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

964. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

965. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

966. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NC_016980 (Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

967. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

968. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

969. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

970. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

971. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

972. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

973. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

974. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

975. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

976. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

977. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

978. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

979. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

980. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

981. spacer 1.12|14817|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

982. spacer 1.12|14817|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

983. spacer 1.12|14817|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

984. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

985. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

986. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

987. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

988. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

989. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

990. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

991. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

992. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

993. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

994. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

995. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

996. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtggtc	Protospacer
*********************

997. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

998. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

999. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1000. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MF150122 (Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1001. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1002. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1003. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1004. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1005. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1006. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1007. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1008. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1009. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1010. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1011. spacer 1.1|14355|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1012. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
ccggatccgctaccggtgctc	Protospacer
 ********************

1013. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1014. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1015. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1016. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1017. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1018. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1019. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1020. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1021. spacer 1.1|14355|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1022. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1023. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1024. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1025. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1026. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1027. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1028. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1029. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1030. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1031. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1032. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1033. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1034. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1035. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1036. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1037. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1038. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1039. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1040. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1041. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1042. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1043. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1044. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1045. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1046. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1047. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1048. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1049. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1050. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1051. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1052. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1053. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1054. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1055. spacer 1.1|14355|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1056. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1057. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1058. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1059. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1060. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1061. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1062. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1063. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1064. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1065. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1066. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1067. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1068. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1069. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1070. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1071. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1072. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1073. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1074. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1075. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1076. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1077. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1078. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1079. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1080. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1081. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1082. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1083. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1084. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1085. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1086. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1087. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1088. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1089. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1090. spacer 1.1|14355|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1091. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1092. spacer 1.1|14355|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1093. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1094. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1095. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1096. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1097. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1098. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MH255828 (Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1099. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1100. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1101. spacer 1.1|14355|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 1, identity: 0.952

acggatccgctaccggtgctc	CRISPR spacer
acggatccgctgccggtgctc	Protospacer
***********.*********

1102. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1103. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1104. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1105. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1106. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1107. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1108. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1109. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1110. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1111. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1112. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1113. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1114. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1115. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1116. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1117. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1118. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1119. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1120. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1121. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1122. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1123. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1124. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1125. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1126. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1127. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1128. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1129. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1130. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1131. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1132. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1133. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1134. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1135. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1136. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1137. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1138. spacer 1.2|14397|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1139. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1140. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1141. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1142. spacer 1.2|14397|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1143. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1144. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1145. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1146. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1147. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1148. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1149. spacer 1.2|14397|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1150. spacer 1.2|14397|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctgccagtgctc	Protospacer
**************.******

1151. spacer 1.2|14397|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acagggccgctaccggtgctc	Protospacer
***********.*********

1152. spacer 1.2|14397|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1153. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1154. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acaggaccgctgccggtgctc	Protospacer
*****.***************

1155. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1156. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1157. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1158. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1159. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1160. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acagggccactgccggtgctc	Protospacer
********.************

1161. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1162. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1163. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1164. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1165. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1166. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1167. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1168. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1169. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1170. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1171. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_MF150122 (Klebsiella pneumoniae strain A64477 plasmid pKP64477b, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
aaagggccgctgccggtgctc	Protospacer
* *******************

1172. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1173. spacer 1.2|14397|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acagggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
**.******************

1174. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1175. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1176. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1177. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1178. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1179. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1180. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1181. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1182. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1183. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****************.***

1184. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
atgtgaccgctgacggtagct	Protospacer
*.*******************

1185. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
atgtgaccgctgacggtagct	Protospacer
*.*******************

1186. spacer 1.3|14439|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1187. spacer 1.3|14439|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1188. spacer 1.3|14439|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1189. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1190. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1191. spacer 1.3|14439|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acgtgaccgctgacggtagct	CRISPR spacer
acgtgaccgctgatggtagct	Protospacer
*************.*******

1192. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1193. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1194. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1195. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1196. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1197. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1198. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1199. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1200. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1201. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1202. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1203. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1204. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1205. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1206. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1207. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1208. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1209. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1210. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1211. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1212. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1213. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1214. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1215. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1216. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1217. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1218. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1219. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1220. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1221. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1222. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1223. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1224. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1225. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1226. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1227. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1228. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1229. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1230. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1231. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1232. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1233. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1234. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1235. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1236. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1237. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1238. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1239. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1240. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1241. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1242. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1243. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1244. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1245. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1246. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1247. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1248. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1249. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1250. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1251. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1252. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1253. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1254. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1255. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1256. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1257. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1258. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1259. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1260. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1261. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1262. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1263. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1264. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1265. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1266. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1267. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1268. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1269. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1270. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1271. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1272. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1273. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1274. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1275. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccactgacggtggct	Protospacer
********.************

1276. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1277. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1278. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1279. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1280. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1281. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1282. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1283. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1284. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1285. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1286. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1287. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1288. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1289. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1290. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1291. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1292. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1293. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1294. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1295. spacer 1.4|14481|21|NZ_CP027063|CRT matches to MF185718 (Arthrobacter phage Colucci, complete genome) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggcc	Protospacer
********************.

1296. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
.********************

1297. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1298. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1299. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1300. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1301. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1302. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1303. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1304. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1305. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1306. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1307. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1308. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1309. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1310. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1311. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1312. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1313. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1314. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1315. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1316. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1317. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1318. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1319. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1320. spacer 1.4|14481|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1321. spacer 1.4|14481|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1322. spacer 1.4|14481|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1323. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1324. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1325. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1326. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1327. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1328. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1329. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1330. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1331. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1332. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1333. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1334. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
************ ********

1335. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1336. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1337. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1338. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1339. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtagct	Protospacer
*****************.***

1340. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1341. spacer 1.4|14481|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgatggtggct	Protospacer
*************.*******

1342. spacer 1.4|14481|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
*** *****************

1343. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1344. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1345. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1346. spacer 1.5|14523|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1347. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1348. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1349. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1350. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1351. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1352. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1353. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1354. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1355. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1356. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1357. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgtcggtgctc	Protospacer
************.********

1358. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1359. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1360. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1361. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1362. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1363. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1364. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1365. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1366. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1367. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1368. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1369. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1370. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1371. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1372. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1373. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1374. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1375. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1376. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1377. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1378. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1379. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1380. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1381. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1382. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1383. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1384. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1385. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1386. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1387. spacer 1.5|14523|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1388. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1389. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1390. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1391. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1392. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1393. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1394. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1395. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1396. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1397. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1398. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1399. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1400. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1401. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1402. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1403. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1404. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1405. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1406. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1407. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1408. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1409. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1410. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1411. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1412. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1413. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1414. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1415. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1416. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1417. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1418. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1419. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1420. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1421. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1422. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1423. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1424. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1425. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1426. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1427. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1428. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1429. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1430. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1431. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1432. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1433. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1434. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1435. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1436. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1437. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1438. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1439. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1440. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1441. spacer 1.5|14523|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgcaggtgctc	Protospacer
************* *******

1442. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1443. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1444. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1445. spacer 1.5|14523|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1446. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1447. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1448. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1449. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1450. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1451. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1452. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1453. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1454. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1455. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1456. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1457. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1458. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1459. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1460. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1461. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1462. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1463. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1464. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1465. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1466. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1467. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1468. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1469. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1470. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1471. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1472. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1473. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1474. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1475. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1476. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1477. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1478. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1479. spacer 1.6|14565|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1480. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1481. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1482. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1483. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1484. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1485. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1486. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1487. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1488. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1489. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgggggcgctgacggtggct	Protospacer
****** **************

1490. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1491. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1492. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1493. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1494. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1495. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1496. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1497. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1498. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1499. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1500. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1501. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1502. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1503. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1504. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1505. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1506. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1507. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1508. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1509. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1510. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1511. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1512. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1513. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1514. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1515. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1516. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgggggcgctgacggtggct	Protospacer
****** **************

1517. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1518. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1519. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1520. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1521. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1522. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1523. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1524. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1525. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1526. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1527. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1528. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1529. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1530. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1531. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1532. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1533. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1534. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1535. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1536. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1537. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1538. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1539. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1540. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1541. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1542. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1543. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1544. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1545. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1546. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1547. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1548. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1549. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1550. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1551. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1552. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1553. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1554. spacer 1.6|14565|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1555. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1556. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1557. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1558. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1559. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1560. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1561. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1562. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1563. spacer 1.6|14565|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
gcggggccgctgacggtggct	Protospacer
.********************

1564. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1565. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1566. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1567. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1568. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1569. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1570. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1571. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1572. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1573. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1574. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1575. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1576. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1577. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1578. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1579. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1580. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1581. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1582. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1583. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1584. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1585. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1586. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1587. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1588. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1589. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1590. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1591. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1592. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1593. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
atggggccgctgacggtggct	Protospacer
*.*******************

1594. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1595. spacer 1.6|14565|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acggggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggct	Protospacer
*** *****************

1596. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1597. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1598. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1599. spacer 1.7|14607|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1600. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1601. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1602. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP042975 (Klebsiella pneumoniae strain KPN55602 plasmid pK55602_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1603. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1604. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1605. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1606. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1607. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1608. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1609. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1610. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgtcggtgctc	Protospacer
************.********

1611. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1612. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1613. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1614. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1615. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1616. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1617. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1618. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1619. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1620. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1621. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1622. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1623. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1624. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1625. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1626. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1627. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1628. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1629. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1630. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1631. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1632. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1633. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1634. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1635. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1636. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1637. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1638. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1639. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1640. spacer 1.7|14607|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1641. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1642. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1643. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1644. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1645. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1646. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1647. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1648. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1649. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1650. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1651. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1652. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1653. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1654. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1655. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1656. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1657. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1658. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1659. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1660. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1661. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1662. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1663. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1664. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1665. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1666. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1667. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1668. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1669. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgccggtgctt	Protospacer
********************.

1670. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1671. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1672. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1673. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1674. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1675. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1676. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1677. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1678. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1679. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK413719 (Klebsiella pneumoniae strain 362713 plasmid p362713-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1680. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1681. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1682. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1683. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1684. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1685. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
gcgtggccgctgccggtgctc	Protospacer
.********************

1686. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1687. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1688. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1689. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1690. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1691. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1692. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1693. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1694. spacer 1.7|14607|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgctgcaggtgctc	Protospacer
************* *******

1695. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1696. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1697. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1698. spacer 1.7|14607|21|NZ_CP027063|CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1699. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1700. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1701. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1702. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1703. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1704. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1705. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1706. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1707. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1708. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1709. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acgtggccgttgccggtgctc	Protospacer
*********.***********

1710. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1711. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1712. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1713. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgccggtgctc	CRISPR spacer
acggggccgctgccggtgctc	Protospacer
*** *****************

1714. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1715. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1716. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1717. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1718. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1719. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1720. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1721. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1722. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1723. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1724. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1725. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1726. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1727. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1728. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1729. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1730. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1731. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1732. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1733. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1734. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1735. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1736. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1737. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1738. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1739. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1740. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1741. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1742. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1743. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1744. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1745. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1746. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1747. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1748. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1749. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1750. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1751. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1752. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1753. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1754. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1755. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1756. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP013713 (Klebsiella pneumoniae strain J1 plasmid 2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1757. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1758. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1759. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1760. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1761. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026172 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPN-bbef, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1762. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1763. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1764. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1765. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1766. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1767. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1768. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1769. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1770. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1771. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1772. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1773. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026398 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-edaa, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1774. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1775. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1776. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1777. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1778. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1779. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1780. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1781. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1782. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1783. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1784. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1785. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052539 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1786. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1787. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1788. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1789. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1790. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1791. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1792. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1793. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgactgtggct	Protospacer
************** ******

1794. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1795. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1796. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1797. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1798. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1799. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1800. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1801. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1802. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1803. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1804. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1805. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1806. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1807. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1808. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1809. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1810. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1811. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1812. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1813. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1814. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1815. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1816. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1817. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1818. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1819. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1820. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1821. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1822. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1823. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1824. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1825. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1826. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1827. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1828. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1829. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1830. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1831. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1832. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1833. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1834. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1835. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1836. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1837. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1838. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1839. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1840. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1841. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1842. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1843. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1844. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgaaggtggct	Protospacer
************* *******

1845. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032223 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1846. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1847. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1848. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050068 (Klebsiella aerogenes strain 035 plasmid p35, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1849. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP041093 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1850. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1851. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1852. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1853. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1854. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggct	Protospacer
.********************

1855. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acgtgaccgctgacggtggct	Protospacer
*****.***************

1856. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1857. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1858. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1859. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1860. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1861. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1862. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1863. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1864. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1865. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1866. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1867. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1868. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1869. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052325 (Klebsiella pneumoniae strain E16KP0032 plasmid pE16KP0032-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1870. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1871. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1872. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1873. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1874. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1875. spacer 1.8|14649|21|NZ_CP027063|CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1876. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1877. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1878. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1879. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1880. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1881. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1882. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1883. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1884. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1885. spacer 1.8|14649|21|NZ_CP027063|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1886. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1887. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1888. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1889. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1890. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1891. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1892. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1893. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1894. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1895. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1896. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1897. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1898. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1899. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1900. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1901. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1902. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1903. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1904. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1905. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1906. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1907. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1908. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1909. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1910. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1911. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1912. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1913. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1914. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1915. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1916. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1917. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1918. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1919. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1920. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1921. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1922. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1923. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1924. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1925. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1926. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1927. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1928. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1929. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1930. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1931. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1932. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1933. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1934. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1935. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1936. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1937. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1938. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1939. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1940. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1941. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1942. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1943. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1944. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1945. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1946. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1947. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1948. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1949. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1950. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1951. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1952. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1953. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1954. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1955. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1956. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1957. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1958. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1959. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1960. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1961. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1962. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1963. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MH255828 (Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-VIR, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1964. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1965. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1966. spacer 1.8|14649|21|NZ_CP027063|CRT matches to HG918041 (Klebsiella pneumoniae Kp15 plasmid pENVA complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1967. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1968. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1969. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1970. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1971. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1972. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1973. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1974. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1975. spacer 1.8|14649|21|NZ_CP027063|CRT matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 1, identity: 0.952

acgtggccgctgacggtggct	CRISPR spacer
acggggccgctgacggtggct	Protospacer
*** *****************

1976. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 1, identity: 0.952

acgggaccgctgccggtagtc	CRISPR spacer
acggggccgctgccggtagtc	Protospacer
*****.***************

1977. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 1, identity: 0.952

acgggaccgctgccggtagtc	CRISPR spacer
acggggccgctgccggtagtc	Protospacer
*****.***************

1978. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggcggctgtcggtggtc	Protospacer
******* *************

1979. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acaggggcgataccagtgacc	CRISPR spacer
acagggacgataccagtgacc	Protospacer
******.**************

1980. spacer 1.11|14775|21|NZ_CP027063|CRT matches to NZ_CP032915 (Enterobacter roggenkampii strain ECY546 plasmid pY546, complete sequence) position: , mismatch: 1, identity: 0.952

acaggggcgataccagtgacc	CRISPR spacer
acaggggcgataccggtgacc	Protospacer
**************.******

1981. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1982. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP020848 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1983. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgttgtcgctgctggtggtc	Protospacer
**** ****************

1984. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgttgtcgctgctggtggtc	Protospacer
**** ****************

1985. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP018961 (Escherichia coli strain Ecol_422 plasmid pEC422_1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1986. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP011314 (Klebsiella pneumoniae subsp. pneumoniae strain 234-12 plasmid pKpn23412-362, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1987. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP044377 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1988. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP044381 (Klebsiella pneumoniae strain 2018S07-013 plasmid p2018S07-013-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1989. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP021699 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000727, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1990. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1991. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP044386 (Klebsiella pneumoniae strain 2018C01-239 plasmid p2018C01-239-1_MCR1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1992. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_CP034046 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1993. spacer 1.12|14817|21|NZ_CP027063|CRT matches to NZ_MH733011 (Klebsiella pneumoniae strain KP16103 plasmid pKP16103-MCR-1, complete sequence) position: , mismatch: 1, identity: 0.952

gcgtggtcgctgctggtggtc	CRISPR spacer
gcgtggtcgctgctggtgatc	Protospacer
******************.**

1994. spacer 1.5|14523|21|NZ_CP027063|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.905

acgtggccgctgccggtgctc	CRISPR spacer
gtgtggccgctgccggtgctc	Protospacer
..*******************

1995. spacer 1.6|14565|21|NZ_CP027063|CRT matches to CP052400 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-1, complete sequence) position: , mismatch: 2, identity: 0.905

acggggccgctgacggtggct	CRISPR spacer
gaggggccgctgacggtggct	Protospacer
. *******************

1996. spacer 1.7|14607|21|NZ_CP027063|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.905

acgtggccgctgccggtgctc	CRISPR spacer
gtgtggccgctgccggtgctc	Protospacer
..*******************

1997. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052327 (Klebsiella pneumoniae strain E16KP0017 plasmid pE16K0017-1, complete sequence) position: , mismatch: 2, identity: 0.905

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggtc	Protospacer
*******************..

1998. spacer 1.8|14649|21|NZ_CP027063|CRT matches to CP052240 (Klebsiella pneumoniae strain E17KP0027 plasmid pE17KP0027-1, complete sequence) position: , mismatch: 2, identity: 0.905

acgtggccgctgacggtggct	CRISPR spacer
acgtggccgctgacggtggtc	Protospacer
*******************..

1999. spacer 1.8|14649|21|NZ_CP027063|CRT matches to MF185718 (Arthrobacter phage Colucci, complete genome) position: , mismatch: 2, identity: 0.905

acgtggccgctgacggtggct	CRISPR spacer
gcgtggccgctgacggtggcc	Protospacer
.*******************.

2000. spacer 1.9|14691|21|NZ_CP027063|CRT matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 2, identity: 0.905

acgggaccgctgccggtagtc	CRISPR spacer
gcgggaccgctgccggtagtt	Protospacer
.*******************.

2001. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_KX029332 (Klebsiella pneumoniae strain Kp84/11 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2002. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_LN824134 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_A_Kpneumoniae_MS6671) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2003. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP015501 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 1, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2004. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP042866 (Escherichia coli strain ATCC BAA-196 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2005. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP031582 (Klebsiella pneumoniae strain N4b plasmid pIncHI1B-1502320, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2006. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP004000 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13f, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2007. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP032208 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

2008. spacer 1.10|14733|21|NZ_CP027063|CRT matches to NZ_CP027156 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed4) position: , mismatch: 2, identity: 0.905

gcgtggccgctgtcggtggtc	CRISPR spacer
gcgtggccgctgtcggtggct	Protospacer
*******************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

162735 : 223885

Shigella_phage(40.0%)

transposase,integrase

attL 175623:175682|attR 201062:202291

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048264963.1\|162735_164266_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.9e-50	39.8
WP_000994210.1\|167655_168198_+	3'-5' exonuclease	NA	NA	NA	NA
WP_048264961.1\|168211_168709_-	hypothetical protein	NA	NA	NA	NA
WP_048265023.1\|168705_170469_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_048264960.1\|170470_171718_-	nucleotidyltransferase	NA	NA	NA	NA
WP_077258344.1\|171714_172890_-	SAVED domain-containing protein	NA	NA	NA	NA
WP_077258367.1\|173287_173485_-	hypothetical protein	NA	NA	NA	NA
WP_048264996.1\|173817_174087_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_072198182.1\|174094_174622_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_064167953.1\|174705_175014_+	hypothetical protein	NA	NA	NA	NA
175623:175682	attL	NA	NA	NA	NA
WP_088476848.1\|175640_176788_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-148	93.0
WP_088476847.1\|176807_177173_+	DUF1173 family protein	NA	NA	NA	NA
WP_126034233.1\|177321_177627_+	hypothetical protein	NA	NA	NA	NA
WP_048291886.1\|177948_178734_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	1.0e-50	89.3
WP_004197633.1\|180107_180413_-	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_015632547.1\|180414_180633_-	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_072060593.1\|180684_180870_+	hypothetical protein	NA	NA	NA	NA
WP_048265005.1\|180911_182285_+	hypothetical protein	NA	NA	NA	NA
WP_088476846.1\|182373_182589_+	hypothetical protein	NA	NA	NA	NA
WP_023345594.1\|182626_183055_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_023345593.1\|183167_184013_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_023345592.1\|184115_184511_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023345591.1\|184622_185207_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_048291887.1\|185274_186117_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_023345588.1\|186534_186765_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_023345587.1\|186761_187178_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_023345586.1\|187269_188673_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_048291888.1\|188682_190557_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_023345584.1\|190945_191581_-	DUF1349 domain-containing protein	NA	NA	NA	NA
WP_077258347.1\|191619_192825_-	MFS transporter	NA	NA	NA	NA
WP_023345582.1\|192909_193680_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023345581.1\|194033_195473_+	family 1 glycosylhydrolase	NA	NA	NA	NA
WP_023345580.1\|195533_196430_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023345579.1\|196529_197711_+	MFS transporter	NA	NA	NA	NA
WP_023345578.1\|197829_198438_-	short chain dehydrogenase	NA	NA	NA	NA
WP_048265000.1\|198535_199438_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_088476848.1\|199955_201102_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-148	93.0
WP_004181920.1\|203280_204636_-	hypothetical protein	NA	NA	NA	NA
201062:202291	attR	NA	NA	NA	NA
WP_048291881.1\|204679_205717_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_072060590.1\|206082_206625_-	hypothetical protein	NA	NA	NA	NA
WP_065809520.1\|208706_209171_+	hypothetical protein	NA	NA	NA	NA
WP_048291879.1\|209170_209959_+	hypothetical protein	NA	NA	NA	NA
WP_065809521.1\|209972_212915_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_004181906.1\|213383_213740_-	hypothetical protein	NA	NA	NA	NA
WP_065809522.1\|214581_214929_-	hypothetical protein	NA	NA	NA	NA
WP_126034224.1\|215011_215449_-	hypothetical protein	NA	NA	NA	NA
WP_048291875.1\|215544_216612_-	hypothetical protein	NA	NA	NA	NA
WP_048291874.1\|216680_216977_-	hypothetical protein	NA	NA	NA	NA
WP_032719541.1\|217210_217588_+	hypothetical protein	NA	NA	NA	NA
WP_004118124.1\|219363_219525_-	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_021312536.1\|219867_220353_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003026799.1\|220340_220607_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_101837567.1\|220739_221201_-	S-(hydroxymethyl)glutathione synthase	NA	NA	NA	NA
WP_088476786.1\|222597_222753_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_101837575.1\|222765_223885_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.9e-51	42.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP027064

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP027063

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection