CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP025591	Lactiplantibacillus plantarum strain K259 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP025590	Lactiplantibacillus plantarum strain K259 chromosome, complete genome	3 crisprs	DEDDh,cas3,DinG,csa3,WYL	1	9	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025590_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025590_1

921635-924255

Orphan

Consensus_repeat	Method
GANTCNGACTCNGANAGTGATTCNGATTCNGACAGTGANTC	CRT

26 spacers

The CRISPR arrays of NZ_CP025590_1

>merge|NZ_CP025590|1|921635-924255|CRT
GATTCGGATAGCGACAGTGATTCGGACTCTGACAGTGATTCGGATTCCGATAGCGACTCGGACTCGGACAGCGACTCGGACTCGGACAGTGACTCCGACTCCGACAGTGATTCCGACTCCGATAGCGACTCCGATTCTGACAGTGACTCGGACTCGGACAGCGATTCAGATAGCGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACTCAGACAGCGATTCAGACTCCGATTCTGACAGTGATTCCGACTCGGACAGCGACTCGGATTCGGATAGTGATTCCGACTCAGACAGTGACTCGGATTCGGATAGTGATTCGGATTCAGACAGTGACTCCGACTCGGATAGTGATTCCGACTCAGACAGCGATTCTGACTCAGACAGCGATTCGGACTCGGACAGCGATTCGGACTCGGACAGCGATTCGGACTCAGACAGTGATTCCGACTCAGATAGTGATTCGGATTCCGACAGCGATTCAGATAGCGACAGTGATTCCGACTCAGACAGTGATTCCGATTCCGACAGCGATTCGGATTCGGATAGTGATTCCGATTCCGACAGTGATTCCGATTCCGATAGTGACTCCGATTCGGACTCGGATAGTGATTCGGATAGCGACAGTGACTCCGACTCGGATAGTGATTCGGATTCCGACAGTGATTCGGACTCGGATAGTGACTCGGATTCCGATAGTGATTCGGACTCGGATAGTGATTCCGATTCGGACAGTGATTCGGATAGCGACAGTGACTCCGACTCTGATAGTGATTCCGATTCTGACAGTGATTCTGACTCCGACAGCGATTCAGACTCAGATAGTGACTCAGATTCCGACAGCGATTCAGACTCGGACAGTGATTCGGATAGCGACAGCGACTCAGACTCGGACAGTGACTCAGATAGCGACAGCGATTCCGATTCTGACAGCGACTCAGACTCTGATAGTGATTCTGACTCAGACAGTGATTCGGATAGCGACAGCGATTCGGATTCCGATAGTGATTCCGACTCAGACAGTGATTCGGATTCCGACAGCGATTCAGACTCTGATAGTGATTCCGATTCTGACAGTGATTCGGATAGCGACAGCGACTCAGACTCCGACAGCGATTCAGATAGCGACAGTGATTCGGACTCGGATAGTGATTCTGATTCCGACAGCGACTCAGATTCTGACAGTGATTCGGATTCGGATAGCGATTCCGATTCCGACAGTGACTCCGACTCGGATAGTGATTCAGACTCGGATAGTGATTCCGACTCTGACAGTGATTCCGATTCTGACAGTGATTCCGACTCGGATAGCGATTCTGACTCCGATAGTGACTCCGATTCGGATAGTGATTCCGATTCGGACAGTGATTCGGACTCGGACAGCGATTCGGACTCGGACAGCGATTCGGACTCTGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACAGCGACTCAGATTCTGACAGTGATTCGGATTCGGATAGCGATTCGGATTCCGACAGCGACTCGGATTCCGACAGTGATTCGGACTCGGATAGTGATTCGGATTCCGACAGTGACTCAGACTCTGACAGCGATTCGGATTCCGACAGTGACTCGGACTCAGATAGCGATTCTGACTCGGATAGTGATTCCGATTCGGACAGCGATTCCGATTCCGACAGTGATTCGGACTCGGACAGCGATTCTGACTCGGACAGTGATTCGGACTCGGACAGCGACTCGGATTCCGATAGCGATTCCGACTCTGATAGTGATTCGGACTCGGACAGCGACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTCGGATTCCGATAGTGACTCCGATTCGGACAGCGATTCCGACTCAGACAGTGATTCCGATTCGGATAGTGATTCCGATTCGGACAGTGATTCAGACTCGGATAGCGATTCAGACTCCGATAGTGACTCGGATTCCGACAGTGATTCAGATTCGGACTCGGACAGCGACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTCCGATTCGGACTCGGACAGCGATTCGGACTCAGACAGCGACTCGGATTCCGATAGCGATTCAGACTCTGATAGTGATTCGGACTCGGACAGCGACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTCGGATTCCGACTCTGACAGCGACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTCCGATTCGGACTCGGACAGCGATTCGGACTCTGACAGCGATTCGGACTCGGACAGTGATTCGGATAGCGACAGTGACTCGGATTCGGATAGTGATTCGGACTCAGACAGCGATTCCGATTCTGACAGTGATTCGGATTCGGATAGCGATTCGGATTCCGACAGCGACTCGGATTCCGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACAGTGACTCGGACTCAGATAGTGATTCAGATTCCGACAGTGACTCGGACTCAGATAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACAGTGATTCCGATTCGGACAGTGACGCTGACTCAGACAGCGACTCAGGTTCCGACAACGACTCAGACTCAGACAGTGATTCGAATAGCGACAGTGACTC

>NZ_CP025590|1|1|921635-924255|CRT
GATTCGGATAGCGACAGTGATTCGGACTCTGACAGTGATTC	GGATTCCGATAGCGACTCGGACTCGGACAGCGACTCGGACTCGGACAGTGACTCCGACTCCGACAGTGATTCCGACTCCGATAGC
GACTCCGATTCTGACAGTGACTCGGACTCGGACAGCGATTC	AGATAGCGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACTCAGACAGCGATTCAGACTCCGATTCTGACAGTGATTCCGACTCGGACAGC
GACTCGGATTCGGATAGTGATTCCGACTCAGACAGTGACTC	GGATTCGGATAGTGATTCGGATTCAGACAGTGACTCCGACTCGGATAGTGATTCCGACTCAGACAGCGATTCTGACTCAGACAGCGATTCGGACTCGGACAGC
GATTCGGACTCGGACAGCGATTCGGACTCAGACAGTGATTC	CGACTCAGATAGTGATTCGGATTCCGACAGCGATTCAGATAGCGACAGTGATTCCGACTCAGACAGTGATTCCGATTCCGACAGC
GATTCGGATTCGGATAGTGATTCCGATTCCGACAGTGATTC	CGATTCCGATAGTGACTCCGATTCGGACTCGGATAGTGATTCGGATAGCGACAGTGACTCCGACTCGGATAGTGATTCGGATTCCGACAGT
GATTCGGACTCGGATAGTGACTCGGATTCCGATAGTGATTC	GGACTCGGATAGTGATTCCGATTCGGACAGTGATTCGGATAGCGACAGTGACTCCGACTCTGATAGTGATTCCGATTCTGACAGTGATTCTGACTCCGACAGC
GATTCAGACTCAGATAGTGACTCAGATTCCGACAGCGATTC	AGACTCGGACAGTGATTCGGATAGCGACAGCGACTCAGACTCGGACAGTGACTCAGATAGCGACAGCGATTCCGATTCTGACAGC
GACTCAGACTCTGATAGTGATTCTGACTCAGACAGTGATTC	GGATAGCGACAGCGATTCGGATTCCGATAGTGATTCCGACTCAGACAGTGATTCGGATTCCGACAGC
GATTCAGACTCTGATAGTGATTCCGATTCTGACAGTGATTC	GGATAGCGACAGCGACTCAGACTCCGACAGCGATTCAGATAGCGACAGTGATTCGGACTCGGATAGTGATTCTGATTCCGACAGCGACTCAGATTCTGACAGT
GATTCGGATTCGGATAGCGATTCCGATTCCGACAGTGACTC	CGACTCGGATAGTGATTCAGACTCGGATAGTGATTCCGACTCTGACAGTGATTCCGATTCTGACAGT
GATTCCGACTCGGATAGCGATTCTGACTCCGATAGTGACTC	CGATTCGGATAGTGATTCCGATTCGGACAGTGATTCGGACTCGGACAGCGATTCGGACTCGGACAGCGATTCGGACTCTGACAGT
GATTCCGACTCGGATAGTGATTCGGATTCCGACAGCGACTC	AGATTCTGACAGTGATTCGGATTCGGATAGCGATTCGGATTCCGACAGCGACTCGGATTCCGACAGT
GATTCGGACTCGGATAGTGATTCGGATTCCGACAGTGACTC	AGACTCTGACAGCGATTCGGATTCCGACAGTGACTCGGACTCAGATAGC
GATTCTGACTCGGATAGTGATTCCGATTCGGACAGCGATTC	CGATTCCGACAGTGATTCGGACTCGGACAGC
GATTCTGACTCGGACAGTGATTCGGACTCGGACAGCGACTC	GGATTCCGATAGCGATTCCGACTCTGATAGTGATTCGGACTCGGACAGC
GACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTC	GGATTCCGATAGTGACTCCGATTCGGACAGC
GATTCCGACTCAGACAGTGATTCCGATTCGGATAGTGATTC	CGATTCGGACAGTGATTCAGACTCGGATAGC
GATTCAGACTCCGATAGTGACTCGGATTCCGACAGTGATTC	AGATTCGGACTCGGACAGC
GACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTC	CGATTCGGACTCGGACAGC
GATTCGGACTCAGACAGCGACTCGGATTCCGATAGCGATTC	AGACTCTGATAGTGATTCGGACTCGGACAGC
GACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTC	GGATTCCGACTCTGACAGC
GACTCAGACTCAGACAGTGATTCGGATAGCGACAGTGACTC	CGATTCGGACTCGGACAGCGATTCGGACTCTGACAGC
GATTCGGACTCGGACAGTGATTCGGATAGCGACAGTGACTC	GGATTCGGATAGTGATTCGGACTCAGACAGCGATTCCGATTCTGACAGT
GATTCGGATTCGGATAGCGATTCGGATTCCGACAGCGACTC	GGATTCCGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACAGT
GACTCGGACTCAGATAGTGATTCAGATTCCGACAGTGACTC	GGACTCAGATAGTGATTCCGACTCGGATAGT
GATTCGGATTCCGACAGTGATTCCGATTCGGACAGTGACGC	TGACTCAGACAGCGACTCAGGTTCCGACAAC
GACTCAGACTCAGACAGTGATTCGAATAGCGACAGTGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025590.1\|WP_102124438.1\|926664_928173_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP025590.1\|WP_003643178.1\|936402_937143_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP025590.1\|WP_003643191.1\|912739_913459_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025590.1\|WP_013355431.1\|911167_912664_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP025590.1\|WP_013355437.1\|930628_931312_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP025590.1\|WP_003643186.1\|925003_926638_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025590.1\|WP_013355435.1\|929739_929937_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025590.1\|WP_013355430.1\|909837_910767_+\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP025590.1\|WP_169484465.1\|913669_914860_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP025590.1\|WP_003643180.1\|931774_934201_+\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP025590.1\|WP_003643189.1\|914995_916498_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP025590.1\|WP_013355429.1\|908341_909724_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP025590.1\|WP_011101352.1\|934724_936395_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP025590.1\|WP_013355427.1\|905738_907064_-\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP025590.1\|WP_013355434.1\|928183_929710_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP025590.1\|WP_003643199.1\|903430_903949_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP025590.1\|WP_013355428.1\|907035_908010_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP025590.1\|WP_013355436.1\|930032_930560_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377744
NZ_CP025590.1\|WP_003644232.1\|937279_938116_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP025590.1\|WP_013355426.1\|904063_904900_-\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|378975

Protein	Function_ID	Function_description	E-value
NZ_CP025590.1\|WP_102124438.1\|926664_928173_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	7.0057e-70
NZ_CP025590.1\|WP_003643178.1\|936402_937143_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	4.08752e-87
NZ_CP025590.1\|WP_013355431.1\|911167_912664_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	2.55693e-86
NZ_CP025590.1\|WP_013355437.1\|930628_931312_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.23981e-45
NZ_CP025590.1\|WP_003644232.1\|937279_938116_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	2.72812e-84
NZ_CP025590.1\|WP_013355430.1\|909837_910767_+\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	1.33395e-160
NZ_CP025590.1\|WP_169484465.1\|913669_914860_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP025590.1\|WP_003643180.1\|931774_934201_+\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP025590.1\|WP_003643189.1\|914995_916498_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.26448e-72
NZ_CP025590.1\|WP_013355429.1\|908341_909724_-\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP025590.1\|WP_011101352.1\|934724_936395_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	7.02708e-131
NZ_CP025590.1\|WP_013355427.1\|905738_907064_-\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	2.43567e-148
NZ_CP025590.1\|WP_013355434.1\|928183_929710_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	2.42423e-108
NZ_CP025590.1\|WP_003643199.1\|903430_903949_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.80056e-08
NZ_CP025590.1\|WP_013355428.1\|907035_908010_-\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	7.70113e-117
NZ_CP025590.1\|WP_013355436.1\|930032_930560_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	1.66853e-67
NZ_CP025590.1\|WP_013355426.1\|904063_904900_-\|metallophosphoesterase-family-protein	gnl\|CDD\|378975	pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain. Members of this family are part of the Calcineurin-like phosphoesterase superfamily.	3.97199e-10

>NZ_CP025590.1|WP_003643189.1|914995_916498_+|MFS-transporter
MQQRKTNVMAVTVAIYVATFMSAIEGTIVSTALPTIVGDLHGVSLMNWVFSIYLLTNAMMTPIYGKLTDLVGRKPVMQAGLIIFIIGSMMSGLSNSMPVLIFWRAIQGIGAGALMPVSMTIIADIYSFERRAKVLGFNSSAWGIASVLAPLIGGLIVDKLSWHWIFFINVPVGLITLFLFQFYLREPKRHNNVKIDYLGSFWLMLFLLCLMLSFQLLGNATISWVAVGTAWIISALSLWLFIRRESRTDEPVISMDLFKNHTFIIQNAVAALVSGFLMAVEVYIPTWTQGILGVPASLAGFAVTPSSLMWIVGSFVTGRLLAKWAPRRILYLSLAFILVTSICLAWLPVNTAFPWFFLITAIGGVGFGITITATTVTSQHLVPAENVGVATSFNTLSRTIGQTLMISIFGIALNVGMNQGIQHHAGTNMAMMNKLINPQTATQLPSHLLPTLHRILYTGLHWVYLIGLGLVILAFIVNSLDRGPQKTAAQHAADLNQNQD
>NZ_CP025590.1|WP_169484465.1|913669_914860_+|methionine-adenosyltransferase
MVSERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETRSGDADPLDQIGAGDQGMMFGYAINETPELMPLPIALSHRLMRKIAALRKDGTIKWLRPDAKAQVTVEYDEDNQPKRIDTVVLSTQHDPDVDLDTIRQTVIDQVIKAVLPADLLDDQTKYLVNPTGRFVIGGPQGDAGLTGRKVIVDTYGGFAHHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLADQVEVQLAYAIGVAEPVSIAVDTAGTGKVSDEALINAIRENFDLRPAGIIKMLDLQRPIYRQTAAYGHFGRTDIDLPWEHTDKVDALKAAFK
>NZ_CP025590.1|WP_003643191.1|912739_913459_-|hypothetical-protein
MIRIGKLHIKRDYIALAIFTIVQSIISWWAALDYGRSFQTASFSAAQLPLIGYTLAVAAAVFIILDRRIAPQWSLIAIGITVAFAFTNIIAKESELLYLLLTCSAWLLVMAVPRFGMQNYFGLVVFGVIMTFTIPVAVFDLQNNYLSTTFLWKLTPMLASYVFLYVPSFSRQRQINQLISAITGLLLVITIFLQPLTWQTIVAILITIAVWFSQQSFGRTRLHLMINVAVQLALILLLY
>NZ_CP025590.1|WP_013355431.1|911167_912664_+|glycosyltransferase
MYYFVGTGLGLKLTGIEKAQLNRLALFDATGYQARCVYVTYNPRLHEHAARFGAEGKCFSLYDFFQGTMPEAVTKIHHDWMHYWQAVCHFKVIQVPNTTDFRVLDTDGQYLMYVHFVDAGRQQLDYVNYFDNQGVKVRREFYDNRGFLSRTSFLVKHQEVHTEVYYDLQGQVKIIKQYDITGPEPKLRLITLKNYQQRDFFFNTEQAFQTFFFNELATADDVYFCDRNRQTAAALGHTRPAIRVCSVLHSTHLRIGEDVVSGHLKSVYRYVLAHPDQFHRIIVSTEHQKRDLLARYDNLPPVVVIPVGYTTVHPFKIDGRDLHRIISVARYSPEKQLPHQLEVVRRLVGEFPDLTLQLFGHGQKIEMQMRQFIQANQLEKNIVIRGFLPNLAEEYQRASLALMTSVEEGFSLATMEAESYGVPVIGYRIAYGPEDIIEDGVNGYLVTPNDVDELTMKVRQYLQHPERQAQLITNAYNSATRYSKQTIIEKWRQLIAAL
>NZ_CP025590.1|WP_013355430.1|909837_910767_+|homocysteine-S-methyltransferase
MLSLTEQLNRGPVVSDGAMATELEKRGVATNSALWSATAMLDHPDAIQAVHQSYLDAGAKIMTTNTYQANVPAFEQAGIAAAQARQLIQQAVTIAHTARDASHVTDAVIAGSIGPYGAYLADGSEYTGAYQLTPSAYQDFHRERLALIMAAGVDVLALETMPRLDEVQALVQLITTTWPQQPYWVSFSIKDPQTLCDGTSLAATAKWVAAQPNVVAVGVNCTTLENIAPALATLKAAVAVPLIVYPNSGDQYDPVTKTWQETHLSHQFASFVPQWLAAGARIIGGCCRTTPKDIATVARALSVSDSAKL
>NZ_CP025590.1|WP_013355429.1|908341_909724_-|amino-acid-permease
MSKQTHLSRQMESRHVLMISLGGVIGTGLFLSSGYTIHQAGPIGTLLAYTIGAILVYLVMLCLGELSVAMPYTGAFHVYAKKYIGPGTGFTVAILYWLTWTIALGSEFTAAGLIMQTWFPHIATWIWSLVFMVVIFTVNALSVRWFAEAEFWFASIKVIAIIAFIVLGGLAMVGILPLHGHTSAPFLSNYTRNGWFPNGFGGVFTTMLTVNFAFSGTELIGITAGETKDPAHTIPTAIKTALWRLIIFFIGSMSVMAALIPYKQAGVTQSPFVLVFKAIGIPYAADLMNFVVLTAIMSAANSGLYASTRMLWSLANEGTIPKVFKRTTKRDVPLVALITSMLGGILALLSSVYAAGSVYLVLVSISGLAVVIVWMAIALSEINFRKTYLKSGQSLDQLTFKTPGYPVVPWLAFILSGLSCILIWFDPNQRIALYYTIPFVAICYLGYYLNQRYRRTHAAK
>NZ_CP025590.1|WP_013355428.1|907035_908010_-|ferrochelatase
MHPGLLLVNLGSPASPRTKDVKAYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPQGSPLIVYSQAICQQVQAALPDWDVRLAMTYGQPDIGATLKAMVADGCEKPIILPLFPQYTQSTHGGIHRQVEATGLPHTFIDSFYDQPTYIHLLATKVWQSYQAHHYDAVIFSYHSIPTAMVRHGDPYQRECEATTKAVLTERPELPADKVITAYQSKFGPMPWLKPYLKNELMQLVELGKRNVLVVTPSFVVDCLETLEEDYVQNYQTFRASGGDRFDLVPPMNKDTGFSQFLADLAIQKQEASNHAIASSSKS
>NZ_CP025590.1|WP_013355427.1|905738_907064_-|Nramp-family-divalent-metal-transporter
MQSHRHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLAVLALAIIVAMFMQGLAIRLGVVARQDLAQAIASKLPRPVRYAAWILNEVAMMATDMTGVIGTAIALKMLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEVIVLVAILTVGIIFGIEVGRAHVQFGNVLLGLVPTPLIVKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHNPAQVTEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTNALASLQAVFDGLKSTTVVGALASQVMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGMLVGFSDAAFENLIIYAQVALSIALPFTLLPLVALTNDASLMKAHVNRPTVTWVGYGLAGIITVLNIYLVYSLF
>NZ_CP025590.1|WP_013355426.1|904063_904900_-|metallophosphoesterase-family-protein
MVKIAVLSDVHGNATALEAVLADAQKQHVDEYWTVGDMTVRGPESERCLTLLDRVHPTAYVLGNHEENYQKVMAANPNTFTKPKQIMATVLTAFDRRQLSSTHFERLLNLPMTVIKHVGPLTIRLQHVLPTVASGHALAPTASQANFDQAAEGDVDIVIYAHTHQPIMRYATTGQLILNAGTVGLPTAINPHLRQPRANYLLLTIDETGLQHADYRAVDFDWQRAITIAQNTHLPYFEFYEQTLRTNTYQYAPSAVAAYNTQHDMAREARKILLENRH
>NZ_CP025590.1|WP_003643199.1|903430_903949_-|GNAT-family-N-acetyltransferase
MYFKKATLDDLDTIIDILSDGRNQLAEAGVNQWQGDYPSRKQITADIMQGSAYLFNADDNATVGAVAVVPSPDETYDTAKAEWLNTTAPYVVIHRVAIHSSHAGHGYATQLFEKIIAHIAADHPEIKSIRIDTHADNQAMQHLIAKMNFKRVGEMVGVYHVDDVCYVYEKML
>NZ_CP025590.1|WP_003643186.1|925003_926638_+|hypothetical-protein
MQKSTVTKLKQALIATGNLKDYGTSTVTLALSVSDHRHRAQVRFYRCDSFKQAWIAVAQQLAKTPQASWVRLEAVQSTQKLPRETFEKRLAATFRMNYWRYGISFDADFKTALLEMESNGQAFFRPSKAHRIGKNRSGSWVDYDRVEPYLNKREGALPVDIRKTENVWVFTTAGVFTDGQKIWNLSEQEDCGKGVRVVTDEQSELQSAIEHGETFLINQLKGNGKFVYGYFPARQRVLSNYNVVRHFSSLYALLEAIPFTKRTEDFAKVKLAIQWGLKNATIEKEGAIFVDDNGELKLGGQALLILALSKYQDVTKDDTFVPVLMKAFKGVHFFQEPSGKLIHVLNPDLTVKAAYRIIYYEGEVAFALSRLYELTHDKNVMDLVKQILDYMVANDYGKYHDHWISYAINEALLVFPDNHDYMKLGLKNVFSHLKFIEERDTTYPTLLELVDAAVKMTDMIKRSGNEDLIAPYDLVRLRQVLRYRALYEITTGCFLPEIAMYLYNPQKFIGGFYARHDNFRTRIDDCEHFLSGLINYYNYTYRQA
>NZ_CP025590.1|WP_102124438.1|926664_928173_+|accessory-Sec-system-glycosyltransferase-Asp1
MFYFINEYILGKNSSVEHAAINRVKLFNHYKAPAQIVTKMYDRLLHQTMGTFQLANQQVLNMFDYFQQITDVPTKVLHTDDMHLPVEYAVEVGANFSKIFNGDEHVSNVGFIPGTIGRVFYQEFFDNQGNLSSTDLWDWRGFKSSTQYFGQNGKLVLERFYNLQGETVIEQYYVPDTNGNPLASRLILKNYRDQAERFFQDANHLFRFFLAELSHLDKQTTTFISDRPGTSVKPLLELQDDSHKYVTVPIYQAKDINDPIHSPLDGFLTPAFDNLQHFDGFITATESQAQHLRTRFPKAKVTVLPTVTTSPLAQSKLQPITARPKQLLYVGRLAPDRQLDQLIRTIALVKQQVKEIQCDFYGYGDPEYLKTLNKLVEELKLTNNVHLLDYHPDLETRYDDYQLLLNTDIVDGGPMSMPEAMSHGIPVISYRFNYGPKDWIDDGHDGFIVDPGNQLALRDRVIELMTDTKKLTAFSEAAFKKLHTSQTDLKVWHRWQQLLGIK
>NZ_CP025590.1|WP_013355434.1|928183_929710_+|accessory-Sec-system-glycosyltransferase-Asp1
MYYFLNDNMQFSKSGIEQAEINRLTLFKKHHVAAKIVTRVFAMNLHDVLEGANIADADFVNLFDFFCGSQSVKRQRFDLADFEVPADAIKTRKDNQIQVMERGKLIMIIYLRAGTEAVSNVQYFDVNGRTLKMSWWDTRGFKCLEQLFDWDGKIAQEAYFGPDGLIHVEKLHLLNHAGQERITWRVLNYNEQSHTFNGMNELTRYFYDELNQLNDEQNVFICDRTVECAWGLFNMTTPAKKVLHLHNNHVSDAKDIMHSTLNNNYANALNNWAAWDAVISATPEQTKDVEARFGKDIPAFTIPVGYVDNATLKAAPVKFDQRQKDLVVQVARLAPEKQQNHSIEAFVEVHKQFPDAKLELWGYANGDIEKQLHAQVAAAHLEDVVLFKGYTTDVNAVYNRAQLGLLPSRAEGFSLMLLEAQAHGLPMVANDVKYGPSDIIQDHKSGILTTDGDVQQLTKTILELLKNQGQLAQYSAQAYENAKRYSEEAVFKQWQALLDYFKPAKITA
>NZ_CP025590.1|WP_013355435.1|929739_929937_+|hypothetical-protein
MLMLMTIYGTVKMFTRMIVYCGIGGLVLIVRHHNRKKRRNEMDEGTKRIMRNTPKDENGKYPWEK
>NZ_CP025590.1|WP_013355436.1|930032_930560_-|class-I-SAM-dependent-methyltransferase
MNQVVNPGDHVIDATVGNGHDTVYLAKLVGTTGRVDGFDIQSAAIEATTTALDKAALTHQVTLWQTGHEHIADKIAADQPIKCAVFNLGYLPGGDKQIITKPTTTLTAIKAIQERLVTNGLIILLVYAGHPGGATEAQAVLDYVTNLDQHQFQVLQYQFINQVHVPPYLLAIQKR
>NZ_CP025590.1|WP_013355437.1|930628_931312_-|phosphatase-PAP2-family-protein
MAIIYLSEESVLKQRSWQRSDSLILLIFIGWLGWTAAVWQRAPWLTHFDTTVANFWHHSPQWFQHVMVTYTQLGNPHTITIITLIIGLALWLGHNPRGAVFFWVTTWLIAGYGNYLIKQVIMRPRPTAWRLVQIGGYSYPSGHSTTTTVLIGSLLVLAFDYWHRNALTGWLTALGITAILLMMISRVIVGVHYPSDTIGGLLLGSVLLYISARFSTRYRHGPLRLRP
>NZ_CP025590.1|WP_003643180.1|931774_934201_+|leucine--tRNA-ligase
MAYNHKVIERKWQHYWKENKTFKTLDTTDKKKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYALKTGHNPKDFTAKNIKNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYKKGLAYESETLVNWAPDMMGGTVVSNEEVVDGKTERGGYDVYRVPMKQWSLKITAYADRLIDDLDDIDWPENIKEQQRNWIGRSVGASIRFKVAGQPDDTEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPEQADAIKAYKAKIASKSDLERTDLNKDKTGVFTGSYGINPVNGEKLPIWIADYVLASYGTGAIMAVPAHDDRDFEFAQKFDLPIKPVIAGDNDYDQQAYTGDGEHINSGFVDGLAKQPAIDKMIDWLGEHHAGEKKVNYRLRDWIFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATKNLEPSGTGESPLANIDDWVNVVDENGRKGKRETNTMPQWAGSSWYFLRYVDPHNREALADYDKLKYWSPVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGDNHEKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWIERVWRLMIDENNRVRDRITTINDGKLTKIYNETVKKVTEDYEAMRFNIAISQMMVFVNEAYKVDDLPIIYIEGFVKLLSPIAPHLSEELWSLLGHDDTITYATWPTYDESKLVEDTVQIVLQVNGKVRSHAEVAKDMGKDELEKLALADEKIQEFTAGKTVRKVIAIPGKLVNVVAN
>NZ_CP025590.1|WP_011101352.1|934724_936395_+|polysaccharide-biosynthesis-protein
MSEESKANQPQNAHVNSEAEAHQKMVRGSAWMTAGSLFSRVLGAIYIIPWVIWMGADYTQGNALYAKGYNIYSFFLLIAIGGIPSAISKQLSEYNAMNEYAVGQRLFKRGLLLTSAFGIIGAIILWFGAGLISTAFGGYDANLIPVLHALAIALVILPSMSLTRGFFQGYQQMAPSAISQFVEQVFRVIYMLGATYFIMRVAHGDWVNAVTQSTFAAFVGAAASFLLLGWYYFRKRPELNALAAQSENKLVIPVWQLFRDIIIQAIPFIVIDTATTVFNLLDQATFQPMMRLVYHLGTKQIDTLYAYFAFNANKLVMIIVSLASAIAVTVVPILSESLASHNMRNIRKQLEDSIILFLFIMIPGALGMAAVAQPLNTLFYSYDQIGTLILQISAFTAIALGFFTVISALMQGLSRNRDIIRYYLIGLLVKIVIQLPCIYFLSTAGPLVATAIGMMVASLMAMYDLEVNFGIRYVKLLPKINRILVYSILTYVTARLVVYGLNFVLNEHSKTQSFLIVALAVIAGGAVYVYLALRSRMADLMIGTKAAGLRRKLRIK
>NZ_CP025590.1|WP_003643178.1|936402_937143_+|rRNA-pseudouridine-synthase
MRVDKFLHAMRIGTRTQVRRLIKDGHITANGEPVISGKQQINPGSDTVFLDDVQVRYQQYFYYVMNKPVGVITATTDSAAKTVMDLFNTTDFRDDLFPVGRLDKDTEGILVITNDGALSHDLLSPNHHVTKVYEAEVTGEITAAQLANFNDGITLKDGTELQPAQAEIVQFHEIENFTTIRIMIHEGKYHQVKRMVGTLGERVVGLRRIKFGSLTLPVGLLAGNYRALTDDELTALKADANQPVGE
>NZ_CP025590.1|WP_003644232.1|937279_938116_-|NAD(P)H-hydrate-dehydratase
MQPITTEIVSRTIIKRPADSHKGNYGRIMLIGGNQNFGGAIIMAATAATYSGAGLVTVATDPSNFTSLHARLPEAMVIDYHQTDTLLNLLAGMDVIVIGPGLGTDTVADQLLTAVLAATHVPQRLVIDGSALTLLAQQARPLPATDIVVTPHQMEWQRLSGIAIKDQTPTANHDAQQRLGVTAVVKAHRTTVYTDERVWFNPGGTPAMATGGMGDTLAGMIGGFVSQFHNFTDAVLSAVYLHSAIADDLAATRYVVLPHQISARIPTYMHRFSQIERP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025590_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025590_2

2285781-2286006

Orphan

Consensus_repeat	Method
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	PILER-CR

2 spacers

csa3

The CRISPR arrays of NZ_CP025590_2

>merge|NZ_CP025590|2|2285781-2286006|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAATGTTCCAAGCCCATTAGTAACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAACGTTCCTAGCCCATTAGTGACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

>NZ_CP025590|2|1|2285781-2286006|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAATGTTCCAAGCCCATTAGTA
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAACGTTCCTAGCCCATTAGTG
ACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025590.1\|WP_024002907.1\|2288248_2289193_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|214889
NZ_CP025590.1\|WP_033617510.1\|2286769_2287324_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025590.1\|WP_003644778.1\|2293277_2294900_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP025590.1\|WP_187345420.1\|2296101_2298027_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP025590.1\|WP_033617504.1\|2281992_2282550_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025590.1\|WP_060684135.1\|2280108_2281503_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP025590.1\|WP_033608924.1\|2291979_2293185_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP025590.1\|WP_024002913.1\|2271761_2272355_-\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224996
NZ_CP025590.1\|WP_015825877.1\|2290681_2291512_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702
NZ_CP025590.1\|WP_003642181.1\|2287422_2287752_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP025590.1\|WP_021356578.1\|2269308_2269992_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP025590.1\|WP_022638329.1\|2276300_2278088_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP025590.1\|WP_033617506.1\|2272503_2273676_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP025590.1\|WP_102124554.1\|2278087_2279839_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP025590.1\|WP_011101965.1\|2289269_2289815_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP025590.1\|WP_022638328.1\|2274634_2275663_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP025590.1\|WP_011101955.1\|2273665_2274532_-\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP025590.1\|WP_027821794.1\|2270375_2270936_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025590.1\|WP_003642184.1\|2290077_2290605_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP025590.1\|WP_015380831.1\|2295220_2296015_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319820

Protein	Function_ID	Function_description	E-value
NZ_CP025590.1\|WP_024002907.1\|2288248_2289193_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|214889	smart00892, Endonuclease_NS, DNA/RNA non-specific endonuclease. A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.	6.05604e-24
NZ_CP025590.1\|WP_033617510.1\|2286769_2287324_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.68761e-08
NZ_CP025590.1\|WP_003642181.1\|2287422_2287752_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.32613e-13
NZ_CP025590.1\|WP_060684135.1\|2280108_2281503_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.66222e-56
NZ_CP025590.1\|WP_033608924.1\|2291979_2293185_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.00928e-09
NZ_CP025590.1\|WP_024002913.1\|2271761_2272355_-\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|224996	COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only].	3.74555e-34
NZ_CP025590.1\|WP_015825877.1\|2290681_2291512_-\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	3.51122e-07
NZ_CP025590.1\|WP_187345420.1\|2296101_2298027_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	5.35394e-122
NZ_CP025590.1\|WP_021356578.1\|2269308_2269992_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	6.30531e-49
NZ_CP025590.1\|WP_022638329.1\|2276300_2278088_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.89578e-169
NZ_CP025590.1\|WP_033617506.1\|2272503_2273676_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	2.15099e-145
NZ_CP025590.1\|WP_102124554.1\|2278087_2279839_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP025590.1\|WP_011101965.1\|2289269_2289815_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.46296e-18
NZ_CP025590.1\|WP_022638328.1\|2274634_2275663_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	1.04581e-136
NZ_CP025590.1\|WP_011101955.1\|2273665_2274532_-\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	4.36824e-180
NZ_CP025590.1\|WP_003644778.1\|2293277_2294900_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP025590.1\|WP_003642184.1\|2290077_2290605_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.41001e-30
NZ_CP025590.1\|WP_015380831.1\|2295220_2296015_-\|HAD-family-hydrolase	gnl\|CDD\|319820	cd07518, HAD_YbiV-Like, Escherichia coli YbiV sugar phosphatase/phosphotransferase and related proteins; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli YbiV can act as both a sugar phosphatase and as a phosphotransferase. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.17921e-48

>NZ_CP025590.1|WP_033617504.1|2281992_2282550_+|hypothetical-protein
MNYTSQANIHKFTVSLVIILLSSILISTTITLKISANTTSSSQQAIDCIAQELADVSNSIRYDPQTGLATNLDVNALVSKYGSNNQNQLQHINEIMKYEYKRNLQFNQGKLNSIQTRSFWSCMKNQLLDMIGYQTFQALLRGGIQGLIQRKAWKAAAKLLIRYLGDGIGVGFIAAQLSWYAIRCA
>NZ_CP025590.1|WP_060684135.1|2280108_2281503_+|MFS-transporter
MSQPSTVTLKTKLAILSVGLLSFVGILVETSMNVTFPTLIKTMGVSLDTVQWLTTGYLLLTTIVMSTTAYVLKRFNPKPLFLFAALVCLLGGILCWLAPNFPILLTGRLLQAVATGISIPLMFQLIFTYVPRNQLGTYTGLASVIVSLAPALGPTYGGILTSVWSWRAIFVGIVPLLALLAILGAFNISGKALGVGDKKFDYLGAILLAITFTSLLFTFNNAGTHGWLSPNFGLWCLWSIVMIGAMVTYAIKGRRQLIDYSILKLPILRLRLFNYFGLQFINIGLSFVLPLFAQTVLGASAMTAGLMMLPGAIVGAITGPIAGRIYDKQGPTTLLTFSAIMASAALLLFWLTTDYFTVIIMAVIYALLRVGFNTGFGTAISDGSTRVPLPQKSDQNSMFSMMQQYAGSIGTSIMSAVIAGYEIHHPTVTGTIMGSKLDFLLLFVLAIAILISVLHVKRLEIGQN
>NZ_CP025590.1|WP_102124554.1|2278087_2279839_-|ATP-binding-cassette-domain-containing-protein
MSIFLKLGWYFRREWKLYLAGVLGLVLTAIIGIVPPRIIGDVVDGINQHSLTAHTLAVYLVIIGVAAVGQYLARYLWRNAIWGGAAGLERTLRERLFWHFMKMDATFYQQYRTGDLMAHATNDLTAVERVAGGGILQFADSIITGGTTLIAMMTLIDWRLTLIAVVPFPLLAVVSRYLGKKIHVAFRASQAAFSRLNNKAQESISGIKVIKALGQEKADVADFNQQIDQTIKINRHVNVLDSLFDPAITMIIALSYGATIILGGLYVTHGVITIGNLVSFVTYLGMMVWPMFAVGMLFNTMERGNASYDRVMELLNQQSAIIDAKRGIEQRPHGDIQYQIKQFNYPNDAGTSLSNVDFTLKAGQTLGIVGRVGAGKSTIMKLILREFDQYEGHITYGGHDIKQYALDSYLPALGYVPQDSFLFSNTIRENIRFADPTVSQAVVEAVAAKSDLSGQIASMPAGYDTQVGEEGISLSGGQRQRLAIARALLINPELLILDDALSAVDAETEAEILANLKAERADKTTIIAAHRLSSVMNADEIIVLDAGHVVERGTHAQLMTQHGWYQKMFTRQQLEIKVEGAVQ
>NZ_CP025590.1|WP_022638329.1|2276300_2278088_-|ABC-transporter-ATP-binding-protein
MAARQSVWARSMPVKEQLTVIRRLLPYAKPFKWFFIAAIVFSGLISVVNIYLPRVLQTFIDHYLKTGHATVPVMWYFAGLYFFGMVVRALMQFVQNFSSTMGAEYMLENVRRQMFAKLHRMGMRYFDQVPGGSILSRLTNDTMSFSNFWALFNTLFTAFFAVISSFVAMYLTDAQIALWLLIFMPFLAVTIWYYQRYSSRVYRRMRERLSELNTKLSEAITGISVIQQFRQEHRINGEFDHTNDAYFKTRQAMIRTNSLLLSPLIDLFYALGTVMVLGIFGVRGLNGYVAAGVVYAFITYLNNFYNPMTSMMDNLSDFQDGVVAGSRVLRVMDDPTIAPTQHADPTAKITRGKIEFRHVTFAYDGQHPVLKDVSFVAEPGQTVALVGQTGSGKTSTINVLMRFYEFQSGEVLIDDRDIREYPAEELRQKMGLVLQEPFMFYGDINSNIRMFNDQISDEQVQAAARFVKADDFINDLPENYQSRVIERGASYSSGQRQLISFARTIVTDPKILILDEATANVDTETEEMIQTGLDRIQENRTTIAIAHRLSTIQNADLILVLNQGQIVERGSNDELLQQHGYYYDMIQLQNSAHVD
>NZ_CP025590.1|WP_022638328.1|2274634_2275663_-|aldo/keto-reductase
MQYRQLGTSDLKVSSIALGCMGFGAGTGTALNQRSWAVGQTQANQVLDRAISLGINFFDTAPVYQAGASERVLGQGLKKFQRDQLVLATKFTNRTTQEIENHVSGREHVLRSLDQSLQNLQTDYVDLYIYHIWDWLTPMAEIMAGLNEAVQAGKVRYIGISNAYSWQIAQINALAVRYGYPQFVSIQSHYNLVYREDERELFSYAHENGLATTPYSPLASGRLAHPFGTQTTRRQQDTFADTKYQATSEMDQPIIDRVEELARQHHVSMAAINLAWLQQRVTAPIIGATKPHHLDAVAEAAGLALTASEIQYLESPYQPHDLEGVMALNRSRTNNWNQYSGQ
>NZ_CP025590.1|WP_011101955.1|2273665_2274532_-|DUF3737-family-protein
MKTITQQYLTGERALFKAHDLEIDNTTFADGESPLKESRNVTLKQPIFKWKYPLWYSQHVTVDQGLFETMSRSGIWYTKDITITNSTLQAPKLFRRASQVKLAHVHFSDAEETLWNCQDITLNDVQAAGDYFGMNSQNIRIDGFNLVGNYAFDGAKNVEIHHATLMTKDALWNCENVTVYDSQIIGEYLGWNSKNIRFVNCTIESDQGLCYMDNVKLENCTLLNTDLAFEYCRNIDADVVSTIDSVKNPLSGRIHAQAIGEIIMDDPEVDPHQTLISVDHESRAPHAV
>NZ_CP025590.1|WP_033617506.1|2272503_2273676_-|pyridoxal-phosphate-dependent-aminotransferase
MPFDFETVLNRRHTNAVKWDVADNELPMWVADMDFETAPVIKQALIKRAQFGVFGYEEVPTAYYEAVADWWATEHNFRPQIEWLMFCTGVVPAISSIVRKMTAAGDNVLVQAPVYNIFYHSIENNGRHTLSSDLVARDASYAIDWDDLTTKLADPLTTMMILCNPQNPIGIVWSRATLQRLGELCLKYHVLVVADEIHCDLTLNGHTYTPFSSLTAPVAHNSISCISPSKTFNVAALHAATLIIPDAHVRALVSRGINNDELAEPNSFAIPASIAAYTEGHDWVAALRTKLAANQRQVQTYLTAELPQVKLVEAQATYLLWLDVSQVTTDSAALAAFIRQRTGLFLSAGDVYRGDGNRFLRLNVACPTTTLTDGLARLKAGITAYQQVQA
>NZ_CP025590.1|WP_024002913.1|2271761_2272355_-|NAD(P)-binding-domain-containing-protein
MEIGIIGAGTVGTVLAKTFARGDHQIKLSRHSGAASLATRRAEFAANVAFVEVAEALQQPLVILAVPFEQAPAVLAQVADYKQRIVVDVTNQFTADFKKIKTAPLTGSEVIARAANNARVIKAFNTIPPEFMDGHVAGPGKRVLFYAGDDVAAKKEFAALVRPLNFRPVNLGKLRHGGSVMQVGGGLGNTHFVQIEE
>NZ_CP025590.1|WP_027821794.1|2270375_2270936_-|hypothetical-protein
MSSYSNELLMLIFQSTLFKQVIILFAYGCLYYLVTHFIDKKIQHKKNFLLKLGLVKLKKRNKTRWEKIRLIMQLFLLASIPVLVFSELVLNTDYQYMLLVSSIMKCVGFISFVIAFVDSLGPIKEMQQLIAGAQSSDTLDSDKKALAVTSFKKIRWMLILYQVLKVPLLVIFLSLSVDYRRDGFFS
>NZ_CP025590.1|WP_021356578.1|2269308_2269992_+|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MQYAIFDLDNTILDFDRAEAANLAAVFQHHGVTDIRRAENEYQAYNETVWQQIEQGADRDSLLDQRFQVFLGTLGITVDGPAVQQEYDQLLAHSYQVIPGAHELLRTLTNAGLTLLVGTNGIKHTQLSRLAGAHMTPYFDHIFISESIGYAKPNPHFFNAIHDQYPDMNATNTVMIGDSLRSDIAGAATVQLPSIWYNPQHAHNDTTIAPTYTVDNFKQLQKLLLTA
>NZ_CP025590.1|WP_033617510.1|2286769_2287324_-|TetR/AcrR-family-transcriptional-regulator
MVISIRTELDLQRAMYQLLEQRSISQITVEQICKQAFIHRSSFYRYYTDKFDLLRQMVMHTLDELLAAERTNTVGSAIMSTFIGAHTQVLRHLLVTNNEGDNTRSQQVINDCFVTVAETGADDRVFAMIRQSQHPDLTAYLVSGVVTSIVQWLNNGHRDGQAASTQAMIQGTLATVFSLEQHTV
>NZ_CP025590.1|WP_003642181.1|2287422_2287752_-|winged-helix-turn-helix-transcriptional-regulator
MVSSEEALQEFRETIPIFEVLADERRQQIMIELSQHAQGMTVGELTERMHISQPAVSHQLKTLKERHFVAVEHQGTRNYYRVTFDAPLTQVEHLIHTLKADLELKPYLH
>NZ_CP025590.1|WP_024002907.1|2288248_2289193_-|DNA/RNA-non-specific-endonuclease
MVKLMRRVGIAGLLSLSLLLGGCSLLTSGTDTTSSTTSQQSESSRNQTTSATGNTQQTYKQLAKMTYQSGSAAAIKVNSGKSTLAASQWKNSKIDYGNLDSLNRTTTDTAYLSKANLGRSEGRTAQTWSPTGWHNQPITVNGKRVYPQNRGHLIAYTLSFNLTSNGQYRAGEDGSLDNPKNLATQTAYSNQKTMQIYEDQVRTALEQGKKVIYRVTTVFRGNELMPRGYWSQAVSTDGSVNFNVYIWNVEPGVSFDYATGRGKADSTMQVAGADKVSSSQNTSASRSSQSTTTSKQVERELVKYGYKYVKKALN
>NZ_CP025590.1|WP_011101965.1|2289269_2289815_-|GNAT-family-N-acetyltransferase
MTATITIRPLQRAELTMLWQLGFSDPNAEWTRWNGPYFHDQLPTQTDFETIIGPRDWLIRPRNWVITRDGVIVGSVNWHFVDGSLKRWLEVGIIIYNQEHWGEHIGRTALTKWLTHLFQEETTLPHIGLTTWSGNMRMMQLAEAVGLKQEAWIPQVRYWQGQYYDSVKYGILRNDWQVQKD
>NZ_CP025590.1|WP_003642184.1|2290077_2290605_-|GNAT-family-N-acetyltransferase
MTQFETERLILRPMTAADHDALADMIFDPQVVAYLRYRRVQSPAAFEQLFTTHFLADTTTVFGIERRRDHQLIGFYEFHGSGATGELTYALSPAAWGHGYVAEAGNCLMHYGFETLNYETIEAHYASANPNSGRVMAKMGMQAAGELHTFTSDKGEVIHVMRYLLTKATWRQLSA
>NZ_CP025590.1|WP_015825877.1|2290681_2291512_-|phosphotransferase
MRTLHKTLTRLLQADLIPIAHVSFNEMYTGYSRRYDTVVFVKVFSPNHERKFRTEQQVTAQLTDRVLASFQLASREWVLVLRDWQLTPVPTTLTPALVYQMGQVVSRFHHAIQLPTTADLMPVLDFDGMAARVERLKTSPHYDALVSLLPYFLDHRTMIITALAPQPVMTLHGDMGTRNFRYHHGQLVLIDFERARHGYALEDCLKFFFEDLQQSATLIQAFWAGYGTDLQIPPLVTQWLLLQCSTGIFTYVNQITDPRFEAVGTAMLAQVTLPNH
>NZ_CP025590.1|WP_033608924.1|2291979_2293185_-|CPBP-family-intramembrane-metalloprotease
MTPETEQLLRRWYMGQLIVLFGAAFIQLFTFDGGVFFPVGGMQLLIWGLLAWWPAAEEDQAQWRRLRHVNYYVQTVLQFTLLPILLANLVAWLSQLSWLDEQGLIAVGMAYLMVAFVPVAVVVTKPIESVIGRIAVLITAIFSGVVSAQQTFLVLPNLQAPSVFEMVSDTGILGALGFVIAVGVLLRGWGLTGPSWRFNRQAQTSLVVGLIVVGTAFSLWNAFSAGGSWATTFTHWDFQLRSATWKMFLSGLEPGIAEEWLYRFAVLTLLLQAFRHRRHQLDLAVWLSGGLFGMWHITNVFAGQPLSATVEQIIFAATLGWFLASTYLYSGSILLPMVIHAAIDILSMMASGSQTMVKPDAFEWQTIGATVIIFVGITIYFLTGSRRQVIQAHVNQRLSVQ
>NZ_CP025590.1|WP_003644778.1|2293277_2294900_-|ATP-binding-cassette-domain-containing-protein
MLTVNNVSMQFSTRKLYEDVNLKFTPGNCYGVIGANGAGKSTFLKILEGKLQPTTGTVSMGPNERMSSLNQNHFAFEDEEVLATVIRGHEKLYEIMTEKDALYAKPDFSDEDGIRAAELEGEFAEMDGWNAESEADQLLQNLGIDESMQHLKMSELTEPQKVKVLLGQALFGSPDVLLLDEPTNGLDVQSISWLEDFLAGYEKTVIVVSHDRHFLNQVCTHMCDVDFGKITLFVGNYDFWMESSQLAAKLQANANAKKADQIKELQEFVARFSANASKSKQATSRKKQLEKITLDDIKPSSRKYPFIKFTPDREIGNDLVKVENVSKSIEGVKILDNISFTLRPNEKTALISRNDLATTTLMQIIAGSMAPDSGTVTWGQTTSRTYLPKDINEEYAGSELPIIDWLRQFASKEESDNTFLRGFLGKMLFSGSDVERPVNVLSGGEKVRGMLSKMMLSRANVLLLDDPTNHLDLESITALNDSLIDFKGAIVFTSHDHEFIQTIADHIVEVSAKGVVDRGDTTYDEYLAHEATQGRVQDLY
>NZ_CP025590.1|WP_015380831.1|2295220_2296015_-|HAD-family-hydrolase
MTIKLIATDMDGTFLNDHGDYDQERFANDYAALQRRGIQFVIASGHQAAELATTFSAYPEMWLIGGNGAELWQREAGLKAATFSPQATQQVLAALAPYPELQVALCGTQTVHVLAHANPQFVANMRDYYYQLETCADLTTVTDPVVKFDVICPAAMTDQLVYELTPKLAGIAVPASGGQGSMDLIQPGMHKGRALKQLGEQLGILPDEMLVFGDGTNDLEMFHYATHAVAMQNAPENVQANATAVTGTNVDNGVLDYIEQHILS
>NZ_CP025590.1|WP_187345420.1|2296101_2298027_-|DUF2207-domain-containing-protein
MPKKALAVSRAPRLGEYDKLGLTIIGGGDGEMSKKRRLSWLSVLGLLAGFCWWFSLAMRAAADYDIDQYQVNVAIQRDGSANVTQAMTYQFDDDYHGVFNVQDLKGIQGAQLEGVTTQLNGGTTVTAAPSETGANNTYQLTQNADRMRVKLYRQVQEDDKLRVVYRYRLKGVVTNYADTAELNWKVIGSGWDVPLNNVKIVIQLPAKNVSALQAWTHGPLSGQTKVERAAGRVTMTLGHNPANQFVESHLLFPTTVTATNTRTNTAKRKATVQKQEAKLAQEANEKRRRNRLLRRVIFGTAVAGWLLVMIGYLWWLARHPAKPHQQPIPINHSFDVPPVTPAVAESLWAQRSPNTDALTAEILRAAANHEITIETVAGHRKPDVRLTQLKPVTNSFLAHCFDKIAVDGQFMLTDLKKYGKRDKAGRLGKWFSRWQTEVDQDVAVYQDETNYRLRNQWLMVAVVVSVMGMIATGAGLLVSPKVVTLMVIPAIVAAVAFWIGWIIQRRRIAINTDAGLELRNQINGLRRMLKDIGHFNTAQVGDLILWEQILPYAAAFGLANQVTKQLTIDFGTEALATGMLVYYPLFYANGGLDFDLSGAINDSFSGALDASGSASSASGGSGGFSGGSSGGFGGGSGGGAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025590_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025590_3

2470536-2470621

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025590_3

>merge|NZ_CP025590|3|2470536-2470621|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP025590|3|1|2470536-2470621|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025590.1\|WP_044432936.1\|2471358_2472240_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP025590.1\|WP_003643401.1\|2475549_2476062_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP025590.1\|WP_003642346.1\|2467972_2468926_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP025590.1\|WP_003642350.1\|2472524_2473319_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP025590.1\|WP_011102040.1\|2465307_2465874_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025590.1\|WP_003642342.1\|2464420_2465149_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP025590.1\|WP_022638460.1\|2469042_2470521_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP025590.1\|WP_102124566.1\|2467186_2467753_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP025590.1\|WP_011102046.1\|2478757_2479594_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP025590.1\|WP_003642344.1\|2466000_2467038_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP025590.1\|WP_003643400.1\|2473315_2474314_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP025590.1\|WP_063733572.1\|2458803_2460216_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP025590.1\|WP_003642355.1\|2477229_2477976_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP025590.1\|WP_003642340.1\|2463354_2463639_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP025590.1\|WP_003643398.1\|2470638_2471238_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025590.1\|WP_022638457.1\|2477992_2478448_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NZ_CP025590.1\|WP_011102039.1\|2463922_2464288_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP025590.1\|WP_011102044.1\|2476042_2476936_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP025590.1\|WP_011102043.1\|2474310_2475306_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP025590.1\|WP_102124565.1\|2460486_2463069_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382

Protein	Function_ID	Function_description	E-value
NZ_CP025590.1\|WP_044432936.1\|2471358_2472240_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NZ_CP025590.1\|WP_003643401.1\|2475549_2476062_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP025590.1\|WP_003642346.1\|2467972_2468926_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP025590.1\|WP_003642350.1\|2472524_2473319_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP025590.1\|WP_011102040.1\|2465307_2465874_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP025590.1\|WP_003642342.1\|2464420_2465149_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP025590.1\|WP_022638460.1\|2469042_2470521_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP025590.1\|WP_102124566.1\|2467186_2467753_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	6.57389e-29
NZ_CP025590.1\|WP_011102046.1\|2478757_2479594_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP025590.1\|WP_003642344.1\|2466000_2467038_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP025590.1\|WP_003643400.1\|2473315_2474314_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP025590.1\|WP_063733572.1\|2458803_2460216_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP025590.1\|WP_003642355.1\|2477229_2477976_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP025590.1\|WP_003642340.1\|2463354_2463639_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP025590.1\|WP_003643398.1\|2470638_2471238_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP025590.1\|WP_022638457.1\|2477992_2478448_-\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NZ_CP025590.1\|WP_011102039.1\|2463922_2464288_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP025590.1\|WP_011102044.1\|2476042_2476936_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131
NZ_CP025590.1\|WP_011102043.1\|2474310_2475306_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78
NZ_CP025590.1\|WP_102124565.1\|2460486_2463069_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.97913e-70

>NZ_CP025590.1|WP_022638460.1|2469042_2470521_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP025590.1|WP_003642346.1|2467972_2468926_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP025590.1|WP_102124566.1|2467186_2467753_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYVLTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP025590.1|WP_003642344.1|2466000_2467038_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP025590.1|WP_011102040.1|2465307_2465874_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP025590.1|WP_003642342.1|2464420_2465149_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP025590.1|WP_011102039.1|2463922_2464288_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP025590.1|WP_003642340.1|2463354_2463639_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP025590.1|WP_102124565.1|2460486_2463069_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATTATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKSASSAATSTSAKATSQATSVTSSTATTTQVSRTASSTAASAASSTATVKAVTPASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEVTTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYYAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP025590.1|WP_063733572.1|2458803_2460216_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSFRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP025590.1|WP_003643398.1|2470638_2471238_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP025590.1|WP_044432936.1|2471358_2472240_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP025590.1|WP_003642350.1|2472524_2473319_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP025590.1|WP_003643400.1|2473315_2474314_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP025590.1|WP_011102043.1|2474310_2475306_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP025590.1|WP_003643401.1|2475549_2476062_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP025590.1|WP_011102044.1|2476042_2476936_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP025590.1|WP_003642355.1|2477229_2477976_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP025590.1|WP_022638457.1|2477992_2478448_-|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP025590.1|WP_011102046.1|2478757_2479594_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP025590_2	2.1\|2285839\|26\|NZ_CP025590\|PILER-CR	2285839-2285864	26	NZ_CP025590.1	2285755-2285780	0	1.0

1. spacer 2.1|2285839|26|NZ_CP025590|PILER-CR matches to position: 2285755-2285780, mismatch: 0, identity: 1.0

cattcaatgttccaagcccattagta	CRISPR spacer
cattcaatgttccaagcccattagta	Protospacer
**************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157297-157327	0	1.0
NZ_CP025590_1	1.19\|923662\|19\|NZ_CP025590\|CRT	923662-923680	19	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151492-151510	0	1.0
NZ_CP025590_1	1.19\|923662\|19\|NZ_CP025590\|CRT	923662-923680	19	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155575-155593	0	1.0
NZ_CP025590_1	1.19\|923662\|19\|NZ_CP025590\|CRT	923662-923680	19	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157495-157513	0	1.0
NZ_CP025590_1	1.19\|923662\|19\|NZ_CP025590\|CRT	923662-923680	19	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3526-3544	0	1.0
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157477-157513	0	1.0
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157495-157525	1	0.968
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157585-157615	1	0.968
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1540-1570	1	0.968
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1954-1984	1	0.968
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3166-3196	1	0.968
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	982-1012	1	0.968
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154039-154069	1	0.968
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154237-154273	1	0.973
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154627-154663	1	0.973
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154861-154897	1	0.973
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156319-156349	2	0.935
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157423-157453	2	0.935
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157261-157291	2	0.935
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2272-2302	2	0.935
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3040-3070	2	0.935
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155899-155929	2	0.935
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152002-152032	2	0.935
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156025-156055	2	0.935
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2536-2566	2	0.935
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157567-157603	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151780-151816	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153451-153487	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153649-153685	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153667-153703	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154393-154429	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154411-154447	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155059-155095	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155293-155329	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156823-156859	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156841-156877	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156991-157027	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157009-157045	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157135-157171	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157279	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157495	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157549-157585	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2254-2290	2	0.946
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1144	2	0.946
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151492-151522	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153061-153091	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153907-153937	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154465-154495	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154663-154693	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154879-154909	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155077-155107	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155311-155341	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155575-155605	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1054-1084	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1252-1282	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1486-1516	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1612-1642	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3094-3124	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3130-3160	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3358-3388	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3526-3556	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3544-3574	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1144-1174	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153079-153109	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153577-153607	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153595-153625	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155881-155911	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156373-156403	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3184-3214	3	0.903
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3238-3268	3	0.903
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156319-156349	3	0.903
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3040-3070	3	0.903
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157423-157453	3	0.903
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2272-2302	3	0.903
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156301-156337	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157405-157441	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151402	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153007-153043	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153871-153907	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154219-154255	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157117-157153	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1396-1432	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1594-1630	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1750-1786	3	0.919
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3022-3058	3	0.919
NZ_CP025590_1	1.25\|924112\|31\|NZ_CP025590\|CRT	924112-924142	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15526-15556	3	0.903
NZ_CP025590_1	1.25\|924112\|31\|NZ_CP025590\|CRT	924112-924142	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15652-15682	3	0.903
NZ_CP025590_1	1.25\|924112\|31\|NZ_CP025590\|CRT	924112-924142	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9571-9601	3	0.903
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151840-151870	4	0.871
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153199	4	0.871
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153613-153643	4	0.871
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156655-156685	4	0.871
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1768-1798	4	0.871
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155503-155533	4	0.871
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156283-156313	4	0.871
NZ_CP025590_1	1.26\|924184\|31\|NZ_CP025590\|CRT	924184-924214	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21139-21169	4	0.871
NZ_CP025590_1	1.26\|924184\|31\|NZ_CP025590\|CRT	924184-924214	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21337-21367	4	0.871
NZ_CP025590_1	1.26\|924184\|31\|NZ_CP025590\|CRT	924184-924214	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15940-15970	4	0.871
NZ_CP025590_1	1.26\|924184\|31\|NZ_CP025590\|CRT	924184-924214	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9697-9727	4	0.871
NZ_CP025590_1	1.26\|924184\|31\|NZ_CP025590\|CRT	924184-924214	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9841-9871	4	0.871
NZ_CP025590_2	2.1\|2285839\|26\|NZ_CP025590\|PILER-CR	2285839-2285864	26	AP014283	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, * SEQUENCING IN PROGRESS *	15532-15557	4	0.846
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3670-3700	5	0.839
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2608-2638	5	0.839
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153931-153961	5	0.839
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2326-2362	5	0.865
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157714-157744	6	0.806
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1714-1744	6	0.806
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2350-2380	6	0.806
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3058-3088	6	0.806
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156715-156745	6	0.806
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156865-156895	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16070-16100	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16202-16232	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16334-16364	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16742-16772	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17360-17390	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17510-17540	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17576-17606	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17738-17768	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18092-18122	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18236-18266	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18500-18530	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18674-18704	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18824-18854	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19220-19250	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19574-19604	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19646-19676	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19718-19748	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19778-19808	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19898-19928	6	0.806
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20084-20114	6	0.806
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1768-1798	6	0.806
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154219	6	0.838
NZ_CP025590_1	1.16\|923458\|31\|NZ_CP025590\|CRT	923458-923488	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3058-3088	7	0.774
NZ_CP025590_1	1.20\|923722\|31\|NZ_CP025590\|CRT	923722-923752	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1714-1744	7	0.774
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155779	7	0.811
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2152	7	0.811
NZ_CP025590_1	1.14\|923296\|31\|NZ_CP025590\|CRT	923296-923326	31	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	20505-20535	8	0.742
NZ_CP025590_1	1.17\|923530\|31\|NZ_CP025590\|CRT	923530-923560	31	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	20505-20535	8	0.742
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153859	8	0.784
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156133	8	0.784
NZ_CP025590_1	1.22\|923854\|37\|NZ_CP025590\|CRT	923854-923890	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156607	8	0.784

1. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagtgattcggactcggacagc	Protospacer
*******************************

2. spacer 1.19|923662|19|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgattcggactcggacagc	CRISPR spacer
cgattcggactcggacagc	Protospacer
*******************

3. spacer 1.19|923662|19|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgattcggactcggacagc	CRISPR spacer
cgattcggactcggacagc	Protospacer
*******************

4. spacer 1.19|923662|19|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgattcggactcggacagc	CRISPR spacer
cgattcggactcggacagc	Protospacer
*******************

5. spacer 1.19|923662|19|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgattcggactcggacagc	CRISPR spacer
cgattcggactcggacagc	Protospacer
*******************

6. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactcggacagcgattcggactctgacagc	Protospacer
*************************************

7. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagcgattcggactcggacagc	Protospacer
************.******************

8. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagtgattcggactctgacagc	Protospacer
************************ ******

9. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagtgattcggactcggacagc	Protospacer
 ******************************

10. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagtgattcggactctgacagc	Protospacer
************************ ******

11. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagtgattcggactctgacagc	Protospacer
************************ ******

12. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.968

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagtgattcggactctgacagc	Protospacer
************************ ******

13. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattccgacagtgactccgattcggacagc	Protospacer
*********.*********************

14. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggactctgacagc	Protospacer
************ ************************

15. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggattcggacagcgattcggactctgacagc	Protospacer
*********.***************************

16. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggattcggacagcgattcggactctgacagc	Protospacer
*********.***************************

17. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattcggacagtgattcggactcggacagc	Protospacer
 ***** ************************

18. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggactcggacagc	Protospacer
 **.***************************

19. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattccgacagcgattcggactctgacagc	Protospacer
************.*********** ******

20. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgattcggactcggacagc	Protospacer
 *****.************************

21. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattcggacagtgattcggactcggacagc	Protospacer
 ***** ************************

22. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattccgacagtgactccgattcggacagt	Protospacer
*********.********************.

23. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattcggacagtgactccgattcggacagc	Protospacer
****** **.*********************

24. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggactccgacagtgactccgattcggacagc	Protospacer
***.*****.*********************

25. spacer 1.16|923458|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggactctgatagtgactccgattcggacagc	Protospacer
***.**.************************

26. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactctgacagcgattcggactctgacagc	Protospacer
.*********** ************************

27. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggattctgacagc	Protospacer
************ **************.*********

28. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgactcggattcggacagcgattcggactctgacagc	Protospacer
***.*****.***************************

29. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgattcggactccgacagc	Protospacer
************ *****************.******

30. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgattcggactccgacagc	Protospacer
************ *****************.******

31. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattccgactctgacagc	Protospacer
************ *********** ************

32. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggattctgacagcgattcggactctgacagc	Protospacer
*********.** ************************

33. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggattcggacagcgattcggactccgacagc	Protospacer
*********.********************.******

34. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggattcggacagcgattcggactccgacagc	Protospacer
*********.********************.******

35. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgattcggactccgacagc	Protospacer
************ *****************.******

36. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagc	Protospacer
************ *****************.******

37. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgattcggactccgacagc	Protospacer
************ *****************.******

38. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagc	Protospacer
************ *****************.******

39. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattccgactctgacagcgattcggactctgacagc	Protospacer
****** ***** ************************

40. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgactcggactctgacagc	Protospacer
************ ********.***************

41. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgactcggactctgacagc	Protospacer
************ ********.***************

42. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggattctgacagc	Protospacer
************ **************.*********

43. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactcggacagcgattcggattctgacagc	Protospacer
.**************************.*********

44. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgactcggactctgacagc	Protospacer
************ ********.***************

45. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattcggacagcgattcggactcggacagc	Protospacer
 ***** *****.******************

46. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattcggacagtgattcggattcggacagt	Protospacer
****** **************.********.

47. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgattcggactccgacagc	Protospacer
 *****.***************** ******

48. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgactccgacagtgattcggactctgacagt	Protospacer
***.******************** *****.

49. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagc	Protospacer
 ***********.********.*********

50. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagc	Protospacer
 ***********.********.*********

51. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagc	Protospacer
 ***********.********.*********

52. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagc	Protospacer
 ***********.********.*********

53. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagcgattcggactcggacagc	Protospacer
 *****.*****.******************

54. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgattcggactctgacagc	Protospacer
 *****.***************** ******

55. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggattcggacagc	Protospacer
 **.*****************.*********

56. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggattcggacagc	Protospacer
 **.*****************.*********

57. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagtgattcggattctgacagc	Protospacer
 ********************.** ******

58. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggattcggacagc	Protospacer
 **.*****************.*********

59. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagtgattccgactctgacagc	Protospacer
 ***************** ***** ******

60. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggattcggacagc	Protospacer
 **.*****************.*********

61. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagcgattcggactcggacagc	Protospacer
 *****.*****.******************

62. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagtgattcggattctgacagc	Protospacer
 ********************.** ******

63. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgattctgacagtgattcggactctgacagt	Protospacer
******.***************** *****.

64. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggactccgacagtgactccgattcggacagt	Protospacer
***.*****.********************.

65. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgattcggacagtgactccgattcggacagc	Protospacer
 ***** **.*********************

66. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattcggacagtgactccgattcggacagt	Protospacer
****** **.********************.

67. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgattcggacagtgactccgattcggacagc	Protospacer
 ***** **.*********************

68. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggactccgacagtgactccgattcggacagt	Protospacer
***.*****.********************.

69. spacer 1.16|923458|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattccgacagtgactccgattccgacagt	Protospacer
*********.************** *****.

70. spacer 1.16|923458|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgactccgacagtgactccgattcggacagc	Protospacer
 **.*****.*********************

71. spacer 1.17|923530|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggacagtgattcagactcggatagc	CRISPR spacer
ggattcggacagtgattcggactcggacagc	Protospacer
 *****************.********.***

72. spacer 1.17|923530|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggacagtgattcagactcggatagc	CRISPR spacer
ggattcggacagtgattcggactcggacagc	Protospacer
 *****************.********.***

73. spacer 1.20|923722|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agactctgatagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggactcggacagc	Protospacer
.*****.**.*********************

74. spacer 1.20|923722|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agactctgatagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgattcggactcggacagc	Protospacer
.**.*****.*********************

75. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactcggacagcgattccgactctgacagt	Protospacer
.*********************** ***********.

76. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactcggacagcgactcggactctgacagt	Protospacer
.********************.**************.

77. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactccgacagcgactcggactctgacagt	Protospacer
************ ********.**************.

78. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgactcggattcggacagcgattcggactctgacagc	Protospacer
.**.*****.***************************

79. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgactcggattcggacagcgattcggactctgacagt	Protospacer
***.*****.**************************.

80. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagt	Protospacer
************ *****************.*****.

81. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagt	Protospacer
************ *****************.*****.

82. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgactctgactcggacagcgattcggactctgacagt	Protospacer
***.** *****************************.

83. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggattctgacagcgattcggactctgacagc	Protospacer
.********.** ************************

84. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactctgacagcgattcggactccgacagc	Protospacer
.*********** *****************.******

85. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgattcggactcggacagcgattcggatgctgacagc	Protospacer
.**************************. ********

86. spacer 1.25|924112|31|NZ_CP025590|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

ggactcagatagtgattccgactcggatagt	CRISPR spacer
agactcagatagtgattccgattcagatagt	Protospacer
.********************.**.******

87. spacer 1.25|924112|31|NZ_CP025590|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

ggactcagatagtgattccgactcggatagt	CRISPR spacer
agactcagatagtgattccgattcagatagt	Protospacer
.********************.**.******

88. spacer 1.25|924112|31|NZ_CP025590|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.903

ggactcagatagtgattccgactcggatagt	CRISPR spacer
agactcagatagtgattccgattcagatagt	Protospacer
.********************.**.******

89. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagt	Protospacer
 ***********.********.********.

90. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggactccgacagt	Protospacer
 ***********.*********** *****.

91. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattccgacagcgattcggattcggacagt	Protospacer
 ***********.********.********.

92. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgattcggactccgacagt	Protospacer
 *****.***************** *****.

93. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgacagcgacagtgattcggactctgacagc	Protospacer
***.  ****************** ******

94. spacer 1.20|923722|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

agactctgatagtgattcggactcggacagc	CRISPR spacer
cgactctgacagtgattcggactccgacagt	Protospacer
 ********.************** *****.

95. spacer 1.20|923722|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

agactctgatagtgattcggactcggacagc	CRISPR spacer
cgactctgacagtgattcggactccgacagt	Protospacer
 ********.************** *****.

96. spacer 1.26|924184|31|NZ_CP025590|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.871

tgactcagacagcgactcaggttccgacaac	CRISPR spacer
agactcagacagcgactcagattcagacagc	Protospacer
 *******************.*** ****.*

97. spacer 1.26|924184|31|NZ_CP025590|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.871

tgactcagacagcgactcaggttccgacaac	CRISPR spacer
agactcagacagcgactcagattcagacagc	Protospacer
 *******************.*** ****.*

98. spacer 1.26|924184|31|NZ_CP025590|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tgactcagacagcgactcaggttccgacaac	CRISPR spacer
agactcagacagcgactcagattcagacagc	Protospacer
 *******************.*** ****.*

99. spacer 1.26|924184|31|NZ_CP025590|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.871

tgactcagacagcgactcaggttccgacaac	CRISPR spacer
agactcagacagcgactcagattcagacagc	Protospacer
 *******************.*** ****.*

100. spacer 1.26|924184|31|NZ_CP025590|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.871

tgactcagacagcgactcaggttccgacaac	CRISPR spacer
agactcagacagcgactcagattcagacagc	Protospacer
 *******************.*** ****.*

101. spacer 2.1|2285839|26|NZ_CP025590|PILER-CR matches to AP014283 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.846

cattcaatgttccaagcccattagta	CRISPR spacer
cattaaatgttccatgcccattaaaa	Protospacer
**** ********* ********. *

102. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggactccgacagtgattcggactccgactcc	Protospacer
 **.******************** ***  *

103. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgacagcgacagtgattcggattctgacagc	Protospacer
***.  ***************.** ******

104. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

ggattccgatagtgactccgattcggacagc	CRISPR spacer
ggattccgacagtgactccgattcggattct	Protospacer
*********.*****************.  .

105. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
ggactcggactcggacagcgactcggactctgactcc	Protospacer
 **.*****************.************  *

106. spacer 1.14|923296|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgattccgacagtgattcggactcggacagc	CRISPR spacer
tgatgccgacagtgactcggactcggactct	Protospacer
.*** **********.************  .

107. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggatgctgacagtgattcggactcggactct	Protospacer
 *** *.*********************  .

108. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattccgacagtgattcggactcggacagc	CRISPR spacer
ggattctgacagtgactcggactcggactcg	Protospacer
 *****.********.************

109. spacer 1.14|923296|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattccgacagtgattcggactcggacagc	CRISPR spacer
cgacagcgacagtgactcggattcggacagt	Protospacer
***.  *********.*****.********.

110. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgactccgacagtgactccgattcggactct	Protospacer
 **.*****.******************  .

111. spacer 1.16|923458|31|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgactccgacagtgactccgattcggactct	Protospacer
 **.*****.******************  .

112. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

113. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

114. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

115. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactctgacagc	Protospacer
 ***   ***************** **.***

116. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

117. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

118. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

119. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactctgacagc	Protospacer
 ***   ***************** **.***

120. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

121. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

122. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactctgacagc	Protospacer
 ***   ***************** **.***

123. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

124. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

125. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactctgacagc	Protospacer
 ***   ***************** **.***

126. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

127. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagcgattcagactcagatagc	Protospacer
 ***   *****.***********.******

128. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

129. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

130. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

131. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgattcggacagtgattcagactcggatagc	CRISPR spacer
agatagcgacagtgattcagactcagacagc	Protospacer
 ***   *****************.**.***

132. spacer 1.20|923722|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

agactctgatagtgattcggactcggacagc	CRISPR spacer
cgacagcgacagtgattcggactctgacagc	Protospacer
 ***  .**.************** ******

133. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.838

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
tgacagtgactctgacagcgattcggactctgacagc	Protospacer
.**.   ***** ************************

134. spacer 1.16|923458|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

ggattccgatagtgactccgattcggacagc	CRISPR spacer
cgacagcgacagtgactcggattcggacagt	Protospacer
 **.  ***.******** ***********.

135. spacer 1.20|923722|31|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

agactctgatagtgattcggactcggacagc	CRISPR spacer
ggatgctgacagtgattcggactcggactct	Protospacer
.**. ****.******************  .

136. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.811

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgacagtgactctgacagcgattcggactccgacagt	Protospacer
***.   ***** *****************.*****.

137. spacer 1.22|923854|37|NZ_CP025590|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.811

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
cgacagtgactcggacagcgactccgactctgacagt	Protospacer
***.   **************.** ***********.

138. spacer 1.14|923296|31|NZ_CP025590|CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 8, identity: 0.742

cgattccgacagtgattcggactcggacagc	CRISPR spacer
gtattccggcagtgattcagactcggtagga	Protospacer
  ******.*********.*******  .*

139. spacer 1.17|923530|31|NZ_CP025590|CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 8, identity: 0.742

cgattcggacagtgattcagactcggatagc	CRISPR spacer
gtattccggcagtgattcagactcggtagga	Protospacer
  **** *.*****************  .*

140. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
agacagcgactccgacagcgattcggattctgacagt	Protospacer
 **.   ***** **************.********.

141. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
agacagcgactccgacagcgattcggattctgacagt	Protospacer
 **.   ***** **************.********.

142. spacer 1.22|923854|37|NZ_CP025590|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

cgattcggactcggacagcgattcggactctgacagc	CRISPR spacer
agacagcgactccgacagcgattcggattctgacagt	Protospacer
 **.   ***** **************.********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30939 : 142518

107

Tupanvirus(18.18%)

tRNA,bacteriocin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044428951.1\|30939_31503_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_044428954.1\|31696_32365_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_027821520.1\|32522_34028_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|34292_34661_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|34773_35283_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|35313_36510_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|36619_37090_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|37108_37564_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|37667_38240_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|38405_39326_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015379753.1\|39462_40362_+	oxidoreductase	NA	NA	NA	NA
WP_053566421.1\|40801_42682_+	hypothetical protein	NA	NA	NA	NA
WP_011679766.1\|42853_43300_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|43537_45064_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|45064_46036_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_053566422.1\|46113_47445_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|47910_49428_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|49442_51272_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643775.1\|51286_52009_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_053566424.1\|52591_56287_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_095587192.1\|57839_58256_+	EndoU domain-containing protein	NA	NA	NA	NA
WP_053566425.1\|58295_58610_+	hypothetical protein	NA	NA	NA	NA
WP_080373188.1\|58671_58824_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_053566426.1\|58834_59242_+	immunity 63 family protein	NA	NA	NA	NA
WP_080373231.1\|59742_60081_+	hypothetical protein	NA	NA	NA	NA
WP_011100991.1\|60420_60699_+	hypothetical protein	NA	NA	NA	NA
WP_063733875.1\|60995_61913_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|61919_62093_+	hypothetical protein	NA	NA	NA	NA
WP_016511577.1\|62637_63180_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011100988.1\|63194_63458_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|63574_63778_+	hypothetical protein	NA	NA	NA	NA
WP_063204024.1\|63902_64142_+	hypothetical protein	NA	NA	NA	NA
WP_047672646.1\|64159_64546_+	hypothetical protein	NA	NA	NA	NA
WP_072534813.1\|64995_65187_+	hypothetical protein	NA	NA	NA	NA
WP_057136835.1\|65578_65824_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|66398_66818_+	hypothetical protein	NA	NA	NA	NA
WP_102124376.1\|67086_67572_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|67907_68525_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_102124377.1\|68528_69683_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|69686_70478_-	HAD family hydrolase	NA	NA	NA	NA
WP_102124378.1\|70548_71421_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|71580_72396_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_063486820.1\|72921_74298_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|74342_75527_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|75911_76115_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|76526_77195_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|77191_77365_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|77395_77563_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|78424_78625_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|78752_78920_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641977.1\|80266_81013_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|81890_82037_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_021356664.1\|82227_83556_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_063486822.1\|83556_84300_+	response regulator transcription factor	NA	NA	NA	NA
WP_063204018.1\|84418_85162_+	response regulator transcription factor	NA	NA	NA	NA
WP_015825123.1\|85467_86241_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|86339_86498_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|86522_86693_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_063204064.1\|86959_89110_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_057136851.1\|89125_90502_+	HlyD family secretion protein	NA	NA	NA	NA
WP_063733768.1\|90591_91281_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063204066.1\|91348_92017_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_102124379.1\|92103_92784_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821496.1\|93691_93895_+	hypothetical protein	NA	NA	NA	NA
WP_063204067.1\|93989_96299_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_021356643.1\|96557_97334_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|97773_98790_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|99197_99908_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|99980_101342_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|101348_101537_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|101526_101949_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|102171_103527_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|103544_104981_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|105101_105998_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|106147_106894_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_063204068.1\|107006_108020_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_047672680.1\|108474_109608_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|109612_110407_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|110575_111493_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|111538_112813_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|112805_113765_+	hypothetical protein	NA	NA	NA	NA
WP_003646490.1\|113786_114491_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|114490_115333_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_015825136.1\|115936_116326_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|116647_118699_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003642016.1\|118931_120116_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003642017.1\|120238_121015_+	TatD family hydrolase	NA	NA	NA	NA
WP_063204069.1\|121001_121565_+	ribonuclease M5	NA	NA	NA	NA
WP_003642019.1\|121561_122452_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003642020.1\|122556_122808_+	Veg family protein	NA	NA	NA	NA
WP_003643828.1\|122940_123807_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642022.1\|124116_125061_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642023.1\|125328_126027_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003646500.1\|126019_126817_+	metal ABC transporter permease	NA	NA	NA	NA
WP_003642030.1\|127172_128009_+	pur operon repressor	NA	NA	NA	NA
WP_063204070.1\|128077_129460_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_063204071.1\|129695_130520_+	serine hydrolase	NA	NA	NA	NA
WP_003643830.1\|130885_131866_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003646506.1\|132148_133171_+	YdcF family protein	NA	NA	NA	NA
WP_003643831.1\|133253_134240_+	lipoprotein	NA	NA	NA	NA
WP_003646508.1\|134409_135219_-	sugar-phosphatase	NA	NA	NA	NA
WP_169484456.1\|135238_136597_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003643833.1\|136605_137538_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642040.1\|137900_138341_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003642041.1\|138385_138994_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642042.1\|139166_140780_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003646511.1\|141246_142518_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7

DBSCAN-SWA_2

154113 : 224816

unidentified_phage(10.53%)

tRNA,transposase,integrase,protease

attL 211133:211157|attR 226218:226242

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063486830.1\|154113_155013_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_003642056.1\|155073_155862_+	hypothetical protein	NA	NA	NA	NA
WP_063486834.1\|156083_157472_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_003642058.1\|157726_159313_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-73	40.4
WP_013355194.1\|159484_160747_-\|transposase	ISL3-like element ISP1 family transposase	NA	NA	NA	NA
WP_003642061.1\|161866_162229_+	holo-ACP synthase	NA	NA	NA	NA
WP_003642062.1\|162228_163356_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.5e-29	28.6
WP_027821484.1\|163764_164157_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	5.7e-10	36.0
WP_060684291.1\|164448_166431_+	KUP/HAK/KT family potassium transporter	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.1e-68	35.8
WP_063733776.1\|166537_169600_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_011101043.1\|169592_170660_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_021357494.1\|170928_171954_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_072535965.1\|171984_173193_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_003642071.1\|173208_173955_+	acetylglutamate kinase	NA	NA	NA	NA
WP_003642072.1\|173951_175121_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.9e-17	26.6
WP_021356429.1\|175113_176136_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003642074.1\|176244_176751_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	2.9e-06	32.1
WP_102124382.1\|176950_178576_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003643849.1\|180261_180900_-	CBS domain-containing protein	NA	NA	NA	NA
WP_022638510.1\|181054_182449_-	peptidoglycan binding domain-containing protein	NA	NA	NA	NA
WP_102124383.1\|182761_184423_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.4e-92	41.3
WP_003642078.1\|184436_185399_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_021356688.1\|185730_186288_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_063204265.1\|186307_189835_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_013355210.1\|190009_191614_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_003642082.1\|191610_191898_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_003642083.1\|192018_192417_+	septum formation initiator family protein	NA	NA	NA	NA
WP_003642084.1\|192541_193081_+	RNA-binding protein S1	NA	NA	NA	NA
WP_003642085.1\|193364_194711_+\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	2.6e-09	23.8
WP_003642086.1\|194730_195273_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.5e-08	26.0
WP_003643854.1\|195352_197590_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	6.0e-104	47.8
WP_063204266.1\|197738_198626_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003642089.1\|198625_199633_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_072533499.1\|199736_201236_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.3e-89	37.5
WP_044429853.1\|201449_201914_+\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	8.8e-18	37.2
WP_063487734.1\|208547_210020_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.7e-68	34.3
WP_072540382.1\|210074_210917_+	metallophosphoesterase	NA	NA	NA	NA
211133:211157	attL	NA	NA	NA	NA
WP_050340432.1\|211309_212473_-\|integrase	site-specific integrase	S5MBZ0	Brevibacillus_phage	4.0e-43	31.7
WP_046947797.1\|212504_212921_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_046947796.1\|213043_213238_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_046947795.1\|213250_213937_+	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	9.1e-11	30.9
WP_046040869.1\|213963_214257_+	hypothetical protein	NA	NA	NA	NA
WP_046947794.1\|214569_214992_+	hypothetical protein	NA	NA	NA	NA
WP_046947793.1\|214984_215206_+	hypothetical protein	NA	NA	NA	NA
WP_046947792.1\|215218_215998_+	bifunctional DNA primase/polymerase	A0A060ADS5	Enterococcus_phage	1.3e-21	31.3
WP_046947791.1\|216009_217428_+	virulence protein	A0A0A7RTG3	Clostridium_phage	1.2e-73	36.1
WP_050340426.1\|218038_218413_+	hypothetical protein	NA	NA	NA	NA
WP_046040767.1\|218414_218828_+	hypothetical protein	NA	NA	NA	NA
WP_027822219.1\|219870_220197_+	hypothetical protein	NA	NA	NA	NA
WP_004271307.1\|220675_221599_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015474755.1\|221806_223405_-	APC family permease	NA	NA	NA	NA
WP_050339279.1\|223772_224816_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.5e-33	34.3
226218:226242	attR	NA	NA	NA	NA

DBSCAN-SWA_3

266734 : 360792

104

Lactobacillus_phage(27.45%)

capsid,portal,terminase,integrase,tRNA,holin,protease,tail,head

attL 262654:262669|attR 312775:312790

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
262654:262669	attL	NA	NA	NA	NA
WP_003640924.1\|266734_267427_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003643927.1\|267616_268948_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_003640926.1\|269023_269707_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003640927.1\|269715_270012_-	N-acetyltransferase	NA	NA	NA	NA
WP_003640928.1\|270150_270687_+	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.8
WP_003643928.1\|271723_273103_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003640931.1\|273118_274294_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|274619_276110_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_024521299.1\|276387_277800_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	8.9e-45	29.8
WP_003640934.1\|277801_278212_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003640935.1\|278183_278969_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003644974.1\|278970_279519_+	NYN domain-containing protein	NA	NA	NA	NA
WP_063204088.1\|280025_280628_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|280689_280839_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|280850_281036_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|281140_281689_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640941.1\|281716_282604_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003640942.1\|282705_283131_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|283231_283921_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|284119_284623_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|284684_285053_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_102124386.1\|285204_286407_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	1.2e-37	29.5
WP_003642778.1\|286615_286792_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_063721905.1\|287078_287642_-	hypothetical protein	NA	NA	NA	NA
WP_063721904.1\|287668_288748_-	hypothetical protein	NA	NA	NA	NA
WP_102124387.1\|289229_289565_-	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	3.7e-26	53.9
WP_102124388.1\|289672_289927_-	hypothetical protein	NA	NA	NA	NA
WP_102124389.1\|289936_290728_-	hypothetical protein	NA	NA	NA	NA
WP_003644968.1\|290750_291164_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_011101778.1\|291175_291538_-	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_063964081.1\|291666_291894_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_158649082.1\|292015_292186_-	hypothetical protein	NA	NA	NA	NA
WP_102124390.1\|292244_292493_+	hypothetical protein	NA	NA	NA	NA
WP_102124391.1\|292522_292726_-	hypothetical protein	NA	NA	NA	NA
WP_063722756.1\|292803_292986_+	hypothetical protein	NA	NA	NA	NA
WP_102124392.1\|293046_293601_+	hypothetical protein	O03909	Lactobacillus_phage	6.3e-95	96.7
WP_102124393.1\|293606_293894_+	DNA-binding protein	NA	NA	NA	NA
WP_164971152.1\|294003_294150_+	hypothetical protein	E9LUT9	Lactobacillus_phage	3.4e-16	89.4
WP_102124395.1\|294403_294790_+	hypothetical protein	NA	NA	NA	NA
WP_102124396.1\|294786_295674_+	recombinase RecT	E9LUM3	Lactobacillus_phage	5.4e-64	53.3
WP_187345425.1\|295705_296458_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	2.6e-75	53.0
WP_102124398.1\|297352_298195_+	ATP-binding protein	O03914	Lactobacillus_phage	1.1e-151	96.1
WP_102124399.1\|298351_298870_+	hypothetical protein	O03915	Lactobacillus_phage	4.6e-39	54.2
WP_011101765.1\|298866_299247_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_003642805.1\|299457_299919_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_154104195.1\|300290_300437_+	hypothetical protein	NA	NA	NA	NA
WP_102124400.1\|300449_300719_-	DUF3892 domain-containing protein	A0A059NT53	Lactococcus_phage	7.2e-12	62.7
WP_015380624.1\|301088_301286_+	hypothetical protein	NA	NA	NA	NA
WP_033607691.1\|301413_301683_+	DUF2829 domain-containing protein	A0A0K2FLC4	Brevibacillus_phage	2.7e-11	43.2
WP_102124401.1\|301723_302605_+\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	4.8e-57	50.7
WP_063488225.1\|302594_303833_+\|terminase	PBSX family phage terminase large subunit	X2CYF4	Lactobacillus_phage	1.0e-137	57.4
WP_102124402.1\|303844_305353_+\|portal	phage portal protein	V5US18	Oenococcus_phage	3.4e-135	51.2
WP_003642812.1\|305282_305579_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	6.7e-11	40.2
WP_102124403.1\|307123_307801_+	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	3.0e-14	31.2
WP_102124404.1\|307815_308166_+	hypothetical protein	V5UTH9	Oenococcus_phage	3.4e-30	62.9
WP_003642819.1\|308185_309208_+\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_003642820.1\|309220_309397_+	hypothetical protein	NA	NA	NA	NA
WP_013355731.1\|309408_309741_+\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_102124405.1\|309740_310088_+	hypothetical protein	V5US85	Oenococcus_phage	2.0e-35	61.4
WP_044431353.1\|310089_310641_+	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	8.8e-65	62.3
WP_013355729.1\|310640_311006_+	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_099447638.1\|311107_311491_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_033608825.1\|311590_311989_+	hypothetical protein	V9QJA0	Oenococcus_phage	6.6e-46	74.0
WP_102124607.1\|312096_312360_+	hypothetical protein	V9QKH3	Oenococcus_phage	1.4e-23	65.4
WP_102124406.1\|312375_318207_+\|tail	phage tail protein	V5URV5	Oenococcus_phage	3.0e-227	40.9
312775:312790	attR	NA	NA	NA	NA
WP_099739626.1\|318250_318583_+	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_102124407.1\|318597_322848_+	hypothetical protein	Q6SE68	Lactobacillus_prophage	1.3e-144	59.4
WP_003642831.1\|322854_323304_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.1e-24	40.5
WP_003642832.1\|323306_323741_+	hypothetical protein	NA	NA	NA	NA
WP_050431034.1\|323919_325035_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.3e-32	77.4
WP_102124408.1\|325035_325332_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.4e-37	75.5
WP_102124409.1\|325318_325690_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	4.9e-27	84.6
WP_052470491.1\|325976_327500_+	AAA family ATPase	NA	NA	NA	NA
WP_027821466.1\|328282_329260_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_027821465.1\|329272_329941_-	hypothetical protein	NA	NA	NA	NA
WP_003640948.1\|330244_332848_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_003640949.1\|333022_333598_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.4e-26	41.7
WP_003640950.1\|333679_334690_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003643938.1\|334717_336883_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.7e-269	63.5
WP_003640952.1\|337021_337252_-	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_044429285.1\|337474_338083_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003640954.1\|338085_338592_+	nucleoside deaminase	NA	NA	NA	NA
WP_003643940.1\|339117_340815_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|340836_341145_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|341160_341760_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|341774_342026_+	YaaL family protein	NA	NA	NA	NA
WP_016510978.1\|342411_343077_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|343073_343403_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|343419_344439_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|344463_344811_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_044429290.1\|344909_345806_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.5e-82	55.7
WP_003640969.1\|345809_346595_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|346733_347729_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640973.1\|349806_350661_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003640974.1\|350657_351461_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003640975.1\|351450_352221_-	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
WP_003640976.1\|352258_353311_-	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_003640977.1\|353590_354316_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_011101142.1\|354299_354878_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640979.1\|354870_355326_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_072534972.1\|355330_356377_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.0e-61	41.4
WP_003643947.1\|357154_359137_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.0e-50	28.7
WP_003640983.1\|359305_359983_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003640984.1\|360147_360792_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1017135 : 1029913

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355467.1\|1017135_1018374_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7
WP_013355468.1\|1018464_1019436_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
WP_003643099.1\|1019621_1020569_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1020911_1021526_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_022638021.1\|1021528_1023967_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_013355469.1\|1024054_1024615_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
WP_013355470.1\|1024685_1025126_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
WP_022638019.1\|1025516_1026884_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
WP_021356352.1\|1026876_1027569_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_013355473.1\|1028278_1028944_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_013355474.1\|1028968_1029913_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	2.0e-72	45.5

DBSCAN-SWA_5

1513766 : 1599089

Lactobacillus_phage(74.47%)

capsid,portal,terminase,integrase,tRNA,holin,protease,tail,head,transposase

attL 1539348:1539365|attR 1605950:1605967

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533795.1\|1513766_1514690_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003640717.1\|1515174_1515696_-	shikimate kinase	NA	NA	NA	NA
WP_003645966.1\|1515698_1516796_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_063733656.1\|1516798_1518097_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003644492.1\|1518110_1518638_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_063730294.1\|1518646_1519816_-	chorismate synthase	NA	NA	NA	NA
WP_061871736.1\|1519808_1521263_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1521911_1522265_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_022637968.1\|1522287_1524864_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1524878_1525184_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1525173_1525473_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1525517_1526735_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_102124469.1\|1526755_1527232_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1527527_1531841_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1532334_1534044_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1534083_1535361_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1535398_1536184_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1536199_1536979_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1537098_1537662_-	ribosome recycling factor	NA	NA	NA	NA
WP_003644498.1\|1538585_1539464_-	elongation factor Ts	NA	NA	NA	NA
1539348:1539365	attL	NA	NA	NA	NA
WP_044430935.1\|1539566_1540370_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1540594_1541317_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1541605_1542604_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1542688_1542994_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1542977_1543736_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1543847_1544483_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1544539_1544776_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1544873_1545113_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1545264_1545897_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_157262971.1\|1545985_1546078_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003644502.1\|1546451_1547081_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1547130_1548300_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1548335_1548728_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1548891_1549284_+	hypothetical protein	NA	NA	NA	NA
WP_003644504.1\|1549728_1550670_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_044430944.1\|1551420_1551993_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080333756.1\|1552144_1553329_-	LCP family protein	NA	NA	NA	NA
WP_044430948.1\|1553309_1554101_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-31	37.3
WP_046810958.1\|1554119_1555862_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_044430952.1\|1556339_1557551_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_072557939.1\|1558787_1559318_-\|holin	holin	E9LUS0	Lactobacillus_phage	2.5e-40	98.9
WP_003644510.1\|1559330_1559594_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_072557940.1\|1559593_1560766_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.5e-215	99.7
WP_063487082.1\|1560781_1561666_-	hypothetical protein	E9LUR7	Lactobacillus_phage	1.7e-139	99.7
WP_016058341.1\|1561649_1561811_-	hypothetical protein	E9LUR6	Lactobacillus_phage	1.2e-19	100.0
WP_016058340.1\|1561814_1562069_-	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
WP_072557941.1\|1562061_1564869_-\|tail	phage tail protein	E9LUR4	Lactobacillus_phage	1.0e-311	87.8
WP_072557942.1\|1564886_1567256_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	99.9
WP_102124470.1\|1567325_1569098_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	98.5
WP_102124471.1\|1569170_1574393_-\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	77.8
WP_016058335.1\|1574405_1574597_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_046947715.1\|1574593_1574977_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	1.3e-62	98.4
WP_016058333.1\|1575178_1575817_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	8.8e-117	100.0
WP_046947716.1\|1575817_1576201_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	6.1e-65	97.6
WP_046947717.1\|1576197_1576638_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	1.2e-77	97.9
WP_046947718.1\|1576627_1576990_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	2.9e-64	96.7
WP_046947719.1\|1576973_1577312_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	2.0e-51	91.1
WP_052751295.1\|1577384_1578626_-\|capsid	phage major capsid protein	A0A286QSM8	Streptococcus_phage	4.4e-72	42.4
WP_102124472.1\|1578645_1579347_-\|protease	Clp protease ClpP	Q9T1F7	Lactobacillus_phage	4.1e-51	47.7
WP_046947721.1\|1579327_1580524_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	5.3e-131	61.1
WP_046947722.1\|1580523_1580724_-	DUF1056 family protein	NA	NA	NA	NA
WP_046947723.1\|1580710_1582600_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	93.1
WP_046947724.1\|1582602_1583061_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	2.0e-78	96.0
WP_102124473.1\|1583279_1583750_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	4.7e-83	93.6
WP_013355638.1\|1583760_1583931_-	hypothetical protein	E9LUP6	Lactobacillus_phage	3.3e-23	96.4
WP_063488409.1\|1583942_1584176_-	hypothetical protein	NA	NA	NA	NA
WP_102124474.1\|1584244_1585126_-	hypothetical protein	NA	NA	NA	NA
WP_016058320.1\|1585421_1585853_-	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	1.9e-78	100.0
WP_102124475.1\|1585833_1586004_-	hypothetical protein	E9LUP4	Lactobacillus_phage	1.3e-19	92.9
WP_072540025.1\|1586121_1586319_-	hypothetical protein	NA	NA	NA	NA
WP_072540026.1\|1586391_1586820_-	hypothetical protein	Q5ULU9	Lactobacillus_virus	2.6e-40	56.8
WP_158649083.1\|1586849_1587017_-	hypothetical protein	NA	NA	NA	NA
WP_022638754.1\|1587019_1587178_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_102124476.1\|1587170_1587479_-	hypothetical protein	E9LUN7	Lactobacillus_phage	4.9e-49	96.1
WP_102124477.1\|1587614_1588400_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.2e-133	91.6
WP_102124478.1\|1588399_1589116_-	helix-turn-helix domain-containing protein	A0A0P0I7Q1	Lactobacillus_phage	6.1e-34	39.3
WP_102124479.1\|1589157_1589850_-	hypothetical protein	E9LUU3	Lactobacillus_phage	2.1e-108	82.6
WP_102124480.1\|1589869_1590175_-	hypothetical protein	NA	NA	NA	NA
WP_164883040.1\|1590175_1590346_-	hypothetical protein	NA	NA	NA	NA
WP_027821290.1\|1590388_1590619_-	hypothetical protein	E9LUT8	Lactobacillus_phage	3.2e-29	87.7
WP_102124481.1\|1590630_1590831_-	hypothetical protein	E9LUT7	Lactobacillus_phage	2.9e-26	87.9
WP_063722546.1\|1590833_1591088_-	hypothetical protein	NA	NA	NA	NA
WP_003641367.1\|1591230_1591491_-	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|1591548_1591875_+	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_102124482.1\|1591990_1592200_-	hypothetical protein	NA	NA	NA	NA
WP_164883041.1\|1592211_1592919_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.5e-64	59.5
WP_057138664.1\|1592934_1593183_-	transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
WP_057138663.1\|1593351_1594026_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	8.0e-52	44.6
WP_053267125.1\|1594155_1595031_+	hypothetical protein	NA	NA	NA	NA
WP_053338954.1\|1596215_1596524_-	hypothetical protein	NA	NA	NA	NA
WP_102124485.1\|1596630_1597406_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_053338955.1\|1597925_1599089_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
1605950:1605967	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1903274 : 1947214

Lactobacillus_phage(48.65%)

capsid,portal,terminase,lysis,integrase,tail,head

attL 1911431:1911446|attR 1947081:1947096

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642761.1\|1903274_1905269_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003646619.1\|1905673_1905865_-	hypothetical protein	NA	NA	NA	NA
WP_158649084.1\|1906647_1907562_+	glycosyl transferase	NA	NA	NA	NA
WP_102124495.1\|1907707_1908778_-	LysM peptidoglycan-binding domain-containing protein	A0A2P0ZLG2	Lactobacillus_phage	2.4e-114	90.7
WP_089178211.1\|1908777_1909068_-\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	4.8e-22	59.4
WP_089178210.1\|1909064_1909265_-	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	8.2e-21	88.9
WP_058906830.1\|1909267_1909651_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	2.3e-64	92.9
1911431:1911446	attL	NA	NA	NA	NA
WP_102124496.1\|1911662_1913876_-\|tail	phage tail protein	Q597U4	Lactobacillus_virus	0.0e+00	77.4
WP_102124497.1\|1913890_1915150_-\|tail	phage tail family protein	A0A2P0ZL23	Lactobacillus_phage	8.9e-121	52.0
WP_102124498.1\|1915162_1918603_-\|tail	phage tail tape measure protein	A0A2P0ZL32	Lactobacillus_phage	8.6e-17	53.6
WP_158649085.1\|1918606_1918858_-	hypothetical protein	A0A2P0ZL20	Lactobacillus_phage	4.8e-10	45.0
WP_058906825.1\|1918923_1919337_-	hypothetical protein	A0A2K9VBY8	Lactobacillus_phage	6.2e-39	59.9
WP_102124500.1\|1919357_1920146_-\|tail	phage major tail protein, TP901-1 family	Q597U9	Lactobacillus_virus	2.3e-98	92.1
WP_102124501.1\|1920165_1920519_-	hypothetical protein	K4I072	Lactobacillus_virus	3.9e-42	72.6
WP_058906822.1\|1920518_1920893_-	HK97 gp10 family phage protein	G8FUY4	Pediococcus_virus	4.0e-37	62.9
WP_102124502.1\|1920885_1921164_-	hypothetical protein	G8FUY5	Pediococcus_virus	1.1e-31	73.9
WP_058906820.1\|1921160_1921499_-\|head,tail	phage head-tail connector protein	K4I470	Lactobacillus_virus	3.3e-46	78.6
WP_102124610.1\|1921558_1921813_-	Ig-like domain-containing protein	G8FUY7	Pediococcus_virus	1.3e-15	63.5
WP_102124503.1\|1921833_1922694_-\|capsid	phage capsid protein	K4I067	Lactobacillus_virus	3.0e-144	90.9
WP_102124504.1\|1922713_1923304_-	DUF4355 domain-containing protein	Q597V6	Lactobacillus_virus	4.1e-20	45.3
WP_102124505.1\|1923462_1924269_-\|capsid	minor capsid protein	G8FUZ0	Pediococcus_virus	1.9e-100	66.4
WP_102124611.1\|1924186_1925725_-\|portal	phage portal protein	G8FUZ1	Pediococcus_virus	7.6e-191	66.2
WP_102124506.1\|1925751_1927041_-\|terminase	PBSX family phage terminase large subunit	G8FUZ2	Pediococcus_virus	4.1e-206	79.9
WP_102124507.1\|1927650_1928061_-	DUF2829 domain-containing protein	A0A0S2MVC6	Bacillus_phage	1.5e-16	48.2
WP_102124508.1\|1928100_1928856_-	hypothetical protein	NA	NA	NA	NA
WP_102124509.1\|1928931_1929549_-	DUF4145 domain-containing protein	Q20DE2	Lactobacillus_phage	2.3e-53	49.0
WP_102124510.1\|1930266_1930725_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	56.3
WP_102124511.1\|1931106_1931520_-	DUF1642 domain-containing protein	A0A2K9V535	Lactobacillus_phage	2.1e-47	66.4
WP_102124512.1\|1931530_1931782_-	hypothetical protein	NA	NA	NA	NA
WP_102124513.1\|1931924_1932305_-	hypothetical protein	NA	NA	NA	NA
WP_102124514.1\|1932301_1932820_-	hypothetical protein	O03915	Lactobacillus_phage	2.3e-51	65.8
WP_102124515.1\|1932824_1933547_-	phage antirepressor KilAC domain-containing protein	Q8SDM9	Staphylococcus_phage	2.1e-50	45.6
WP_102124516.1\|1933561_1933831_-	hypothetical protein	NA	NA	NA	NA
WP_102124517.1\|1933827_1934736_-	DnaD domain protein	NA	NA	NA	NA
WP_187345427.1\|1934816_1935569_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	2.4e-73	53.0
WP_102124519.1\|1935600_1936488_-	recombinase RecT	E9LUM3	Lactobacillus_phage	7.8e-63	47.7
WP_102124520.1\|1936484_1936871_-	hypothetical protein	NA	NA	NA	NA
WP_015380632.1\|1937003_1937141_-	hypothetical protein	NA	NA	NA	NA
WP_056988483.1\|1937231_1937477_-	hypothetical protein	NA	NA	NA	NA
WP_024623923.1\|1937489_1938005_-	hypothetical protein	D6PST4	Lactobacillus_phage	1.7e-25	38.6
WP_011101083.1\|1938251_1938482_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101082.1\|1938654_1939017_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_102124521.1\|1939028_1939442_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_102124522.1\|1939467_1940814_+	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	5.1e-82	52.7
WP_089178289.1\|1940863_1941424_+	DUF5067 domain-containing protein	Q6SEF8	Lactobacillus_prophage	4.6e-45	65.9
WP_102124523.1\|1941478_1941814_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	2.4e-25	52.2
WP_102124524.1\|1941986_1943255_+\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	1.1e-89	42.2
WP_063722960.1\|1943367_1944720_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_003642758.1\|1944940_1945798_-	GRP family sugar transporter	NA	NA	NA	NA
WP_011101808.1\|1946032_1947214_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-46	29.9
1947081:1947096	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2130303 : 2138814

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2130303_2130882_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_024002687.1\|2130874_2131900_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.2e-60	40.7
WP_102124536.1\|2131896_2133351_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-49	33.8
WP_003645864.1\|2133335_2135555_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2135547_2136228_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2136227_2136482_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2136483_2137215_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642586.1\|2137217_2138348_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2138331_2138814_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_8

2609064 : 2618115

Streptococcus_phage(14.29%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046811086.1\|2609064_2610177_-	glycerate kinase	W6LM47	Streptococcus_phage	3.0e-35	35.3
WP_044432279.1\|2610312_2611647_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-26	26.9
WP_063204300.1\|2611841_2612171_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003642490.1\|2612392_2613691_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_003643473.1\|2614007_2615297_+	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_024272289.1\|2615345_2616317_+	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.4e-137	71.2
WP_044429853.1\|2616457_2616922_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	8.8e-18	37.2
WP_063204301.1\|2617173_2618115_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.3e-19	30.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection