CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	1 crisprs	DEDDh,cas14j	0	2	4	0
NZ_CP025754	Enterococcus faecium strain AALTL chromosome, complete genome	3 crisprs	DEDDh,RT,cas3,cas14j,csa3,DinG	3	4	13	2
NZ_CP025755	Enterococcus faecium strain AALTL plasmid pEFA-790c, complete sequence	0 crisprs	csa3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025756_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025756_1

126911-127038

TypeV

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP025756_1

>merge|NZ_CP025756|1|126911-127038|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP025756|1|1|126911-127038|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025756.1\|WP_002303312.1\|138489_139389_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP025756.1\|WP_002290394.1\|121728_122046_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP025756.1\|WP_002295674.1\|129296_129638_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP025756.1\|WP_002303208.1\|122046_122301_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274230
NZ_CP025756.1\|WP_002287522.1\|122659_123064_+\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP025756.1\|WP_002347152.1\|133967_135428_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379044
NZ_CP025756.1\|WP_002339140.1\|117085_118018_-\|FAD:protein-FMN-transferase	unknown	unknown	gnl\|CDD\|224394
NZ_CP025756.1\|WP_076065465.1\|120572_121259_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP025756.1\|WP_002321302.1\|139391_139865_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915
NZ_CP025756.1\|WP_002348857.1\|124935_125130_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025756.1\|WP_002305801.1\|131534_133907_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025756.1\|WP_002321303.1\|140230_140491_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025756.1\|WP_002297404.1\|129874_131125_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP025756.1\|WP_085910366.1\|119446_120133_-\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP025756.1\|WP_002323589.1\|123080_124229_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP025756.1\|WP_002303311.1\|137883_138477_+\|abortive-infection-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP025756.1\|WP_002305772.1\|135438_137643_+\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP025756.1\|WP_002296843.1\|120239_120428_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025756.1\|WP_002323647.1\|128345_128678_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025756.1\|WP_002339139.1\|118442_119300_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NZ_CP025756.1\|WP_002303312.1\|138489_139389_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	8.76192e-35
NZ_CP025756.1\|WP_002290394.1\|121728_122046_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP025756.1\|WP_002303208.1\|122046_122301_-\|hypothetical-protein	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	3.2545e-07
NZ_CP025756.1\|WP_002287522.1\|122659_123064_+\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48
NZ_CP025756.1\|WP_002347152.1\|133967_135428_+\|hypothetical-protein	gnl\|CDD\|379044	pfam13155, Toprim_2, Toprim-like. This is a family or Toprim-like proteins.	0.000530207
NZ_CP025756.1\|WP_002339140.1\|117085_118018_-\|FAD:protein-FMN-transferase	gnl\|CDD\|224394	COG1477, ApbE, Membrane-associated lipoprotein involved in thiamine biosynthesis [Coenzyme metabolism].	9.49484e-90
NZ_CP025756.1\|WP_002295674.1\|129296_129638_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48
NZ_CP025756.1\|WP_002321302.1\|139391_139865_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	1.38283e-70
NZ_CP025756.1\|WP_076065465.1\|120572_121259_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.04699e-90
NZ_CP025756.1\|WP_085910366.1\|119446_120133_-\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.99528e-92
NZ_CP025756.1\|WP_002323589.1\|123080_124229_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.71026e-54
NZ_CP025756.1\|WP_002303311.1\|137883_138477_+\|abortive-infection-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	1.00819e-09
NZ_CP025756.1\|WP_002305772.1\|135438_137643_+\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP025756.1\|WP_002297404.1\|129874_131125_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.21771e-29
NZ_CP025756.1\|WP_002339139.1\|118442_119300_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	6.91606e-09

>NZ_CP025756.1|WP_002348857.1|124935_125130_-|hypothetical-protein
MMGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSPCQIRPG
>NZ_CP025756.1|WP_002323589.1|123080_124229_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTIALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP025756.1|WP_002287522.1|122659_123064_+|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP025756.1|WP_002303208.1|122046_122301_-|hypothetical-protein
MGKELKVRKIGNSVGVILPSSLGLKSGDIIQAKQEDNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP025756.1|WP_002290394.1|121728_122046_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP025756.1|WP_076065465.1|120572_121259_-|IS6-family-transposase
MTMNHFKGKQFQQDVIIVAVDYYLRYNLSYREVQEILYDRGINVSHATIYRWVQEYSKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP025756.1|WP_002296843.1|120239_120428_-|hypothetical-protein
MLKKTMLVLGSISLGVLGFSPMLLSVIGKNNSKGELKLNPNYYNSPNEPMFISEKQNDGQDK
>NZ_CP025756.1|WP_085910366.1|119446_120133_-|IS6-like-element-IS1216-family-transposase
MTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHATIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP025756.1|WP_002339139.1|118442_119300_-|helix-turn-helix-transcriptional-regulator
MNIEKFITARKAANLSQKEVSEGICTQATLSKFENNGQVPSLKILIKLCNRINLPLVELFSSMNVINTQLDEQLEKAEFSLITSEYEQLTQILAAIDPKVIDESELIARYYYLKGFEMIFTNAPITDVLFHFDQLLMAETANTLFRLLAYTGIGMVYAREKELEKAEVYFNRVFEKIYTYPIRTTEDIWRVLNIVFHCGVFFAQDGDLETSDALLNYAIDICSDNHLTYYLARAAAQLAKNAQAKNKSKAEVLELIQDALAFAKINKNKKLIDELNHMKKNDTID
>NZ_CP025756.1|WP_002339140.1|117085_118018_-|FAD:protein-FMN-transferase
MNQVIEETKIWQMMGTTITLQVGHEEPSRLLAELGEWLHVYEHRFSAHDATSELMAINQAAGRQAVIVHPELFELIKLGKAHSCARNSYLNIAIGPVVQKWHIGFEDALVPTKAEITELLLLTDPHQIQLDEKMKTVFLTKPGMMIDLGALAKGYIADKLITHCRERNAAFALVNLGGNIVVFGESPRRSDGAWRIGLRNPKGSREESLAVVKLSNQSLVTSGIYERYLQNGSSVYHHIIDPKTGFPVKNDVASLTILSDSSVDGEIWTTRLFGASSLEVLKALEEQPGIEGAVVTKENQFLYTKGFEKI
>NZ_CP025756.1|WP_002323647.1|128345_128678_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP025756.1|WP_002295674.1|129296_129638_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP025756.1|WP_002297404.1|129874_131125_-|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNDSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP025756.1|WP_002305801.1|131534_133907_+|hypothetical-protein
MAEEKEPLDNSRLGKSKRKLVRLQNELNEQIEKMFEHQRKTNGQPMNDKRNGHSWFRQQERLENKVHSLREEIKQQEKQVEKLERQEELKEMGYNKYGGLDMTIENIPRIKEEIERFEKGESTFSAATIRKYQRKLETLEQLKERSEKGKENLLPEVQAIIDSGRVTQWKKNPTIYFLKDYRKVALELNENGGFEESKKYQATSEEEKAAVRELLEEAAPTDSLKEKENDHFYRVEFNENDPEKGLKSYGGEIVTLELIDQLKTLDNQYAAEAGYYKFYFEEVKNGEVVDQIRMDLGDGVNSNQPIYLELAKLCEQVPEKEQKQTVKNEPVSKEQMQSKETKTKQKGYQKRTAEEIKQEVKSLSQQALDAVKKHTHSPEDVKELLNFMSRFPERSFRNQLLIEEQFPGATACLGRAALKKEGIYIKKGEQGNKIFVRKTVKGFYEKGRGFVRETEATPEDKKRIESGQIEVIKKPYYTIEKVFDITQTQLKPEDYPKIFPNRVFDFQLDKKGQSELQAGIQAVANNIGIQIRDMTESEVYQRELGQARGAYVRNEFTGEEEIVMNTRNTPTQHLATSIHELAHARMHKFSELDTATKELQAEMTSYIVCKHFGMDTSEKAIPYIAAWTKNGQTLDDKEAAERGKIMNDVSRVANEFIQTISNEINQYREREPEIQPAEVKQEHKNTVETAENKNIVPVGSLWIDKKDGKVMEEDTGRTLHLKDAAFIEDPQHNQVILKGKSYGKEIQTALPSEEFALGNPFRFSLETVSEVAKRKNEIYYEQQLSQKERV
>NZ_CP025756.1|WP_002347152.1|133967_135428_+|hypothetical-protein
MTEKKMSLIDRCKQIDIVDFARNNGMAVVNKGRDYRLEDHDSFVFDRRKQRFYWNSQNISGDIIELAKLFFIDKEIQDSKQQFKAATDFILKNEDKTERVENLHFETEKYKDHPVDYQPLTEKGRNYLKEERKLPEWLIDYAEKEGLIAELKPKHERQNFLVRDDRLDHAVAFLWKDPQTNETVGASYQGTFIDYERFGERGTYKHIDKNSTANHGFNLKIGDPKQLKFFESSIDLLSYAALNRDQLNDTWLVSMEGLKHHVISHYFGEAVSELRKKQAFPQSIEICVDNDRAGHIFYEKEQLMGAVDPFTNQKVRCERGIANDWQVPKEYKVIYEEVAKEEKITPEAIMAIHKTENNLQLTNQLVSAHKVNASFGQQLSVNDSIEAINLKDICREVAKELKACERVDGTYDFDRFYQEKGDINAQILFSYKAEQYYKGYKNHEHEFVPEVKKDWNDQLKHEIYQQEIRKQKRAMLFQQGRQQERE
>NZ_CP025756.1|WP_002305772.1|135438_137643_+|type-IA-DNA-topoisomerase
MKTVILAEKPSQAKAYADSFSKATRKDGYFEIQDRLFSGETVITYGFGHLVELDSPDMYDENWKQWSLEHLPIFPTHYHYHVPKDKKKQFKVVKQQLQSADTIIIATDSDREGELIAWTIIQQAGADHGKIFKRLWINSLEKEAIYQGFQQLRDAEETYPKFEEAQARQIADWLIGMNGSPLYSLLLQQKGIPGSFSLGRVQTPTLYMIYQLQEKIRNFQKEPYFEGKAQVIAQNGAFDAKLDPNETQATQEAFEDYLKEKGVQLGKQPGTIHQVETEKKSAASPRLFSLSSLQSKMNQLMKASAKDTLEAMQGLYEGKYLSYPRTDTPYITEGEYAYLLDHLDEYKHFLKAEAIPTPIHTPNSRYVNNKKVQEHYAIIPTKTVMTAAAFEQLSPLQQAIYEQVLKTTVAMFAEKYTYEETTILTQVQQLQLKTVGKVPVDLGWKKLFGKESDRKEKEEEPLLPKVTKGEAVTVDLQVLEKETKPPQPYTEGTLITAMKTAGKTVDSEEAQSILKEVEGIGTEATRANIIETLKQKEYIKVEKNKLVVTNKGILLCQAVEKEPLLTSAEMTAKWESYLLKIGEQKGTQATFLANIQKFVSHLLEVVPGQIQSTDFGSTLQEVKAASEKQEATRHLGVCPKCREQEVLLYQNVAACTSEACDFKLWTTIAKKKLTATQLKEIIQNGRTSQSVRGLKGQKGSFEATIVLKEDFTTGFEFSEKKKTNYKKRTRRTTK
>NZ_CP025756.1|WP_002303311.1|137883_138477_+|abortive-infection-protein
MQDKLKELLAIRDGNLSMKEARKFGIAATTVQRLVNQGKLIKVDRGYYVEDGHGIDDLFWLQQRFSRGIFSHETTLDIYQLSTNMPKFIHLTFPHGYNVDRSITKEQQLQFHFVKKEVYELGKVEGTSFQGNPITMYDKERTLCDIWNPRYEFEYEMKLEALKEYMEDPLRDPSKLRDYMTKLHVEKEMKYHMQSLY
>NZ_CP025756.1|WP_002303312.1|138489_139389_+|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MTPTQFAAKTRNLAKSTGLNAQLVQRHFMMDRLIEQISESKYKNDFILKGGFLLGSKYGIDRRTTIDIDTTFRNSKLTEEKLKSIFNDLTRKPTKEGIVFSIQGMKETREADFYPGFQIKLVANLEKVRVPFKMDVTTGDSIYPEVDTHYHQLMFEDKKVEIPAYPTEQIIAEKLSATFSFGTDNSRAKDYYDLFTIPKLENIDTKELYKSVRNTFTKRGDTKPLSFYYEREMDKIRGNDYLEKQWEKYRSVNTFANSISFTDTVNEIDHLMKSVIKIENQERKRQFKRSQQMNQEMER
>NZ_CP025756.1|WP_002321302.1|139391_139865_+|single-stranded-DNA-binding-protein
MINNVTLVGRLTKDPDLRYTASGTAVATFTLAVNRNFANQNGNREADFINCVIWRKPAETMATLAKKGGLIGVVGRIQTRTYDNQQGQRVYVTEVVADNFQLLESKAATESRAHADQSTTSPSPTTFEQRDTNNGLDASQNPFGGQSIDISDDDLPF
>NZ_CP025756.1|WP_002321303.1|140230_140491_+|hypothetical-protein
MNKYVGLLDKIRVIKTQPLLVRFTLQTIHESINCVVADIEIIDKLLIMDDGKYNIAVTGHFNKRNQLVIASMYVRNPDQFTRLMGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.2\|126997\|19\|NZ_CP025756\|CRISPRCasFinder	126997-127015	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP025756_1	1.1\|126934\|40\|NZ_CP025756\|CRISPRCasFinder	126934-126973	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|126997|19|NZ_CP025756|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|126934|40|NZ_CP025756|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 63133

Streptococcus_phage(22.22%)

transposase,integrase

attL 28796:28810|attR 46623:46637

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099745857.1\|1474_2161_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.7e-127	99.1
WP_000195429.1\|2784_3957_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002303110.1\|5787_6825_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.1e-07	28.5
WP_002303111.1\|6821_7334_-\|transposase	transposase	NA	NA	NA	NA
WP_002304894.1\|7391_7658_-	hypothetical protein	NA	NA	NA	NA
WP_002303113.1\|8333_8885_-	DUF334 domain-containing protein	NA	NA	NA	NA
WP_002319817.1\|9429_10110_+\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_002304893.1\|10137_10701_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.2e-18	34.9
WP_000824191.1\|10745_10913_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|10946_11246_-	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|11286_11904_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_002304891.1\|12228_12624_-	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|12703_15055_-	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_000718009.1\|15179_15869_-	hypothetical protein	NA	NA	NA	NA
WP_000751236.1\|15882_16335_-	hypothetical protein	NA	NA	NA	NA
WP_002325565.1\|16465_17146_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-126	99.1
WP_002300494.1\|17247_18567_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|18563_19217_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002348630.1\|19926_20643_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_016922460.1\|20766_20952_-	hypothetical protein	NA	NA	NA	NA
WP_002302261.1\|22558_23590_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_002313180.1\|23596_24427_-	ABC transporter permease	NA	NA	NA	NA
WP_002302265.1\|24423_25230_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002302267.1\|25235_26060_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
WP_002347701.1\|26049_27150_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302270.1\|27327_28113_+	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002330694.1\|28145_28529_+	hypothetical protein	NA	NA	NA	NA
WP_077828694.1\|28604_28736_+	hypothetical protein	NA	NA	NA	NA
WP_002322470.1\|28704_28941_+	peptidylprolyl isomerase	NA	NA	NA	NA
28796:28810	attL	NA	NA	NA	NA
WP_002302275.1\|29018_29990_-	radical SAM protein	NA	NA	NA	NA
WP_002340465.1\|30641_32264_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	2.7e-122	47.5
WP_002301195.1\|32549_33926_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|33925_34582_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|34591_35869_-	ABC transporter permease	NA	NA	NA	NA
WP_087121905.1\|36118_37280_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002330699.1\|37310_37760_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_010706480.1\|37915_38266_-	hypothetical protein	NA	NA	NA	NA
WP_099745858.1\|38732_39894_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-79	53.8
WP_002349250.1\|40519_41044_-	hypothetical protein	NA	NA	NA	NA
WP_002326839.1\|41068_41977_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002301108.1\|42652_43207_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002316137.1\|46326_47499_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.1e-133	98.4
46623:46637	attR	NA	NA	NA	NA
WP_002303163.1\|48778_49642_-	triphosphoribosyl-dephospho-CoA synthase CitG	NA	NA	NA	NA
WP_002305953.1\|49634_50192_-	citrate lyase holo-[acyl-carrier protein] synthase	NA	NA	NA	NA
WP_002303161.1\|50188_51748_-	citrate lyase subunit alpha	NA	NA	NA	NA
WP_002303160.1\|51740_52646_-	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_002303159.1\|52650_52944_-	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_002303158.1\|52947_53961_-	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_002303157.1\|53986_55291_-	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_002303156.1\|55271_56459_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_002303155.1\|56646_57594_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002292681.1\|57890_58439_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|58439_59297_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002300557.1\|59582_59870_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292678.1\|59859_60189_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002305108.1\|60265_60538_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002303154.1\|60537_60801_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002303153.1\|60906_61323_-	hypothetical protein	NA	NA	NA	NA
WP_102642289.1\|61971_63133_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.5e-77	50.9

DBSCAN-SWA_2

75063 : 131125

Streptococcus_phage(26.32%)

transposase,integrase

attL 74412:74427|attR 83916:83931

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
74412:74427	attL	NA	NA	NA	NA
WP_002303240.1\|75063_75519_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_002303241.1\|76036_76987_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_008269238.1\|77525_77642_-	hypothetical protein	NA	NA	NA	NA
WP_002348634.1\|78990_80289_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_010782529.1\|80655_81564_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_010782535.1\|82026_83319_-	hypothetical protein	NA	NA	NA	NA
WP_002348758.1\|83293_85066_-	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	2.1e-19	36.1
83916:83931	attR	NA	NA	NA	NA
WP_002348764.1\|86702_87545_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002348763.1\|87681_89061_-	Xaa-Pro aminopeptidase	NA	NA	NA	NA
WP_025480881.1\|89210_89666_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.3e-34	53.5
WP_002348761.1\|89655_90321_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002348760.1\|90467_90911_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_010782532.1\|90959_91310_+	hypothetical protein	A0A096XT60	Enterococcus_phage	6.0e-19	43.8
WP_010782694.1\|91391_92345_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-33	35.1
WP_010782530.1\|92268_93441_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.5e-13	33.5
WP_002348804.1\|93470_94199_-	hypothetical protein	A0A1B0T6A2	Bacillus_phage	6.3e-10	26.5
WP_002292681.1\|94458_95007_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|95007_95865_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002313074.1\|96150_96438_-	hypothetical protein	NA	NA	NA	NA
WP_002292678.1\|96427_96757_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_016171159.1\|100020_100893_-	ROK family protein	NA	NA	NA	NA
WP_002322556.1\|100909_102382_-	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_002313079.1\|102395_103244_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002348858.1\|103240_104107_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002348859.1\|104149_105508_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016171162.1\|105602_106574_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-05	22.4
WP_002313084.1\|107608_108214_+	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	32.6
WP_002340501.1\|108259_108439_-	hypothetical protein	NA	NA	NA	NA
WP_016171164.1\|110046_110955_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002342383.1\|111013_112816_-	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_002342384.1\|112878_113721_-	hypothetical protein	NA	NA	NA	NA
WP_002331328.1\|113736_113958_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085910366.1\|114447_115134_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002339142.1\|115191_116412_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.9e-57	58.5
WP_002339141.1\|116431_117043_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.7e-56	53.2
WP_002339140.1\|117085_118018_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002339139.1\|118442_119300_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085910366.1\|119446_120133_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002296843.1\|120239_120428_-	hypothetical protein	NA	NA	NA	NA
WP_076065465.1\|120572_121259_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.2e-125	98.2
WP_002290394.1\|121728_122046_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002303208.1\|122046_122301_-	hypothetical protein	NA	NA	NA	NA
WP_002287522.1\|122659_123064_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002323589.1\|123080_124229_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
WP_002348857.1\|124935_125130_-	hypothetical protein	NA	NA	NA	NA
WP_002303636.1\|126481_127522_+	replication protein RepA	NA	NA	NA	NA
WP_002323647.1\|128345_128678_+	hypothetical protein	NA	NA	NA	NA
WP_002295674.1\|129296_129638_+	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
WP_002297404.1\|129874_131125_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_3

139391 : 147031

Temperate_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002321302.1\|139391_139865_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	5.6e-44	62.0
WP_002321303.1\|140230_140491_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.4e-11	51.4
WP_002296239.1\|140935_141142_+	hypothetical protein	NA	NA	NA	NA
WP_002305766.1\|141141_141393_+	hypothetical protein	NA	NA	NA	NA
WP_002305764.1\|141408_141825_+	hypothetical protein	NA	NA	NA	NA
WP_002348912.1\|141806_142079_+	hypothetical protein	NA	NA	NA	NA
WP_002305759.1\|142245_142647_+\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.4e-24	43.1
WP_002305757.1\|142658_143804_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D9J0Y9	Brochothrix_phage	7.7e-164	74.6
WP_002287514.1\|144041_144305_+	hypothetical protein	NA	NA	NA	NA
WP_002321032.1\|144298_144649_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_002318230.1\|144672_145287_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.6e-17	31.9
WP_002288787.1\|145600_146023_+	hypothetical protein	NA	NA	NA	NA
WP_002299573.1\|146032_146236_+	hypothetical protein	NA	NA	NA	NA
WP_002299575.1\|146446_147031_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.9e-43	51.7

DBSCAN-SWA_4

164007 : 203305

Streptococcus_phage(37.5%)

transposase,holin,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002300034.1\|164007_166065_-\|protease	serine protease	NA	NA	NA	NA
WP_002300033.1\|166209_166401_-	hypothetical protein	NA	NA	NA	NA
WP_002300032.1\|166588_167044_+	hypothetical protein	NA	NA	NA	NA
WP_002305782.1\|167040_167283_+	DUF5415 family protein	NA	NA	NA	NA
WP_002302862.1\|167300_167603_+	hypothetical protein	NA	NA	NA	NA
WP_002302860.1\|167671_169726_+	hypothetical protein	NA	NA	NA	NA
WP_002302859.1\|169725_172338_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_002302858.1\|172334_174713_+	hypothetical protein	NA	NA	NA	NA
WP_002302857.1\|174773_175316_+	hypothetical protein	NA	NA	NA	NA
WP_002302856.1\|175393_175726_+	hypothetical protein	NA	NA	NA	NA
WP_002302855.1\|175726_176320_+	hypothetical protein	NA	NA	NA	NA
WP_002302854.1\|176341_178366_+	hypothetical protein	NA	NA	NA	NA
WP_102642290.1\|178365_179565_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	2.5e-32	38.1
WP_002302852.1\|179580_180225_+	hypothetical protein	NA	NA	NA	NA
WP_002302851.1\|180235_181042_+	hypothetical protein	NA	NA	NA	NA
WP_033582323.1\|181452_182388_+	DUF4199 domain-containing protein	NA	NA	NA	NA
WP_002305788.1\|182431_182701_+	hypothetical protein	NA	NA	NA	NA
WP_002302849.1\|182976_183252_+	hypothetical protein	NA	NA	NA	NA
WP_002302844.1\|183293_183716_+	hypothetical protein	NA	NA	NA	NA
WP_033582318.1\|183735_185328_+	hypothetical protein	NA	NA	NA	NA
WP_002302842.1\|185348_185684_+	hypothetical protein	NA	NA	NA	NA
WP_002302840.1\|185829_186024_+	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|186159_187410_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305801.1\|187819_190192_+	hypothetical protein	B5SP25	Lactococcus_phage	3.4e-12	29.7
WP_002353594.1\|190252_191722_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002303486.1\|191732_193742_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002303484.1\|194087_194684_+	transcriptional regulator	NA	NA	NA	NA
WP_002303483.1\|194696_195596_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002301801.1\|195598_195730_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.3e-11	83.3
WP_002305808.1\|195751_196084_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	6.1e-21	53.2
WP_002303482.1\|196128_196362_+	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|196520_196643_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002305809.1\|196832_197057_+	hypothetical protein	NA	NA	NA	NA
WP_002305810.1\|197499_197706_+	hypothetical protein	NA	NA	NA	NA
WP_002300797.1\|197705_197957_+	hypothetical protein	NA	NA	NA	NA
WP_002300801.1\|198137_198410_+	hypothetical protein	NA	NA	NA	NA
WP_002300804.1\|198854_199034_+	hypothetical protein	NA	NA	NA	NA
WP_002311569.1\|199092_199449_+	hypothetical protein	NA	NA	NA	NA
WP_000222572.1\|200417_201371_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002300807.1\|201491_201755_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_000997695.1\|202126_203305_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025754

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025754_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025754_1

1179791-1179867

Orphan

Consensus_repeat	Method
TACAAAATTCTACAAGTAGTCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025754_1

>merge|NZ_CP025754|1|1179791-1179867|CRISPRCasFinder
TACAAAATTCTACAAGTAGTCAAGATAGGCGCTCAGTAGATGTTCGAGAAAACTTACAAAATACTACAAGTAGTCAA

>NZ_CP025754|1|1|1179791-1179867|CRISPRCasFinder
TACAAAATTCTACAAGTAGTCAA	GATAGGCGCTCAGTAGATGTTCGAGAAAACT
TACAAAATACTACAAGTAGTCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025754.1\|WP_002322861.1\|1185630_1185879_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP025754.1\|WP_002318021.1\|1173834_1175001_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP025754.1\|WP_002348881.1\|1183079_1183427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348876.1\|1177517_1177736_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_010782540.1\|1183486_1184761_-\|ISL3-like-element-IS1476-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP025754.1\|WP_002348880.1\|1181177_1182569_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP025754.1\|WP_002297290.1\|1171908_1172376_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854
NZ_CP025754.1\|WP_002321715.1\|1175991_1176318_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348874.1\|1175780_1175984_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224393
NZ_CP025754.1\|WP_002322858.1\|1182784_1183087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002322860.1\|1185217_1185532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348879.1\|1180581_1181193_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348835.1\|1186985_1187231_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP025754.1\|WP_002322855.1\|1180381_1180570_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002287505.1\|1173353_1173746_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NZ_CP025754.1\|WP_002348875.1\|1176472_1177516_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_CP025754.1\|WP_002322862.1\|1186107_1186881_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002322813.1\|1175055_1175706_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP025754.1\|WP_002288118.1\|1170250_1171789_+\|gluconokinase	unknown	unknown	gnl\|CDD\|212659
NZ_CP025754.1\|WP_002295975.1\|1172894_1173338_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703

Protein	Function_ID	Function_description	E-value
NZ_CP025754.1\|WP_002322861.1\|1185630_1185879_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	7.3051e-06
NZ_CP025754.1\|WP_002318021.1\|1173834_1175001_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.79537e-35
NZ_CP025754.1\|WP_010782540.1\|1183486_1184761_-\|ISL3-like-element-IS1476-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.69673e-74
NZ_CP025754.1\|WP_002348880.1\|1181177_1182569_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	3.42818e-26
NZ_CP025754.1\|WP_002297290.1\|1171908_1172376_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	7.4093e-53
NZ_CP025754.1\|WP_002348874.1\|1175780_1175984_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	3.61213e-06
NZ_CP025754.1\|WP_002348835.1\|1186985_1187231_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.60019e-05
NZ_CP025754.1\|WP_002287505.1\|1173353_1173746_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	1.13095e-82
NZ_CP025754.1\|WP_002348875.1\|1176472_1177516_+\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	6.35575e-17
NZ_CP025754.1\|WP_002322813.1\|1175055_1175706_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.06613e-05
NZ_CP025754.1\|WP_002288118.1\|1170250_1171789_+\|gluconokinase	gnl\|CDD\|212659	cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases. This subfamily is composed of a group of gluconate kinases (GntK, also known as gluconokinase; EC 2.7.1.12) encoded by the gntK gene, which catalyzes the ATP-dependent phosphorylation of D-gluconate and produce 6-phospho-D-gluconate and ADP. The presence of Mg2+ might be required for catalytic activity. The prototypical member of this subfamily is GntK from Lactobacillus acidophilus. Unlike Escherichia coli GntK, which belongs to the superfamily of P-loop containing nucleoside triphosphate hydrolases, members in this subfamily are homologous to glycerol kinase, xylulose kinase, and rhamnulokinase from Escherichia coli. They have been classified as members of the FGGY family of carbohydrate kinases, which contain two large domains separated by a deep cleft that forms the active site. This model spans both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Some uncharacterized homologous sequences are also included in this subfamily. The Lactobacillus gnt operon contains a single gntK gene. The gnt operons of some bacteria, such as Corynebacterium glutamicum, have two gntK genes. For example, the C. glutamicum gnt operon has both a gluconate kinase gntV gene (also known as gntK) and a second hypothetical gntK gene (also known as gntK2). Both gluconate kinases encoded by these genes belong to this family, however the protein encoded by C. glutamicum gntV is not included in this model as it is truncated in the C-terminal domain.	0
NZ_CP025754.1\|WP_002295975.1\|1172894_1173338_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	4.45441e-103

>NZ_CP025754.1|WP_002348876.1|1177517_1177736_+|hypothetical-protein
MIENHLVDKIHCLDQNADTLELTESICSNTIVLDLKAVNDDYVTHIIIDRKIAQKLSESLRKWAEGGNNENN
>NZ_CP025754.1|WP_002348875.1|1176472_1177516_+|replication-initiator-protein-A
MNEKEVESLVEKQGYSNSDIYAELYYQYPIFLNVNEKYKKMKLSSKLVYMLLKDRNRLSLKNNLYDENQKIFLIFEIKNLVEISGMSKNTILSALDELQKVKLLVKRKNGFNKNKMQMFPNFYYLLKPVLCKDDVYKINKITHQENSQKNLIVQNLNYGTNQYSVDSSKFELCDTSMKTRDKNNFADSSKNELELYKSYKDSKDIKESHNDDLFESLSTKNNKLDEELIETFIEENLLKQMWGESIVNCLKLASNSDYRQFDNWYKKFNYAIKSAEKEQKVQLKIIYEICNNSYFVDHVREQLAMTLRDLIRRAKTDHRIKQKNNYIFTSLKNKALELIKLQKKEGI
>NZ_CP025754.1|WP_002321715.1|1175991_1176318_+|hypothetical-protein
MASWLIEEIENERRKIMDAGITVMLDKQQTNQLKNYVFEMTKEAIDQARIDTGLERPFLKGKEMAKYLNVSYTTFLKFKRMGLPVILLEKMELFSKEECKKWILSHQI
>NZ_CP025754.1|WP_002348874.1|1175780_1175984_+|helix-turn-helix-domain-containing-protein
MITLNDQFIRSLRRHRADLILTKNDAAKLIGINRKTYVKIENGSKESIRASTYQKLVNWLLNDLKSK
>NZ_CP025754.1|WP_002322813.1|1175055_1175706_-|helix-turn-helix-transcriptional-regulator
MSIKTLLNLWFLCYNSLEFTIGGVTLNRIKFYIDSSKKTIKQISTETGINYTTLTNYYRGERNPRNTETWNILADYFHVPVSYLMGLDETNSIEQPNLDRIKTARLEKKDKIVKNIASLDSDYFTELSNLYFSMTSLLEVKLQEDDSDFLFLKSILEDSFEYTILFAKQKKFINKALNLNIDERKELESELFGNLTQVQVNNLKREITARLISKLQ
>NZ_CP025754.1|WP_002318021.1|1173834_1175001_-|site-specific-integrase
MSIQKYTTKSGARYSVRLYVRKDENGKQEYYVKKGFKTEKEAKLHEARKKVEIEDTGYHKPSNDLFITVYEEWLPSYRNRVQETTYQRTKDLFRLHILPKFGNKSISKITPVHCQNAVNEWALKFKNIKQLKSYSSQIFEYAIFAELLHRNPMANTNLPKREKKENENYFSLEELKAFWDILNKEEPLKHILIFQLLITTGIRKGELAALHWSDIYFEEQLMYVRKSYATIRNEEKNARRKTVRIQKNTKNISSERILPIDAQTIEMLKIWKKEQARELLQFGINTNTKNQLIFTYVNADGDINQPLHADYSNNILKRLEKKYKFKHVTIHGFRHTHATLLLEGGASIKETQDRLGHKNAETTLNTYSHVTEKAQRNALEKFIAYTGL
>NZ_CP025754.1|WP_002287505.1|1173353_1173746_+|30S-ribosomal-protein-S9
MAQVQYIGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFAVTETKGAYDVFVNVNGGGYAGQSGAIRHGIARALLEVDPDFRLALKRAGLLTRDARMVERKKPGLKKARKASQFSKR
>NZ_CP025754.1|WP_002295975.1|1172894_1173338_+|50S-ribosomal-protein-L13
MRTTYMAKPGEVERKWYVVDATDVPLGRLSTVVASVLRGKNKPTFTPHLDTGDFVIVINADKVKLTGKKATDKIYYRHSNYPGGLKSITAGELRAKNSRRLIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQPEVLDITNLI
>NZ_CP025754.1|WP_002297290.1|1171908_1172376_+|DNA-starvation/stationary-phase-protection-protein
MKFQQTKEVLNQLVADLSQMSVVVHQTHWYMRGPGFLTLHPMMDEFMDDLNAQLDEVSERLITLDGSPYSTLREFADNTKIPDEIGRWDRTIPERLETLVAGYRYLADLYQKGIEVSGEEGDDPTQDIFIEFKTATEKRIWMIQAHLGKAPEIDA
>NZ_CP025754.1|WP_002288118.1|1170250_1171789_+|gluconokinase
MNVSIGLDIGTTQTKAVAFTDEAQEAASAYFRYPLIQETQGMAEQDQELIFQGVCTVIKEVIKQLPSDTIIQFVSFSSAMHGLILLDEEKTPLSRMITWADNRAADEAEKLKYTVLGKEFYRQTGTPIHPMTPLNKIKWLQNSQPELFKKTAYFVGIKDYIFYRLFGELISDYGTASGTGYFDIHEFQWAEEVLDYLNIRIEQLPQVFPSTYQVTGLPSKTAAELGLPNDISFVLGGADGPLSNLGLGAFGDTIAALTVGTSGALRFITTQPQFHPEMETFCYVLDQKHWVVGGATSNGAGIFDWAGHTFLQEVVQSAKEKGENPYDALLSAIAFVPAGANGLIFHPYLLGERAPLWDADAFGSFIGLQRQHTEKEMMKAILEGICLNLYRILKGVCQENQLTEIRATGGFAQSPIFRQMMADVLGYPLVFPTVTEASALGAVILGWRSIGKIQSISEAQELIELKEQVGVQETDHKKYQKIYPLFVSTQKHLAQTYQQFAQLREELADSEK
>NZ_CP025754.1|WP_002322855.1|1180381_1180570_+|hypothetical-protein
MQLILQISTQDFLELAELCDSVKKATNEKITVTNYIELMIQEELMMKNEIESNFKCCSLEKM
>NZ_CP025754.1|WP_002348879.1|1180581_1181193_+|plasmid-mobilization-relaxosome-protein-MobC
MDDKQKMYEKNRKHSEALNFRVDKKTYLELTLIAKQRGISRADVCRERLKGLKYEPPLLAEDDRVALIKQLNQIGNNLNQAVKALNIIAKYFREQSENKKEKSLHFSFDVSRYNIFKDELANSIAKKMMISYPDDIFLESNRSTSSFLKLSEVEKDYFQYWLEKQTRPDTKEEYSQKVDRNLIHSIQIIASLKDEVKQLWELL
>NZ_CP025754.1|WP_002348880.1|1181177_1182569_+|relaxase/mobilization-nuclease-domain-containing-protein
MGATITSKGRKKNLSSLLQYAANPSKKEKCVAVSGINCSDNSEEALQEMNLVRTRMNKSEDIAQAFHVIHSFDKNISKELSIEKMHEIAVEFAEKAFPNSQIIVASHNDKDHFHSHLVINNIDMETCKRLRIDPKDLERMRKINDEVLVENGLEPVDNQYYENLEKRTNLYSNDPSKLKNGKINYQEFVQNAIEATLENCEVNSFVRFSDHLAKEYNIEVYQFSKTNNKLGYVLYKQDVNFYERRDELITLGREKQSRKEKSQYVERTFSARKLGKKYSFESVFERLEKNLEETHMNNFVDLDTEQIIALASGVDYKTGELNVPFVELDSIAQKQFSDHEGAKKIIKYDDFLREVDRHYANTISLEDDQEYTIKLHTDVNPRTLRSTKSKTILVKKTDQKELFLPAEGFKNCSHTPSAKQIHYQISRIMNDDVKMYRAKKDYEFTQQMIENQQRRQRDFEMDF
>NZ_CP025754.1|WP_002322858.1|1182784_1183087_+|hypothetical-protein
MSDPYIKVYCSKETKTIFDSFYEQNKGIFGTKANMFRVMVSNLPVLANQSNVKLSNPESKGIEQKISEIESIVVGKLDEIDQKLSYYLKNKCKTEEGKDV
>NZ_CP025754.1|WP_002348881.1|1183079_1183427_+|hypothetical-protein
MFKVYFPFQWLFKGILLLLLGLILFGSYLTIKARYFPEEKPVKIVTKDLKMGETYQADGVEITFKKVELTEKRNEFAQHDRVLQVTYTMKNDTENPIRPQQWSIENKRLFVKSCW
>NZ_CP025754.1|WP_010782540.1|1183486_1184761_-|ISL3-like-element-IS1476-family-transposase
MDNHTRKLLGLTDKHLFFDEEWLIEKEYKGVQAQFIKGKLDDSPSYCEHCRSVRIIRNGSYTTRTQMLKVKEKLTILELKRTRFLCHDCGRTFSAKTDLVDEHHQLTKELKQAILMELYENQSRKLIAKKYFVSDGTVTRILREATKHYQPRMNFLPTVLCMDEFKSMNSVSGSMSFICVDGTTNQLFTILEDRRLYKLTQYFLRFPRKARLKVKYLVMDMNASYCQLLKTVFPNAEIVTDRFHIVQHINRSFNQLRVQIMNRFRTSHSENQKKYRRLKRYWKLLLKDSTTLEPLKRHYHRLFKRPISQTEIVDELLSYNEELRTAYHFCQLLRYYFVKRGTEGFQETLKTISSTLPQSFKKKFTIFHRYQSGISNAFKVSHSNGVTEGLNNKIKLIKRIAFGYRNFYNFRARIYLQQGLIFEN
>NZ_CP025754.1|WP_002322860.1|1185217_1185532_+|hypothetical-protein
MADENKVVPLETLVINKEEFEQLFLDFFVQYDRIYDFSSSLDLFELEAEIIENSREENGKIIISVEKFNELFSETFEIDTDYYQPQEVFRLFRDQIIGISQTTK
>NZ_CP025754.1|WP_002322861.1|1185630_1185879_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MDTITPTNFKKNIGKVLQEVVHSNSEIEITRDSKNGLNDGVIMISKRKWELLQEELYLQRTGTWAYVSDLMKNEKEDDFKVV
>NZ_CP025754.1|WP_002322862.1|1186107_1186881_-|hypothetical-protein
MKKFAIILTCALLTGAISGCATSDTNSTSTETSTTTSEKNYPIHFFPVPDGFEAYYHDKKLDVPLSESNSIEKVLPIEIEKNQENIKLKAELPILNSTEIDWHENIKVTIEKGALAQLYTEKVEQFFESGANKDFSKISDYSDNFFNETQDEITNSTFMAEDMYNMTLKKIKAYDHPLNLTLNNGLLSFVLAGYVDYEYSPDYLETPLQHENNDINFRFVYESKSKTWLVDQLSTINTSFHELPKPENEADMVIKIF
>NZ_CP025754.1|WP_002348835.1|1186985_1187231_+|helix-turn-helix-transcriptional-regulator
MLFLKEEKLIDKENVIGSNIRRIRLEKGMGQTELVRELQLSKIAMTRETLVKIEGGRQHIKLDQLRAIRDILQVSYEDLLQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025754_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025754_2

1179929-1180115

Orphan

Consensus_repeat	Method
GAACAGTAGATGTACGAGAAAA	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP025754_2

>merge|NZ_CP025754|2|1179929-1180115|PILER-CR
GAACGGTAGATGTACGAGAAAACTTGCAGAATACTACAAGTAGTCAAAATGGAAATCGAACAGTAGATGTACGAGAAAATGTACAAAGTAGTGGGACAAGTCAACCGAGAACGGTAGATGTACGAGAAAACTTGCAGAATACTACAAGTAGTCAAAATGGAAATCGAACAGTAGATGTACGAGAAAA

>NZ_CP025754|2|1|1179929-1180115|PILER-CR
GAACGGTAGATGTACGAGAAAA	CTTGCAGAATACTACAAGTAGTCAAAATGGAAATC
GAACAGTAGATGTACGAGAAAA	TGTACAAAGTAGTGGGACAAGTCAACCGA
GAACGGTAGATGTACGAGAAAA	CTTGCAGAATACTACAAGTAGTCAAAATGGAAATC
GAACAGTAGATGTACGAGAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025754.1\|WP_002322861.1\|1185630_1185879_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP025754.1\|WP_002318021.1\|1173834_1175001_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP025754.1\|WP_002348881.1\|1183079_1183427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348876.1\|1177517_1177736_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_010782540.1\|1183486_1184761_-\|ISL3-like-element-IS1476-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP025754.1\|WP_002348880.1\|1181177_1182569_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP025754.1\|WP_002297290.1\|1171908_1172376_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854
NZ_CP025754.1\|WP_002321715.1\|1175991_1176318_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348874.1\|1175780_1175984_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224393
NZ_CP025754.1\|WP_002322858.1\|1182784_1183087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002322860.1\|1185217_1185532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348879.1\|1180581_1181193_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	unknown
NZ_CP025754.1\|WP_002348835.1\|1186985_1187231_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP025754.1\|WP_002322855.1\|1180381_1180570_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002287505.1\|1173353_1173746_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NZ_CP025754.1\|WP_002348875.1\|1176472_1177516_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_CP025754.1\|WP_002322862.1\|1186107_1186881_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025754.1\|WP_002322813.1\|1175055_1175706_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP025754.1\|WP_002288118.1\|1170250_1171789_+\|gluconokinase	unknown	unknown	gnl\|CDD\|212659
NZ_CP025754.1\|WP_002295975.1\|1172894_1173338_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703

Protein	Function_ID	Function_description	E-value
NZ_CP025754.1\|WP_002322861.1\|1185630_1185879_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	7.3051e-06
NZ_CP025754.1\|WP_002318021.1\|1173834_1175001_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.79537e-35
NZ_CP025754.1\|WP_010782540.1\|1183486_1184761_-\|ISL3-like-element-IS1476-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.69673e-74
NZ_CP025754.1\|WP_002348880.1\|1181177_1182569_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	3.42818e-26
NZ_CP025754.1\|WP_002297290.1\|1171908_1172376_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	7.4093e-53
NZ_CP025754.1\|WP_002348874.1\|1175780_1175984_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	3.61213e-06
NZ_CP025754.1\|WP_002348835.1\|1186985_1187231_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.60019e-05
NZ_CP025754.1\|WP_002287505.1\|1173353_1173746_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	1.13095e-82
NZ_CP025754.1\|WP_002348875.1\|1176472_1177516_+\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	6.35575e-17
NZ_CP025754.1\|WP_002322813.1\|1175055_1175706_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.06613e-05
NZ_CP025754.1\|WP_002288118.1\|1170250_1171789_+\|gluconokinase	gnl\|CDD\|212659	cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases. This subfamily is composed of a group of gluconate kinases (GntK, also known as gluconokinase; EC 2.7.1.12) encoded by the gntK gene, which catalyzes the ATP-dependent phosphorylation of D-gluconate and produce 6-phospho-D-gluconate and ADP. The presence of Mg2+ might be required for catalytic activity. The prototypical member of this subfamily is GntK from Lactobacillus acidophilus. Unlike Escherichia coli GntK, which belongs to the superfamily of P-loop containing nucleoside triphosphate hydrolases, members in this subfamily are homologous to glycerol kinase, xylulose kinase, and rhamnulokinase from Escherichia coli. They have been classified as members of the FGGY family of carbohydrate kinases, which contain two large domains separated by a deep cleft that forms the active site. This model spans both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Some uncharacterized homologous sequences are also included in this subfamily. The Lactobacillus gnt operon contains a single gntK gene. The gnt operons of some bacteria, such as Corynebacterium glutamicum, have two gntK genes. For example, the C. glutamicum gnt operon has both a gluconate kinase gntV gene (also known as gntK) and a second hypothetical gntK gene (also known as gntK2). Both gluconate kinases encoded by these genes belong to this family, however the protein encoded by C. glutamicum gntV is not included in this model as it is truncated in the C-terminal domain.	0
NZ_CP025754.1\|WP_002295975.1\|1172894_1173338_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	4.45441e-103

>NZ_CP025754.1|WP_002348876.1|1177517_1177736_+|hypothetical-protein
MIENHLVDKIHCLDQNADTLELTESICSNTIVLDLKAVNDDYVTHIIIDRKIAQKLSESLRKWAEGGNNENN
>NZ_CP025754.1|WP_002348875.1|1176472_1177516_+|replication-initiator-protein-A
MNEKEVESLVEKQGYSNSDIYAELYYQYPIFLNVNEKYKKMKLSSKLVYMLLKDRNRLSLKNNLYDENQKIFLIFEIKNLVEISGMSKNTILSALDELQKVKLLVKRKNGFNKNKMQMFPNFYYLLKPVLCKDDVYKINKITHQENSQKNLIVQNLNYGTNQYSVDSSKFELCDTSMKTRDKNNFADSSKNELELYKSYKDSKDIKESHNDDLFESLSTKNNKLDEELIETFIEENLLKQMWGESIVNCLKLASNSDYRQFDNWYKKFNYAIKSAEKEQKVQLKIIYEICNNSYFVDHVREQLAMTLRDLIRRAKTDHRIKQKNNYIFTSLKNKALELIKLQKKEGI
>NZ_CP025754.1|WP_002321715.1|1175991_1176318_+|hypothetical-protein
MASWLIEEIENERRKIMDAGITVMLDKQQTNQLKNYVFEMTKEAIDQARIDTGLERPFLKGKEMAKYLNVSYTTFLKFKRMGLPVILLEKMELFSKEECKKWILSHQI
>NZ_CP025754.1|WP_002348874.1|1175780_1175984_+|helix-turn-helix-domain-containing-protein
MITLNDQFIRSLRRHRADLILTKNDAAKLIGINRKTYVKIENGSKESIRASTYQKLVNWLLNDLKSK
>NZ_CP025754.1|WP_002322813.1|1175055_1175706_-|helix-turn-helix-transcriptional-regulator
MSIKTLLNLWFLCYNSLEFTIGGVTLNRIKFYIDSSKKTIKQISTETGINYTTLTNYYRGERNPRNTETWNILADYFHVPVSYLMGLDETNSIEQPNLDRIKTARLEKKDKIVKNIASLDSDYFTELSNLYFSMTSLLEVKLQEDDSDFLFLKSILEDSFEYTILFAKQKKFINKALNLNIDERKELESELFGNLTQVQVNNLKREITARLISKLQ
>NZ_CP025754.1|WP_002318021.1|1173834_1175001_-|site-specific-integrase
MSIQKYTTKSGARYSVRLYVRKDENGKQEYYVKKGFKTEKEAKLHEARKKVEIEDTGYHKPSNDLFITVYEEWLPSYRNRVQETTYQRTKDLFRLHILPKFGNKSISKITPVHCQNAVNEWALKFKNIKQLKSYSSQIFEYAIFAELLHRNPMANTNLPKREKKENENYFSLEELKAFWDILNKEEPLKHILIFQLLITTGIRKGELAALHWSDIYFEEQLMYVRKSYATIRNEEKNARRKTVRIQKNTKNISSERILPIDAQTIEMLKIWKKEQARELLQFGINTNTKNQLIFTYVNADGDINQPLHADYSNNILKRLEKKYKFKHVTIHGFRHTHATLLLEGGASIKETQDRLGHKNAETTLNTYSHVTEKAQRNALEKFIAYTGL
>NZ_CP025754.1|WP_002287505.1|1173353_1173746_+|30S-ribosomal-protein-S9
MAQVQYIGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFAVTETKGAYDVFVNVNGGGYAGQSGAIRHGIARALLEVDPDFRLALKRAGLLTRDARMVERKKPGLKKARKASQFSKR
>NZ_CP025754.1|WP_002295975.1|1172894_1173338_+|50S-ribosomal-protein-L13
MRTTYMAKPGEVERKWYVVDATDVPLGRLSTVVASVLRGKNKPTFTPHLDTGDFVIVINADKVKLTGKKATDKIYYRHSNYPGGLKSITAGELRAKNSRRLIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQPEVLDITNLI
>NZ_CP025754.1|WP_002297290.1|1171908_1172376_+|DNA-starvation/stationary-phase-protection-protein
MKFQQTKEVLNQLVADLSQMSVVVHQTHWYMRGPGFLTLHPMMDEFMDDLNAQLDEVSERLITLDGSPYSTLREFADNTKIPDEIGRWDRTIPERLETLVAGYRYLADLYQKGIEVSGEEGDDPTQDIFIEFKTATEKRIWMIQAHLGKAPEIDA
>NZ_CP025754.1|WP_002288118.1|1170250_1171789_+|gluconokinase
MNVSIGLDIGTTQTKAVAFTDEAQEAASAYFRYPLIQETQGMAEQDQELIFQGVCTVIKEVIKQLPSDTIIQFVSFSSAMHGLILLDEEKTPLSRMITWADNRAADEAEKLKYTVLGKEFYRQTGTPIHPMTPLNKIKWLQNSQPELFKKTAYFVGIKDYIFYRLFGELISDYGTASGTGYFDIHEFQWAEEVLDYLNIRIEQLPQVFPSTYQVTGLPSKTAAELGLPNDISFVLGGADGPLSNLGLGAFGDTIAALTVGTSGALRFITTQPQFHPEMETFCYVLDQKHWVVGGATSNGAGIFDWAGHTFLQEVVQSAKEKGENPYDALLSAIAFVPAGANGLIFHPYLLGERAPLWDADAFGSFIGLQRQHTEKEMMKAILEGICLNLYRILKGVCQENQLTEIRATGGFAQSPIFRQMMADVLGYPLVFPTVTEASALGAVILGWRSIGKIQSISEAQELIELKEQVGVQETDHKKYQKIYPLFVSTQKHLAQTYQQFAQLREELADSEK
>NZ_CP025754.1|WP_002322855.1|1180381_1180570_+|hypothetical-protein
MQLILQISTQDFLELAELCDSVKKATNEKITVTNYIELMIQEELMMKNEIESNFKCCSLEKM
>NZ_CP025754.1|WP_002348879.1|1180581_1181193_+|plasmid-mobilization-relaxosome-protein-MobC
MDDKQKMYEKNRKHSEALNFRVDKKTYLELTLIAKQRGISRADVCRERLKGLKYEPPLLAEDDRVALIKQLNQIGNNLNQAVKALNIIAKYFREQSENKKEKSLHFSFDVSRYNIFKDELANSIAKKMMISYPDDIFLESNRSTSSFLKLSEVEKDYFQYWLEKQTRPDTKEEYSQKVDRNLIHSIQIIASLKDEVKQLWELL
>NZ_CP025754.1|WP_002348880.1|1181177_1182569_+|relaxase/mobilization-nuclease-domain-containing-protein
MGATITSKGRKKNLSSLLQYAANPSKKEKCVAVSGINCSDNSEEALQEMNLVRTRMNKSEDIAQAFHVIHSFDKNISKELSIEKMHEIAVEFAEKAFPNSQIIVASHNDKDHFHSHLVINNIDMETCKRLRIDPKDLERMRKINDEVLVENGLEPVDNQYYENLEKRTNLYSNDPSKLKNGKINYQEFVQNAIEATLENCEVNSFVRFSDHLAKEYNIEVYQFSKTNNKLGYVLYKQDVNFYERRDELITLGREKQSRKEKSQYVERTFSARKLGKKYSFESVFERLEKNLEETHMNNFVDLDTEQIIALASGVDYKTGELNVPFVELDSIAQKQFSDHEGAKKIIKYDDFLREVDRHYANTISLEDDQEYTIKLHTDVNPRTLRSTKSKTILVKKTDQKELFLPAEGFKNCSHTPSAKQIHYQISRIMNDDVKMYRAKKDYEFTQQMIENQQRRQRDFEMDF
>NZ_CP025754.1|WP_002322858.1|1182784_1183087_+|hypothetical-protein
MSDPYIKVYCSKETKTIFDSFYEQNKGIFGTKANMFRVMVSNLPVLANQSNVKLSNPESKGIEQKISEIESIVVGKLDEIDQKLSYYLKNKCKTEEGKDV
>NZ_CP025754.1|WP_002348881.1|1183079_1183427_+|hypothetical-protein
MFKVYFPFQWLFKGILLLLLGLILFGSYLTIKARYFPEEKPVKIVTKDLKMGETYQADGVEITFKKVELTEKRNEFAQHDRVLQVTYTMKNDTENPIRPQQWSIENKRLFVKSCW
>NZ_CP025754.1|WP_010782540.1|1183486_1184761_-|ISL3-like-element-IS1476-family-transposase
MDNHTRKLLGLTDKHLFFDEEWLIEKEYKGVQAQFIKGKLDDSPSYCEHCRSVRIIRNGSYTTRTQMLKVKEKLTILELKRTRFLCHDCGRTFSAKTDLVDEHHQLTKELKQAILMELYENQSRKLIAKKYFVSDGTVTRILREATKHYQPRMNFLPTVLCMDEFKSMNSVSGSMSFICVDGTTNQLFTILEDRRLYKLTQYFLRFPRKARLKVKYLVMDMNASYCQLLKTVFPNAEIVTDRFHIVQHINRSFNQLRVQIMNRFRTSHSENQKKYRRLKRYWKLLLKDSTTLEPLKRHYHRLFKRPISQTEIVDELLSYNEELRTAYHFCQLLRYYFVKRGTEGFQETLKTISSTLPQSFKKKFTIFHRYQSGISNAFKVSHSNGVTEGLNNKIKLIKRIAFGYRNFYNFRARIYLQQGLIFEN
>NZ_CP025754.1|WP_002322860.1|1185217_1185532_+|hypothetical-protein
MADENKVVPLETLVINKEEFEQLFLDFFVQYDRIYDFSSSLDLFELEAEIIENSREENGKIIISVEKFNELFSETFEIDTDYYQPQEVFRLFRDQIIGISQTTK
>NZ_CP025754.1|WP_002322861.1|1185630_1185879_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MDTITPTNFKKNIGKVLQEVVHSNSEIEITRDSKNGLNDGVIMISKRKWELLQEELYLQRTGTWAYVSDLMKNEKEDDFKVV
>NZ_CP025754.1|WP_002322862.1|1186107_1186881_-|hypothetical-protein
MKKFAIILTCALLTGAISGCATSDTNSTSTETSTTTSEKNYPIHFFPVPDGFEAYYHDKKLDVPLSESNSIEKVLPIEIEKNQENIKLKAELPILNSTEIDWHENIKVTIEKGALAQLYTEKVEQFFESGANKDFSKISDYSDNFFNETQDEITNSTFMAEDMYNMTLKKIKAYDHPLNLTLNNGLLSFVLAGYVDYEYSPDYLETPLQHENNDINFRFVYESKSKTWLVDQLSTINTSFHELPKPENEADMVIKIF
>NZ_CP025754.1|WP_002348835.1|1186985_1187231_+|helix-turn-helix-transcriptional-regulator
MLFLKEEKLIDKENVIGSNIRRIRLEKGMGQTELVRELQLSKIAMTRETLVKIEGGRQHIKLDQLRAIRDILQVSYEDLLQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025754_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025754_3

1590061-1590170

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025754_3

>merge|NZ_CP025754|3|1590061-1590170|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP025754|3|2|1590061-1590170|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025754.1\|WP_002303469.1\|1599422_1601582_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP025754.1\|WP_002294578.1\|1583482_1583635_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP025754.1\|WP_002294585.1\|1587606_1588275_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP025754.1\|WP_002294587.1\|1589143_1589833_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP025754.1\|WP_002291638.1\|1588617_1589040_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP025754.1\|WP_002303471.1\|1592043_1593246_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP025754.1\|WP_010782583.1\|1593436_1594969_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP025754.1\|WP_002294584.1\|1586721_1587594_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP025754.1\|WP_002294593.1\|1597179_1598319_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP025754.1\|WP_002294588.1\|1590798_1591167_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP025754.1\|WP_002294580.1\|1583929_1584475_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP025754.1\|WP_002287787.1\|1595202_1595904_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP025754.1\|WP_002294581.1\|1584551_1585439_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP025754.1\|WP_002294583.1\|1585611_1586631_+\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP025754.1\|WP_002294589.1\|1591272_1591962_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP025754.1\|WP_002287792.1\|1598407_1599373_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP025754.1\|WP_002294577.1\|1582676_1583321_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP025754.1\|WP_002291634.1\|1590242_1590746_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP025754.1\|WP_002287788.1\|1596157_1596871_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP025754.1\|WP_002294579.1\|1583658_1583829_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355

Protein	Function_ID	Function_description	E-value
NZ_CP025754.1\|WP_002303469.1\|1599422_1601582_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP025754.1\|WP_002294578.1\|1583482_1583635_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP025754.1\|WP_002294585.1\|1587606_1588275_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP025754.1\|WP_002294587.1\|1589143_1589833_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP025754.1\|WP_002291638.1\|1588617_1589040_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP025754.1\|WP_002303471.1\|1592043_1593246_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
NZ_CP025754.1\|WP_010782583.1\|1593436_1594969_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	3.59834e-170
NZ_CP025754.1\|WP_002294584.1\|1586721_1587594_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP025754.1\|WP_002294593.1\|1597179_1598319_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
NZ_CP025754.1\|WP_002294588.1\|1590798_1591167_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP025754.1\|WP_002294580.1\|1583929_1584475_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP025754.1\|WP_002287787.1\|1595202_1595904_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP025754.1\|WP_002294581.1\|1584551_1585439_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP025754.1\|WP_002294583.1\|1585611_1586631_+\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP025754.1\|WP_002294589.1\|1591272_1591962_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
NZ_CP025754.1\|WP_002287792.1\|1598407_1599373_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP025754.1\|WP_002294577.1\|1582676_1583321_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP025754.1\|WP_002291634.1\|1590242_1590746_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP025754.1\|WP_002287788.1\|1596157_1596871_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP025754.1\|WP_002294579.1\|1583658_1583829_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13

>NZ_CP025754.1|WP_002294587.1|1589143_1589833_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP025754.1|WP_002291638.1|1588617_1589040_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP025754.1|WP_002294585.1|1587606_1588275_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP025754.1|WP_002294584.1|1586721_1587594_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP025754.1|WP_002294583.1|1585611_1586631_+|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP025754.1|WP_002294581.1|1584551_1585439_+|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP025754.1|WP_002294580.1|1583929_1584475_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP025754.1|WP_002294579.1|1583658_1583829_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP025754.1|WP_002294578.1|1583482_1583635_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP025754.1|WP_002294577.1|1582676_1583321_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP025754.1|WP_002291634.1|1590242_1590746_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP025754.1|WP_002294588.1|1590798_1591167_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP025754.1|WP_002294589.1|1591272_1591962_+|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP025754.1|WP_002303471.1|1592043_1593246_+|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>NZ_CP025754.1|WP_010782583.1|1593436_1594969_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQINWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP025754.1|WP_002287787.1|1595202_1595904_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP025754.1|WP_002287788.1|1596157_1596871_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP025754.1|WP_002294593.1|1597179_1598319_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP025754.1|WP_002287792.1|1598407_1599373_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP025754.1|WP_002303469.1|1599422_1601582_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_CP025754.1	1179843-1179877	2	0.943
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_CP025754.1	1179900-1179928	1	0.966
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_CP025754.1	1179843-1179877	2	0.943

1. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to position: 1179843-1179877, mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

2. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to position: 1179900-1179928, mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

3. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to position: 1179843-1179877, mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50968-50998	0	1.0
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25444-25474	0	1.0
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	40990-41020	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25581-25615	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25689-25723	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41127-41161	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41235-41269	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50719-50753	0	1.0
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50827-50861	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25581-25615	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25689-25723	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41127-41161	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41235-41269	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50719-50753	0	1.0
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50827-50861	0	1.0
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50776-50804	1	0.966
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50884-50912	1	0.966
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25530-25558	1	0.966
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25638-25666	1	0.966
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41076-41104	1	0.966
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41184-41212	1	0.966
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25473-25507	2	0.943
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41019-41053	2	0.943
NZ_CP025754_2	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50935-50969	2	0.943
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25473-25507	2	0.943
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41019-41053	2	0.943
NZ_CP025754_2	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50935-50969	2	0.943
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_LR135299	Enterococcus faecium isolate E7429 plasmid 3	35657-35687	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP041255	Enterococcus faecium strain 515 plasmid p32, complete sequence	47299-47329	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_KY290886	Enterococcus faecalis strain Transconjugant T4 plasmid pJH-T4, complete sequence	62564-62594	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP014451	Enterococcus faecium strain ATCC 700221 plasmid unnamed2, complete sequence	3225-3255	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_LR135341	Enterococcus faecium isolate E7356 plasmid 3	36801-36831	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP027515	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed3, complete sequence	19429-19459	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NC_011364	Enterococcus faecium plasmid pMG1, complete sequence	33916-33946	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP014535	Enterococcus faecium strain E745 plasmid pl6, complete sequence	35427-35457	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NC_007594	Enterococcus faecium plasmid pHT beta, complete sequence	23229-23259	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP019972	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence	26127-26157	7	0.774
NZ_CP025754_1	1.1\|1179814\|31\|NZ_CP025754\|CRISPRCasFinder	1179814-1179844	31	NZ_CP018130	Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence	44361-44391	7	0.774
NZ_CP025754_2	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	33019-33047	8	0.724

1. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
gataggcgctcagtagatgttcgagaaaact	Protospacer
*******************************

2. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
gataggcgctcagtagatgttcgagaaaact	Protospacer
*******************************

3. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
gataggcgctcagtagatgttcgagaaaact	Protospacer
*******************************

4. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

5. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

6. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

7. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

8. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

9. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

10. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

11. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

12. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

13. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

14. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

15. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttgcagaatactacaagtagtcaaaatggaaatc	Protospacer
***********************************

16. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

17. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

18. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

19. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

20. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

21. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 1, identity: 0.966

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

22. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

23. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

24. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

25. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

26. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

27. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 2, identity: 0.943

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

28. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_LR135299 (Enterococcus faecium isolate E7429 plasmid 3) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

29. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP041255 (Enterococcus faecium strain 515 plasmid p32, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

30. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_KY290886 (Enterococcus faecalis strain Transconjugant T4 plasmid pJH-T4, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

31. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP014451 (Enterococcus faecium strain ATCC 700221 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

32. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_LR135341 (Enterococcus faecium isolate E7356 plasmid 3) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

33. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP027515 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

34. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NC_011364 (Enterococcus faecium plasmid pMG1, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

35. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP014535 (Enterococcus faecium strain E745 plasmid pl6, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

36. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NC_007594 (Enterococcus faecium plasmid pHT beta, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggccgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

37. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP019972 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

38. spacer 1.1|1179814|31|NZ_CP025754|CRISPRCasFinder matches to NZ_CP018130 (Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gataggcgctcagtagatgttcgagaaaact	CRISPR spacer
ggtggtcgatcagtagatgtccgagaaaata	Protospacer
*.*.* ** ***********.********.

39. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
gtaacaaagtagcgtgacaagtcaacatc	Protospacer
   *********.* ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

143551 : 250522

117

Enterococcus_phage(19.61%)

integrase,protease,tail,holin,transposase,terminase,capsid,head,portal

attL 148496:148510|attR 251301:251315

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287598.1\|143551_145786_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.1e-127	39.1
WP_002290825.1\|145932_146253_+	DUF1827 family protein	NA	NA	NA	NA
WP_000122610.1\|146420_147713_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002295394.1\|147930_149511_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	5.1e-33	28.4
148496:148510	attL	NA	NA	NA	NA
WP_002295395.1\|149911_151288_-	HlyC/CorC family transporter	NA	NA	NA	NA
148496:148510	attL	NA	NA	NA	NA
WP_002290821.1\|151415_152534_-	AI-2E family transporter	NA	NA	NA	NA
WP_002290819.1\|152675_153110_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002290817.1\|153187_153721_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_002296955.1\|153814_154993_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_002295398.1\|154985_155783_-	recombination regulator RecX	NA	NA	NA	NA
WP_002295399.1\|155889_157272_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.5e-86	37.4
WP_002292856.1\|157445_158024_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.7e-14	34.4
WP_002292857.1\|158344_158815_+	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_002295400.1\|158922_160149_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_002292860.1\|160902_161103_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.6e-19	67.7
WP_002298541.1\|161236_161845_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.6e-70	60.6
WP_002292862.1\|161929_162400_-	GtrA family protein	NA	NA	NA	NA
WP_002318002.1\|162447_163362_-	cation transporter	A0A1V0SED0	Indivirus	7.9e-10	30.8
WP_002348731.1\|163507_164311_+	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_002289148.1\|164488_165436_+	2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_002326809.1\|165620_166916_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002318627.1\|167025_167319_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_002289151.1\|167346_168012_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_002348688.1\|168151_168784_-	response regulator transcription factor	NA	NA	NA	NA
WP_002348689.1\|168790_169858_-	sensor histidine kinase	NA	NA	NA	NA
WP_002295408.1\|169854_170586_-	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_002295409.1\|170753_171233_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_002348690.1\|171368_172544_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_002297066.1\|172708_173869_+	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	3.2e-08	25.2
WP_002298534.1\|173908_174856_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	6.6e-52	38.1
WP_002298532.1\|174988_176380_-	polymerase	NA	NA	NA	NA
WP_002298530.1\|176505_176916_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.4e-19	40.7
WP_002297946.1\|178451_179879_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_002297948.1\|181020_182016_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002297949.1\|182129_183119_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	7.7e-11	33.6
WP_002348694.1\|183090_183900_-	glycosyltransferase	F2Y1U7	Organic_Lake_phycodnavirus	3.6e-14	31.9
WP_010782577.1\|183958_185350_-	sugar transferase	NA	NA	NA	NA
WP_002348696.1\|185637_187776_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002348697.1\|187814_189401_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002297957.1\|189390_190611_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
WP_002289081.1\|190622_191429_-	ABC transporter permease	NA	NA	NA	NA
WP_010782578.1\|191736_193011_+\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	8.6e-55	36.1
WP_002297185.1\|193275_194571_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002348825.1\|194667_195948_-	EpaQ family protein	NA	NA	NA	NA
WP_002348826.1\|195991_198025_-	hypothetical protein	NA	NA	NA	NA
WP_002286428.1\|198058_198910_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002294532.1\|199007_200036_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286442.1\|200057_200630_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002286449.1\|200643_201510_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002321540.1\|201609_202344_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286453.1\|202321_203149_-	glycosyltransferase	NA	NA	NA	NA
WP_002286455.1\|203148_203949_-	glycosyltransferase	NA	NA	NA	NA
WP_002286457.1\|203941_205081_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286461.1\|205156_206080_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002294533.1\|206111_206876_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002297963.1\|207033_207474_+	flavodoxin	NA	NA	NA	NA
WP_002286467.1\|207651_208221_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002348827.1\|208477_209710_+	aminopeptidase	NA	NA	NA	NA
WP_076005172.1\|210014_210215_+\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286680.1\|210463_210766_+	hypothetical protein	NA	NA	NA	NA
210243:210257	attR	NA	NA	NA	NA
WP_002286473.1\|210801_211173_-	hypothetical protein	NA	NA	NA	NA
210243:210257	attR	NA	NA	NA	NA
WP_002296902.1\|211174_211576_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|211589_211997_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|212919_214082_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002349643.1\|215021_216047_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.8e-64	61.3
WP_002286683.1\|216043_216268_-\|holin	holin	NA	NA	NA	NA
WP_002286686.1\|216264_216558_-	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|216595_216733_-	XkdX family protein	NA	NA	NA	NA
WP_002286491.1\|216734_217181_-	hypothetical protein	NA	NA	NA	NA
WP_002286495.1\|217343_219470_-	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286497.1\|219493_221785_-	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	9.6e-89	30.0
WP_002286500.1\|221794_222532_-\|tail	phage tail protein	NA	NA	NA	NA
WP_002348716.1\|222582_226014_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002305377.1\|226030_226213_-	hypothetical protein	NA	NA	NA	NA
WP_002286510.1\|226215_226578_-	hypothetical protein	NA	NA	NA	NA
WP_002286512.1\|226597_227206_-	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286516.1\|227217_227622_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002296598.1\|227614_228016_-	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286522.1\|228005_228359_-\|head	phage head closure protein	NA	NA	NA	NA
WP_002286523.1\|228348_228660_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286524.1\|228656_229532_-	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286525.1\|229541_230702_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286527.1\|230701_231388_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286530.1\|231350_232529_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286533.1\|232548_234243_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286538.1\|234220_234535_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002296599.1\|234637_234919_-	hypothetical protein	NA	NA	NA	NA
WP_002286540.1\|234923_235268_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296600.1\|235293_235461_-	thymidylate synthase	NA	NA	NA	NA
WP_002311723.1\|235656_235863_-	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|236316_236592_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002286542.1\|237049_237463_-	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002286693.1\|237539_237836_-	hypothetical protein	NA	NA	NA	NA
WP_002286545.1\|237832_238390_-	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286547.1\|238386_238806_-	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002296604.1\|238802_239048_-	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|239007_239364_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002286694.1\|239363_239669_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|239665_239827_-	antitoxin	NA	NA	NA	NA
WP_002286695.1\|239823_240126_-	hypothetical protein	NA	NA	NA	NA
WP_002286696.1\|240287_240557_-	hypothetical protein	NA	NA	NA	NA
WP_002286552.1\|240568_241318_-	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286553.1\|241320_242007_-	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286557.1\|242012_242684_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286559.1\|242676_243018_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|243195_243894_-	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286568.1\|243980_244451_+	hypothetical protein	NA	NA	NA	NA
WP_002296610.1\|244493_244673_-	hypothetical protein	NA	NA	NA	NA
WP_002286573.1\|244659_244998_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296611.1\|245013_245217_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002290310.1\|245231_246008_-	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296612.1\|246306_246627_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002348715.1\|246644_247076_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002303013.1\|247205_247667_+	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296616.1\|247700_248336_+	hypothetical protein	NA	NA	NA	NA
WP_002296617.1\|248448_249084_+	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|249382_250522_+\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
251301:251315	attR	NA	NA	NA	NA

DBSCAN-SWA_2

321677 : 330148

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288083.1\|321677_323867_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6
WP_002288081.1\|324181_324784_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002294035.1\|324837_325959_-	DNA polymerase IV	NA	NA	NA	NA
WP_002288078.1\|326067_326940_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002288076.1\|327008_327356_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288071.1\|328207_329146_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002292340.1\|329159_329489_-	hypothetical protein	NA	NA	NA	NA
WP_002294039.1\|329503_330148_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6

DBSCAN-SWA_3

766153 : 810019

Streptococcus_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000997695.1\|766153_767332_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321965.1\|767370_767892_-	hypothetical protein	NA	NA	NA	NA
WP_002296909.1\|767857_769495_+	membrane protein	NA	NA	NA	NA
WP_002294728.1\|769639_770380_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002294730.1\|770570_771206_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002294732.1\|771352_772594_-	serine/threonine transporter SstT	NA	NA	NA	NA
WP_025478783.1\|773803_775852_+	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_002296623.1\|775898_777194_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002294735.1\|777392_778109_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_000222572.1\|778207_779161_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002296256.1\|779252_780251_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002304106.1\|780325_780622_-	peptidase	NA	NA	NA	NA
WP_002296258.1\|780614_780908_-	hypothetical protein	NA	NA	NA	NA
WP_002296259.1\|781053_781605_-	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_002296261.1\|781778_782078_-	hypothetical protein	NA	NA	NA	NA
WP_002296262.1\|782104_782371_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002340421.1\|782717_783401_+	hypothetical protein	NA	NA	NA	NA
WP_002295755.1\|783437_783935_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002326839.1\|783990_784899_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002296391.1\|785378_786170_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002296392.1\|786360_786996_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002291912.1\|787261_788314_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002291914.1\|788326_789265_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002296570.1\|789715_790366_-	hypothetical protein	NA	NA	NA	NA
WP_002301781.1\|790465_790975_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.8e-17	34.8
WP_002348774.1\|791220_792540_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.3e-210	82.7
WP_002331215.1\|793021_793405_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002336652.1\|793645_794260_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002336651.1\|795075_796050_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002336650.1\|796068_796524_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_002336649.1\|796551_797997_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002331209.1\|797993_798929_-	1-phosphofructokinase	NA	NA	NA	NA
WP_002331208.1\|799096_799855_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002345001.1\|800349_801549_-	MFS transporter	NA	NA	NA	NA
WP_002331206.1\|801991_802483_-	hypothetical protein	NA	NA	NA	NA
WP_002331205.1\|802509_803655_-	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-52	33.4
WP_002336647.1\|803669_805037_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002331203.1\|805061_805340_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002336646.1\|805358_805817_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002336645.1\|805828_806449_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_002336644.1\|806459_808502_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_010782519.1\|808879_810019_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

830246 : 837983

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002345009.1\|830246_830639_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.6e-68	99.2
WP_002345010.1\|830725_831223_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_032509114.1\|831339_831564_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.5e-27	97.1
WP_002286940.1\|831667_833578_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_000398284.1\|834361_835567_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_002297361.1\|836123_837983_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0

DBSCAN-SWA_5

869327 : 1017935

125

Streptococcus_phage(13.16%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086953915.1\|869327_870667_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002300788.1\|871292_871772_-	TRAP transporter small permease	NA	NA	NA	NA
WP_010782513.1\|874049_875660_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	8.4e-124	48.0
WP_010782512.1\|875567_878165_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_002300794.1\|878469_878850_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_002294183.1\|878946_880092_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	40.9
WP_002341590.1\|880320_881274_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002294185.1\|881376_882075_+	DUF975 family protein	NA	NA	NA	NA
WP_002289743.1\|882242_884882_-	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.6e-84	31.2
WP_002326809.1\|885591_886887_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002319878.1\|887048_888344_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	37.2
WP_002341590.1\|888434_889388_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002350806.1\|891064_892096_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002348889.1\|892288_893464_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.0e-17	32.9
WP_002293405.1\|893467_894109_+	ABC transporter permease	NA	NA	NA	NA
WP_002301114.1\|894105_895023_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002301116.1\|895019_895691_+	ABC transporter permease	NA	NA	NA	NA
WP_002301121.1\|896921_897188_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002294199.1\|897187_897451_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002348885.1\|897925_898111_+	hypothetical protein	NA	NA	NA	NA
WP_002294202.1\|898252_900076_-	APC family permease	NA	NA	NA	NA
WP_002294203.1\|900672_903378_-	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_002301399.1\|903603_904563_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_016171130.1\|904829_906125_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	1.1e-09	21.2
WP_002294206.1\|906270_907218_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_002293413.1\|907407_907677_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002289874.1\|907852_908215_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	7.6e-09	37.8
WP_002294207.1\|908225_909347_-	alanine racemase	NA	NA	NA	NA
WP_002294209.1\|909362_909713_-	holo-ACP synthase	NA	NA	NA	NA
WP_086272912.1\|909842_911360_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.3e-62	36.2
WP_002317074.1\|911675_913028_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_102642282.1\|913180_914257_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_002329999.1\|914452_916198_+	AarF/ABC1/UbiB kinase family protein	M4R0M8	Ostreococcus_lucimarinus_virus	1.3e-40	28.1
WP_002294214.1\|916446_916914_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_002294217.1\|916897_918271_-	hypothetical protein	NA	NA	NA	NA
WP_002296548.1\|918591_919080_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002294220.1\|919101_919704_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	3.6e-19	30.6
WP_086953915.1\|919772_921112_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002289751.1\|921626_922256_-	uridine kinase	A0A1V0SAA3	Catovirus	3.1e-34	40.2
WP_002289749.1\|922339_923035_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_002348768.1\|923047_923764_-	pseudouridine synthase	NA	NA	NA	NA
WP_002299254.1\|924093_924702_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_002289744.1\|925026_925350_+	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002289277.1\|925531_926902_+	MATE family efflux transporter	NA	NA	NA	NA
WP_010782510.1\|927248_928427_+\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	3.8e-65	39.9
WP_002326809.1\|928494_929790_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002294228.1\|930165_931467_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002289279.1\|931820_933812_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	8.4e-65	33.9
WP_002289280.1\|933955_934222_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002297086.1\|934731_936858_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_002289282.1\|937045_937315_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_002289284.1\|937565_938129_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.3e-12	37.1
WP_002294232.1\|938381_938903_-	transcription repressor NadR	NA	NA	NA	NA
WP_002301156.1\|938905_939748_-	chorismate mutase	NA	NA	NA	NA
WP_002294236.1\|939740_940466_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_002293448.1\|940641_940938_+	hypothetical protein	NA	NA	NA	NA
WP_002297081.1\|941505_943098_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002294240.1\|943110_943851_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-30	39.7
WP_002294242.1\|944018_945368_+	amino acid permease	NA	NA	NA	NA
WP_002297079.1\|945495_946086_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_002294246.1\|946232_947585_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_002289815.1\|948384_948759_-	hypothetical protein	NA	NA	NA	NA
WP_002294249.1\|948875_949358_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_002341570.1\|949409_949988_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_002289812.1\|950016_951018_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-07	25.8
WP_002290528.1\|951030_951633_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_002294252.1\|951802_952249_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_002294254.1\|952325_953039_-	trehalose operon repressor	A0A291LID1	Streptomyces_phage	1.2e-05	39.7
WP_002348864.1\|953261_955250_+	PTS system trehalose-specific EIIBC component	NA	NA	NA	NA
WP_002296127.1\|955329_956877_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002287659.1\|956978_957332_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|957321_957516_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|957775_959071_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002348596.1\|959209_959770_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_002301736.1\|959791_961900_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.8e-57	41.1
WP_002294258.1\|961917_964563_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.6e-39	26.1
WP_002297923.1\|964546_964960_-	hypothetical protein	NA	NA	NA	NA
WP_002348595.1\|964937_965735_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_002294261.1\|966142_966916_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002294262.1\|966935_967571_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_002324284.1\|967598_968396_-	formate/nitrite transporter	NA	NA	NA	NA
WP_002294265.1\|968711_969323_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_002294267.1\|969462_970002_+	biotin transporter BioY	NA	NA	NA	NA
WP_002294268.1\|970071_970581_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	7.5e-10	31.8
WP_002297929.1\|970961_971723_-	3-oxoacyl-ACP reductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-16	31.7
WP_002290506.1\|971719_971941_-	DUF2829 domain-containing protein	A0A0S2MV93	Bacillus_phage	1.1e-05	33.3
WP_002348592.1\|971930_973544_-	M protein trans-acting positive regulator	NA	NA	NA	NA
WP_002294273.1\|973543_974245_-	LrgB family protein	NA	NA	NA	NA
WP_002301190.1\|974237_974648_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_002348590.1\|974973_975708_+	aquaporin family protein	NA	NA	NA	NA
WP_010782508.1\|975753_977199_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	2.2e-123	47.8
WP_010782507.1\|977456_978416_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002348747.1\|978648_979548_-	metallophosphoesterase	NA	NA	NA	NA
WP_002287910.1\|979557_979914_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002287909.1\|980269_980566_+\|tRNA	phenylalanyl-tRNA synthetase subunit alpha	NA	NA	NA	NA
WP_002301160.1\|981209_982163_-	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002301162.1\|982185_982941_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	2.2e-13	28.1
WP_002301163.1\|982937_983897_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_002294286.1\|983889_984840_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.6e-66	40.5
WP_002294287.1\|984989_985442_+	YueI family protein	NA	NA	NA	NA
WP_002326066.1\|985459_986413_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002294288.1\|986596_988864_-	bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB	NA	NA	NA	NA
WP_002301165.1\|989050_990049_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_002348798.1\|990060_990870_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002301166.1\|990878_994460_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_002287896.1\|994479_995166_-	ribonuclease III	K7YH73	Megavirus	9.1e-27	32.3
WP_002287894.1\|995513_997295_-	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002287893.1\|997320_998235_-	ABC transporter permease	NA	NA	NA	NA
WP_002287892.1\|998261_999224_-	ABC transporter permease	NA	NA	NA	NA
WP_002287891.1\|999223_1000168_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-20	35.1
WP_002287889.1\|1000168_1001173_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-18	32.2
WP_002294295.1\|1001440_1001683_-	acyl carrier protein	NA	NA	NA	NA
WP_002289721.1\|1001804_1002806_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_002301167.1\|1002854_1004891_-	ATP-dependent DNA helicase RecG	A0A2H4JBQ0	uncultured_Caudovirales_phage	5.3e-06	22.9
WP_002301169.1\|1005007_1006690_-	DAK2 domain-containing protein	NA	NA	NA	NA
WP_002294298.1\|1006741_1007104_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002290463.1\|1007373_1007562_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_002294300.1\|1007799_1010469_+	YfhO family protein	NA	NA	NA	NA
WP_002317547.1\|1010559_1011180_-	AAA family ATPase	NA	NA	NA	NA
WP_002348801.1\|1011291_1011693_+	hypothetical protein	NA	NA	NA	NA
WP_002317041.1\|1011827_1012166_+	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_002326711.1\|1012510_1013689_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002301399.1\|1014063_1015023_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002298563.1\|1015695_1016442_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002297218.1\|1016639_1017935_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_6

1173834 : 1212611

Streptococcus_phage(22.22%)

transposase,integrase

attL 1202240:1202255|attR 1214376:1214391

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002318021.1\|1173834_1175001_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	3.3e-45	34.0
WP_002322813.1\|1175055_1175706_-	helix-turn-helix transcriptional regulator	Q20DG0	Lactobacillus_phage	3.2e-05	33.3
WP_002348874.1\|1175780_1175984_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002321715.1\|1175991_1176318_+	hypothetical protein	NA	NA	NA	NA
WP_002348875.1\|1176472_1177516_+	replication initiator protein A	NA	NA	NA	NA
WP_002348876.1\|1177517_1177736_+	hypothetical protein	NA	NA	NA	NA
WP_016252733.1\|1177722_1180368_+	hypothetical protein	NA	NA	NA	NA
WP_002322855.1\|1180381_1180570_+	hypothetical protein	NA	NA	NA	NA
WP_002348879.1\|1180581_1181193_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_002348880.1\|1181177_1182569_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_002322858.1\|1182784_1183087_+	hypothetical protein	NA	NA	NA	NA
WP_002348881.1\|1183079_1183427_+	hypothetical protein	NA	NA	NA	NA
WP_010782540.1\|1183486_1184761_-\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	6.6e-55	36.1
WP_002322860.1\|1185217_1185532_+	hypothetical protein	NA	NA	NA	NA
WP_002322861.1\|1185630_1185879_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002322862.1\|1186107_1186881_-	hypothetical protein	NA	NA	NA	NA
WP_002348835.1\|1186985_1187231_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002348834.1\|1187606_1188086_+	DUF3841 domain-containing protein	NA	NA	NA	NA
WP_002350767.1\|1188263_1189760_+	RNA-directed DNA polymerase	Q2P9X6	Enterobacteria_phage	8.5e-70	34.3
WP_002322866.1\|1189905_1190220_+	ATP-binding protein	NA	NA	NA	NA
WP_002322867.1\|1190335_1191595_+	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_002322868.1\|1191606_1192065_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002348831.1\|1192139_1192919_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002322870.1\|1193167_1194715_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002322871.1\|1194735_1196115_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_076005180.1\|1196155_1197619_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	2.2e-123	47.8
WP_002298774.1\|1197825_1198800_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002312606.1\|1198781_1199243_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002298777.1\|1199292_1199757_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002298779.1\|1199770_1200520_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298780.1\|1200519_1201350_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002322873.1\|1201349_1201997_+	HAD family phosphatase	M1I5S4	Acanthocystis_turfacea_Chlorella_virus	4.5e-12	27.4
WP_002298782.1\|1202094_1202871_-	GntR family transcriptional regulator	NA	NA	NA	NA
1202240:1202255	attL	NA	NA	NA	NA
WP_002364278.1\|1204420_1204831_+	hypothetical protein	NA	NA	NA	NA
WP_002348684.1\|1204911_1205532_+	hypothetical protein	NA	NA	NA	NA
WP_002297291.1\|1205861_1207088_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_002320809.1\|1207159_1207318_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297292.1\|1208005_1208746_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.7e-19	33.2
WP_002297293.1\|1208837_1210025_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002297294.1\|1210346_1211189_+	metal ABC transporter permease	NA	NA	NA	NA
WP_002323589.1\|1211462_1212611_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
1214376:1214391	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1262580 : 1271612

Streptococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297353.1\|1262580_1263765_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002297354.1\|1264023_1264314_-	hypothetical protein	NA	NA	NA	NA
WP_002297358.1\|1265678_1266353_-	AAA family ATPase	NA	NA	NA	NA
WP_002297360.1\|1266430_1266670_-	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	2.1e-23	80.3
WP_002297361.1\|1266763_1268623_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0
WP_002343904.1\|1269337_1270483_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	6.0e-132	62.8
WP_002311649.1\|1270565_1270910_-	hypothetical protein	NA	NA	NA	NA
WP_002297365.1\|1270910_1271285_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002297366.1\|1271297_1271612_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4

DBSCAN-SWA_8

1354142 : 1477351

Bacillus_phage(21.43%)

transposase,protease,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287372.1\|1354142_1355081_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	5.2e-09	29.7
WP_002287374.1\|1355080_1356439_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_002287376.1\|1356451_1357192_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_002287377.1\|1357188_1359258_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.5e-21	30.3
WP_002287379.1\|1359422_1360322_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_002287380.1\|1360334_1360985_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002287382.1\|1360985_1361624_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_002296044.1\|1361778_1362633_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002287385.1\|1362636_1363146_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_002322795.1\|1363400_1364939_+	hypothetical protein	B5LJD6	Mycobacterium_phage	2.3e-17	50.5
WP_002297218.1\|1365071_1366367_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002322796.1\|1366528_1368328_-	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_002287389.1\|1368450_1368957_+	membrane protein	NA	NA	NA	NA
WP_002287391.1\|1369035_1369758_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002287397.1\|1369835_1371236_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_002287399.1\|1371405_1372380_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_002287401.1\|1372732_1373293_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_002287403.1\|1373309_1376831_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_002287405.1\|1376845_1378441_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002287407.1\|1378451_1378721_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002287409.1\|1378787_1379213_+	septum formation initiator family protein	NA	NA	NA	NA
WP_002287412.1\|1379258_1379729_+	RNA-binding protein S1	NA	NA	NA	NA
WP_002287414.1\|1379848_1381294_+\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
WP_002287415.1\|1381293_1381839_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
WP_002287418.1\|1381928_1384040_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
WP_002296053.1\|1384256_1385144_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002290055.1\|1385144_1386149_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_002296055.1\|1386259_1387756_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.7e-91	40.9
WP_002297218.1\|1395941_1397237_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002289731.1\|1397591_1398785_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
WP_002295566.1\|1398914_1400387_+	MFS transporter	NA	NA	NA	NA
WP_002295567.1\|1400469_1401258_+	esterase family protein	NA	NA	NA	NA
WP_002285876.1\|1401324_1401993_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_002285883.1\|1402107_1403820_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002301355.1\|1403822_1405595_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-54	29.4
WP_086953915.1\|1405720_1407059_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_000997695.1\|1407930_1409109_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002341521.1\|1409206_1409563_-	hypothetical protein	U4KJ82	Streptococcus_phage	9.2e-15	42.2
WP_002304713.1\|1409634_1410567_-	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.8e-57	53.8
WP_002301399.1\|1410769_1411729_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002301818.1\|1411861_1412068_+\|holin	holin	NA	NA	NA	NA
WP_002303477.1\|1412078_1413098_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_025479400.1\|1413872_1414175_-	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|1414271_1415459_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_076005178.1\|1415651_1415843_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1415866_1417045_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002285906.1\|1417663_1418230_-	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
WP_002285909.1\|1418229_1419186_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
WP_002285911.1\|1419185_1419842_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002301403.1\|1420211_1422230_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
WP_002285916.1\|1422656_1425071_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
WP_002285917.1\|1425418_1426972_+	glycosyl hydrolase	NA	NA	NA	NA
WP_002285918.1\|1427352_1429137_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-46	28.2
WP_002285920.1\|1429151_1430873_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-37	28.0
WP_002303189.1\|1430972_1431734_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002348774.1\|1432443_1433763_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.3e-210	82.7
WP_002285924.1\|1435324_1438396_+	hypothetical protein	NA	NA	NA	NA
WP_002285926.1\|1438533_1439562_+	collagen binding domain-containing protein	NA	NA	NA	NA
WP_104674935.1\|1439985_1440156_-	hypothetical protein	NA	NA	NA	NA
WP_002285932.1\|1440349_1440529_-\|transposase	transposase	NA	NA	NA	NA
WP_002297280.1\|1440538_1440763_-	hypothetical protein	NA	NA	NA	NA
WP_002321621.1\|1440915_1442028_+	FUSC family protein	NA	NA	NA	NA
WP_002285944.1\|1442105_1442399_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_002285948.1\|1442566_1442881_+	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_002285949.1\|1442901_1444881_+	BglG family transcription antiterminator	NA	NA	NA	NA
WP_002285954.1\|1444893_1445220_+	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002285960.1\|1445235_1445754_+	hypothetical protein	NA	NA	NA	NA
WP_002285961.1\|1445753_1447106_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_002285962.1\|1447189_1448695_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
WP_002285964.1\|1448786_1449377_-	transporter	NA	NA	NA	NA
WP_002304848.1\|1449555_1451202_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002285969.1\|1451250_1451970_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_002285971.1\|1452448_1453396_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002285972.1\|1453407_1454328_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002285974.1\|1454368_1455826_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010782528.1\|1456170_1456785_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002285976.1\|1456777_1458502_+	sensor histidine kinase	NA	NA	NA	NA
WP_002304851.1\|1458498_1459950_+	response regulator transcription factor	NA	NA	NA	NA
WP_002285980.1\|1460422_1462576_-	alpha-1,2-mannosidase	NA	NA	NA	NA
WP_002302559.1\|1462577_1463624_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002294491.1\|1463773_1465063_+	glycoside hydrolase family 125 protein	NA	NA	NA	NA
WP_002285985.1\|1465075_1467778_+	alpha-mannosidase	NA	NA	NA	NA
WP_002285988.1\|1467762_1468620_+	ROK family protein	NA	NA	NA	NA
WP_002285989.1\|1468690_1469548_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002294492.1\|1469758_1471930_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_002285994.1\|1471997_1472339_+	YlbF family regulator	A0A1X9I5Y8	Streptococcus_phage	1.3e-10	34.9
WP_002302556.1\|1472614_1474369_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-39	26.9
WP_002285996.1\|1474379_1475216_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_002294493.1\|1475217_1475901_-	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
WP_002297218.1\|1476055_1477351_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_9

1789351 : 1838063

Enterococcus_phage(26.09%)

tRNA,tail,transposase,terminase,head,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086956687.1\|1789351_1790514_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002287966.1\|1790722_1791097_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002348865.1\|1791210_1791840_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294080.1\|1792929_1794258_+	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	7.3e-73	38.1
WP_002287963.1\|1794459_1795293_+	phosphotransferase	NA	NA	NA	NA
WP_002287962.1\|1795308_1796046_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_002287961.1\|1796200_1797169_-	asparaginase	NA	NA	NA	NA
WP_002287960.1\|1797400_1798234_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_002287959.1\|1798267_1799107_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002287958.1\|1799132_1799693_+	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	2.3e-28	45.1
WP_002287957.1\|1799891_1801613_+	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_002287956.1\|1801777_1802920_+	cysteine desulfurase	NA	NA	NA	NA
WP_002287955.1\|1802935_1804147_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_002287954.1\|1804719_1805367_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287953.1\|1805759_1808405_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002294071.1\|1808714_1810028_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287951.1\|1810017_1810671_+	HAD family phosphatase	NA	NA	NA	NA
WP_002304462.1\|1810725_1811397_+	DNA repair protein RadC	NA	NA	NA	NA
WP_002303263.1\|1811291_1812644_-	recombinase family protein	D2IZV7	Enterococcus_phage	1.7e-133	55.3
WP_002303264.1\|1812709_1813999_-	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	5.6e-46	74.0
WP_002303265.1\|1814085_1814790_-	LexA family transcriptional regulator	D7RWF2	Brochothrix_phage	6.2e-39	42.4
WP_002303266.1\|1814989_1815256_+	helix-turn-helix transcriptional regulator	A0A1W6JP54	Staphylococcus_phage	5.4e-12	52.7
WP_002304464.1\|1815423_1815654_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	4.4e-10	49.3
WP_002299038.1\|1815725_1815881_+	hypothetical protein	NA	NA	NA	NA
WP_002304466.1\|1816189_1816429_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.8e-27	81.1
WP_002303273.1\|1816680_1817016_+	hypothetical protein	NA	NA	NA	NA
WP_002303275.1\|1817248_1818190_+	endonuclease	D2IZK1	Enterococcus_phage	2.7e-146	78.9
WP_002303277.1\|1818191_1819082_+	hypothetical protein	D2IYT9	Enterococcus_phage	6.2e-137	84.5
WP_002303278.1\|1819124_1819925_+	hypothetical protein	B4XYS6	Lactobacillus_phage	8.9e-58	54.5
WP_002304468.1\|1819939_1820791_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	3.0e-27	30.2
WP_002304469.1\|1820787_1821147_+	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	6.8e-18	47.5
WP_002292988.1\|1821161_1821323_+	hypothetical protein	NA	NA	NA	NA
WP_002350868.1\|1821319_1821646_+	hypothetical protein	NA	NA	NA	NA
WP_002304472.1\|1821642_1822458_+	prohibitin family protein	A0A288TXV9	Enterococcus_phage	1.8e-82	69.4
WP_002304473.1\|1822596_1822908_+	hypothetical protein	A0A0D3MVS9	Staphylococcus_phage	5.3e-27	58.0
WP_002304474.1\|1822904_1823135_+	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	8.8e-11	50.7
WP_002304475.1\|1823141_1823345_+	hypothetical protein	NA	NA	NA	NA
WP_002286693.1\|1823341_1823638_+	hypothetical protein	NA	NA	NA	NA
WP_002322045.1\|1823714_1824128_+	autolysin	C9E2P5	Enterococcus_phage	2.5e-56	80.3
WP_002304480.1\|1824140_1824527_+	hypothetical protein	O34053	Streptococcus_phage	1.9e-29	55.2
WP_002311618.1\|1825077_1825302_+	hypothetical protein	NA	NA	NA	NA
WP_002304484.1\|1825319_1825748_+	hypothetical protein	A0A1P8BMH5	Lactococcus_phage	2.6e-40	63.1
WP_002304486.1\|1825725_1827144_+\|terminase	phage terminase large subunit	A0A090EUA8	Clostridium_phage	2.5e-124	51.5
WP_002343932.1\|1827155_1828691_+\|portal	phage portal protein	NA	NA	NA	NA
WP_033582200.1\|1828770_1829649_+\|head	phage head morphogenesis protein	NA	NA	NA	NA
WP_002304492.1\|1829650_1829968_+	hypothetical protein	NA	NA	NA	NA
WP_002350777.1\|1830016_1830718_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_002312521.1\|1830732_1831623_+	DUF5309 domain-containing protein	NA	NA	NA	NA
WP_002311614.1\|1831645_1831861_+	hypothetical protein	NA	NA	NA	NA
WP_002298050.1\|1831872_1832214_+	hypothetical protein	NA	NA	NA	NA
WP_002298048.1\|1832213_1832585_+	hypothetical protein	NA	NA	NA	NA
WP_002298046.1\|1832577_1832973_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002298045.1\|1832974_1833352_+	hypothetical protein	NA	NA	NA	NA
WP_002303295.1\|1833352_1833961_+\|tail	tail protein	NA	NA	NA	NA
WP_002303297.1\|1833960_1834302_+	hypothetical protein	NA	NA	NA	NA
WP_002305859.1\|1834543_1837333_+	tape measure protein	D7RWD8	Brochothrix_phage	8.4e-71	40.2
WP_002303299.1\|1837322_1838063_+\|tail	tail protein	NA	NA	NA	NA

DBSCAN-SWA_10

2038333 : 2226848

170

Streptococcus_phage(25.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002305598.1\|2038333_2039251_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_002348661.1\|2039252_2041328_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_002348662.1\|2041707_2042487_+	hypothetical protein	NA	NA	NA	NA
WP_002296209.1\|2042532_2043477_+	transcriptional regulator	NA	NA	NA	NA
WP_002348663.1\|2043492_2044272_+	tyrosine protein kinase	NA	NA	NA	NA
WP_002348664.1\|2044283_2044982_+	CpsD/CapB family tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	6.0e-26	37.1
WP_002312256.1\|2045009_2045774_+	hypothetical protein	NA	NA	NA	NA
WP_002312258.1\|2046094_2047546_+	sugar transferase	NA	NA	NA	NA
WP_002312259.1\|2047923_2049174_+	nucleotide sugar dehydrogenase	M1IB49	Acanthocystis_turfacea_Chlorella_virus	8.9e-105	50.4
WP_002325817.1\|2049187_2049649_+	hypothetical protein	NA	NA	NA	NA
WP_002291721.1\|2049665_2050145_+	EpsH	NA	NA	NA	NA
WP_002312264.1\|2050164_2051232_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002312270.1\|2051799_2052861_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.5e-12	36.5
WP_002312275.1\|2055099_2055819_+	glycosyl transferase	A0A2K9L639	Tupanvirus	2.6e-08	25.0
WP_002312276.1\|2055833_2056919_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002348669.1\|2057054_2058587_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002312280.1\|2058764_2058986_+	transferase	NA	NA	NA	NA
WP_002312281.1\|2059567_2060185_+	VanZ family protein	NA	NA	NA	NA
WP_002312282.1\|2060181_2060712_+	hypothetical protein	NA	NA	NA	NA
WP_010782560.1\|2061577_2062537_-\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002312284.1\|2063341_2063542_+	hypothetical protein	NA	NA	NA	NA
WP_002312285.1\|2063720_2064671_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_002289551.1\|2065108_2065384_-	acylphosphatase	NA	NA	NA	NA
WP_002294889.1\|2065491_2066256_+	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002348853.1\|2066378_2066882_+	HD domain-containing protein	NA	NA	NA	NA
WP_002289547.1\|2068098_2069367_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.2e-42	31.1
WP_002340453.1\|2069393_2070593_-	YdcF family protein	NA	NA	NA	NA
WP_002304680.1\|2070711_2072019_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002288760.1\|2072489_2073608_+	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|2074059_2075355_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002323868.1\|2075632_2075953_+	hypothetical protein	NA	NA	NA	NA
WP_002288762.1\|2076404_2076605_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002304681.1\|2076751_2079541_+	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
WP_002348809.1\|2079587_2080115_+	DUF5590 domain-containg protein	NA	NA	NA	NA
WP_002304682.1\|2080135_2081326_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002288767.1\|2081365_2082664_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002304684.1\|2083716_2084391_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002326717.1\|2084387_2084729_+	hypothetical protein	NA	NA	NA	NA
WP_002288776.1\|2084758_2085118_+	YccF domain-containing protein	NA	NA	NA	NA
WP_002304688.1\|2085641_2087723_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-115	35.6
WP_002288779.1\|2088033_2089500_+	amino acid permease	NA	NA	NA	NA
WP_002304690.1\|2090114_2090654_+	topology modulation protein	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002294855.1\|2090727_2091168_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002289040.1\|2091180_2091390_+	copper chaperone CopZ	NA	NA	NA	NA
WP_002312937.1\|2091389_2093576_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.3e-121	38.6
WP_002299539.1\|2093595_2095767_+	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3
WP_002304699.1\|2099561_2100503_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002304700.1\|2100647_2101496_-	MoxR family ATPase	NA	NA	NA	NA
WP_002294839.1\|2101849_2102662_+	hypothetical protein	NA	NA	NA	NA
WP_002304701.1\|2102815_2103139_+	hypothetical protein	NA	NA	NA	NA
WP_002294835.1\|2103212_2103782_+	prevent-host-death protein	NA	NA	NA	NA
WP_002301695.1\|2104218_2104911_+	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.0e-30	43.4
WP_099745852.1\|2104950_2106290_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	3.4e-78	52.7
WP_099098442.1\|2106394_2107556_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_002295743.1\|2107858_2108767_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002326711.1\|2108928_2110107_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_008266934.1\|2110363_2110777_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002295273.1\|2111008_2111266_-	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|2111551_2112802_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002301623.1\|2113211_2114186_+	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	7.1e-25	31.8
WP_002301399.1\|2114308_2115268_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002326708.1\|2116009_2116327_+	SdpI family protein	NA	NA	NA	NA
WP_002289810.1\|2116417_2116783_-	hypothetical protein	NA	NA	NA	NA
WP_002300070.1\|2116990_2117473_+	hypothetical protein	NA	NA	NA	NA
WP_002289807.1\|2117669_2118560_+	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002326707.1\|2118846_2120121_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.5e-54	35.9
WP_002297196.1\|2120393_2122865_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_002303966.1\|2122967_2124704_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002293705.1\|2124700_2125405_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297194.1\|2125535_2126039_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293708.1\|2125998_2126337_+	putative DNA-binding protein	NA	NA	NA	NA
WP_002293709.1\|2126357_2127776_+	signal recognition particle protein	NA	NA	NA	NA
WP_002293710.1\|2127887_2128466_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002297192.1\|2128469_2128991_+	dihydrofolate reductase	NA	NA	NA	NA
WP_002293714.1\|2129069_2129624_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002290274.1\|2129876_2130152_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_002290277.1\|2130163_2130415_+	KH domain-containing protein	NA	NA	NA	NA
WP_002297190.1\|2130539_2131331_+	hypothetical protein	NA	NA	NA	NA
WP_002293716.1\|2131500_2132022_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002293717.1\|2132011_2132773_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002286913.1\|2132908_2133256_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_002288970.1\|2133513_2133807_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002296840.1\|2134664_2135852_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002303963.1\|2136123_2138451_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_025477176.1\|2138576_2138906_+	hypothetical protein	NA	NA	NA	NA
WP_157999241.1\|2138945_2139950_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002288982.1\|2141581_2142754_+	class C sortase	NA	NA	NA	NA
WP_002303955.1\|2142915_2143371_-	hypothetical protein	NA	NA	NA	NA
WP_002288984.1\|2143959_2144382_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002322902.1\|2144547_2145741_-	MFS transporter	NA	NA	NA	NA
WP_002302962.1\|2145964_2146342_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002321036.1\|2146329_2146668_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288989.1\|2146801_2147245_+	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002303949.1\|2147506_2148322_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002300930.1\|2148331_2148994_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002289620.1\|2149198_2150863_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002289619.1\|2150875_2151586_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289618.1\|2151715_2152213_+	GAF domain-containing protein	NA	NA	NA	NA
WP_002289617.1\|2152397_2152658_+	hypothetical protein	NA	NA	NA	NA
WP_002321266.1\|2153019_2153259_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|2153595_2154774_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002302293.1\|2155212_2155515_-	hypothetical protein	NA	NA	NA	NA
WP_002288592.1\|2156271_2157045_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002288595.1\|2157188_2157539_+	SdpI family protein	NA	NA	NA	NA
WP_002288590.1\|2157519_2158236_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288588.1\|2158235_2159684_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288586.1\|2159753_2160263_-	hypothetical protein	NA	NA	NA	NA
WP_002296838.1\|2160252_2160978_-	hypothetical protein	NA	NA	NA	NA
WP_002303943.1\|2161200_2163321_-	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002288581.1\|2163550_2164729_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002288579.1\|2164744_2165503_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288577.1\|2165525_2166011_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288576.1\|2166081_2167335_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288575.1\|2167451_2168801_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288574.1\|2168912_2170259_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_000122610.1\|2170477_2171770_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002288573.1\|2172073_2172460_-	YxeA family protein	NA	NA	NA	NA
WP_002326704.1\|2172508_2173417_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002311774.1\|2173629_2174589_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002297633.1\|2175452_2175665_+	hypothetical protein	NA	NA	NA	NA
WP_002287775.1\|2175942_2177742_-	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002287776.1\|2177865_2178462_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002301399.1\|2178651_2179611_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002296337.1\|2179876_2180221_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002296335.1\|2180732_2181083_-	hypothetical protein	NA	NA	NA	NA
WP_002348678.1\|2181048_2182380_-	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296332.1\|2182634_2183201_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002303934.1\|2183766_2184741_+	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002288533.1\|2185065_2186961_+	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002288531.1\|2187155_2187602_-	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002296119.1\|2187829_2187979_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002296121.1\|2188066_2188585_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_010782564.1\|2188661_2189618_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293905.1\|2189783_2190590_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293904.1\|2190586_2191576_+	iron ABC transporter permease	NA	NA	NA	NA
WP_002301321.1\|2191572_2192577_+	iron ABC transporter permease	NA	NA	NA	NA
WP_002289886.1\|2192708_2193251_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002289885.1\|2193270_2193969_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002293902.1\|2193989_2194202_+	YqgQ family protein	NA	NA	NA	NA
WP_002288462.1\|2194201_2195164_+	ROK family glucokinase	NA	NA	NA	NA
WP_002288461.1\|2195181_2195577_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288459.1\|2195739_2196105_+	DUF488 family protein	NA	NA	NA	NA
WP_002288458.1\|2196101_2197913_+	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288457.1\|2197974_2198142_-	DUF3042 family protein	NA	NA	NA	NA
WP_002288452.1\|2198389_2199379_+	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288451.1\|2199390_2200875_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288449.1\|2200898_2201879_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288447.1\|2201967_2202792_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002348676.1\|2202775_2203318_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288445.1\|2203324_2203789_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002301319.1\|2203785_2204802_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002326809.1\|2205465_2206761_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002288442.1\|2206932_2207634_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002288439.1\|2208094_2209324_+	arginine deiminase	NA	NA	NA	NA
WP_002288437.1\|2209414_2210434_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288434.1\|2210548_2211496_+	carbamate kinase	NA	NA	NA	NA
WP_002288432.1\|2211915_2213607_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288430.1\|2214059_2214605_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002326699.1\|2214608_2214737_-	hypothetical protein	NA	NA	NA	NA
WP_002326698.1\|2214729_2215821_-	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002293881.1\|2216037_2216517_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002293880.1\|2216875_2217658_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293878.1\|2217756_2218638_+	elongation factor Ts	NA	NA	NA	NA
WP_002293877.1\|2218773_2219496_+	UMP kinase	NA	NA	NA	NA
WP_002293875.1\|2219498_2220056_+	ribosome recycling factor	NA	NA	NA	NA
WP_002287107.1\|2220373_2221624_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002294134.1\|2222032_2222845_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002294135.1\|2222841_2223642_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294136.1\|2223802_2225071_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294137.1\|2225138_2226848_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_11

2361195 : 2410058

Streptococcus_phage(23.08%)

transposase,integrase,protease,tRNA

attL 2361070:2361087|attR 2394228:2394245

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2361070:2361087	attL	NA	NA	NA	NA
WP_002288335.1\|2361195_2361897_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002288338.1\|2361893_2363015_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_002288340.1\|2363029_2364262_+	peptidase T	NA	NA	NA	NA
WP_002288343.1\|2364393_2365302_+	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_002305633.1\|2365336_2365609_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_002288347.1\|2365619_2366666_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_002301554.1\|2366916_2369526_+	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.6e-132	35.0
WP_002288350.1\|2369676_2370348_-	hypothetical protein	NA	NA	NA	NA
WP_002288352.1\|2370340_2370835_-	nucleoside deoxyribosyltransferase	A0A1W6JK28	Lactococcus_phage	7.2e-42	56.5
WP_002288353.1\|2370854_2372075_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002288355.1\|2372221_2374057_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.4e-20	24.4
WP_002288357.1\|2374150_2375278_-\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_000222572.1\|2375334_2376288_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|2376443_2377622_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321532.1\|2377867_2378158_-	hypothetical protein	NA	NA	NA	NA
WP_002322258.1\|2378275_2378536_-	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|2378672_2379086_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002303864.1\|2379541_2380027_-	hypothetical protein	NA	NA	NA	NA
WP_002305631.1\|2380165_2380411_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|2380603_2381404_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002348791.1\|2381422_2383291_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002289422.1\|2383283_2383775_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289423.1\|2383762_2384317_+	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289425.1\|2384334_2385330_+	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002287107.1\|2385471_2386722_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296624.1\|2387130_2387529_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002311093.1\|2387512_2388208_+	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296627.1\|2388791_2389679_-	rotamase	NA	NA	NA	NA
WP_002296628.1\|2389863_2390703_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296629.1\|2390898_2391873_+	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002296631.1\|2392170_2392527_+	hypothetical protein	NA	NA	NA	NA
WP_002296632.1\|2392529_2393687_+	hypothetical protein	NA	NA	NA	NA
WP_002296633.1\|2393712_2394153_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296634.1\|2394312_2394819_+	cysteine hydrolase	NA	NA	NA	NA
2394228:2394245	attR	NA	NA	NA	NA
WP_002311095.1\|2394986_2396900_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_002296637.1\|2396904_2397906_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002296638.1\|2398107_2398314_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296639.1\|2398959_2399808_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296640.1\|2399970_2400873_+	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
WP_002296641.1\|2400874_2401876_+	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_002321677.1\|2401872_2402157_+	alcohol dehydrogenase	NA	NA	NA	NA
WP_002303106.1\|2402189_2402987_+	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002296646.1\|2403000_2403834_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303107.1\|2403851_2404709_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002296648.1\|2404730_2405240_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002296650.1\|2405276_2405678_+	hypothetical protein	NA	NA	NA	NA
WP_002321678.1\|2405789_2406143_+	hypothetical protein	NA	NA	NA	NA
WP_002296653.1\|2406176_2406620_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002296654.1\|2406636_2407722_+	mannonate dehydratase	NA	NA	NA	NA
WP_002296656.1\|2407714_2408428_+	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002302440.1\|2408756_2410058_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6

DBSCAN-SWA_12

2706847 : 2715908

Synechococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288010.1\|2706847_2707426_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4
WP_002321731.1\|2707422_2708466_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288013.1\|2708497_2709937_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288015.1\|2709921_2712144_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288017.1\|2712144_2712816_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002295474.1\|2712817_2713072_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288021.1\|2713071_2713800_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002297115.1\|2714055_2714433_+	hypothetical protein	NA	NA	NA	NA
WP_002288023.1\|2714612_2715908_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1

DBSCAN-SWA_13

2743777 : 2804784

Bacillus_virus(12.5%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|2743777_2745073_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002347134.1\|2745061_2745544_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|2745703_2746882_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295437.1\|2748005_2748296_-	hypothetical protein	NA	NA	NA	NA
WP_002326685.1\|2749589_2750213_+	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	3.9e-37	56.4
WP_002297012.1\|2750296_2751019_-	TatD family hydrolase	NA	NA	NA	NA
WP_002297010.1\|2751008_2751746_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_002297008.1\|2751757_2752750_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297003.1\|2752764_2753508_-	ABC transporter permease	NA	NA	NA	NA
WP_002289757.1\|2753748_2755071_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002289763.1\|2755057_2756023_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-27	36.9
WP_002289765.1\|2756019_2757558_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_002289767.1\|2757973_2758261_-	hypothetical protein	NA	NA	NA	NA
WP_002297002.1\|2758394_2759063_+	membrane protein	NA	NA	NA	NA
WP_002285758.1\|2759328_2759523_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|2759512_2759866_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002303202.1\|2759967_2761515_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002289257.1\|2761706_2762447_-	hypothetical protein	NA	NA	NA	NA
WP_002289258.1\|2762576_2763524_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002289259.1\|2763652_2764417_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002297001.1\|2764420_2764810_-	hypothetical protein	NA	NA	NA	NA
WP_002289260.1\|2764944_2765487_+	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_002289266.1\|2765634_2766267_+	hypothetical protein	NA	NA	NA	NA
WP_002296999.1\|2766400_2766526_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289262.1\|2766659_2767553_-	DUF1803 domain-containing protein	NA	NA	NA	NA
WP_002289263.1\|2767734_2768661_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_002289264.1\|2768745_2769507_-	pyruvate formate lyase-activating protein	NA	NA	NA	NA
WP_002289265.1\|2769750_2771982_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.4e-169	42.5
WP_002303213.1\|2772258_2774709_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	9.2e-98	31.6
WP_002303746.1\|2774720_2776766_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.4e-115	41.3
WP_002296996.1\|2776931_2777366_-	CoA-binding protein	NA	NA	NA	NA
WP_002296995.1\|2777492_2778131_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_002297218.1\|2778311_2779607_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002296994.1\|2779784_2780660_-	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_002290223.1\|2780741_2781533_-	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_002288421.1\|2781550_2782951_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.7e-43	28.8
WP_002288419.1\|2782964_2783513_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_002288415.1\|2783549_2784455_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	9.4e-32	29.4
WP_002320953.1\|2784652_2786029_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_002288411.1\|2785997_2788076_-	type I DNA topoisomerase	A0A167R9A0	Powai_lake_megavirus	1.2e-101	38.5
WP_002303743.1\|2788197_2789055_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_002296990.1\|2789110_2789878_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	2.7e-27	39.5
WP_002296988.1\|2789870_2790731_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_002288405.1\|2790990_2791389_+	glyoxalase	NA	NA	NA	NA
WP_002288403.1\|2791625_2792168_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_002294418.1\|2792250_2792802_-	signal peptidase I	NA	NA	NA	NA
WP_002288398.1\|2792953_2793181_-	YozE family protein	NA	NA	NA	NA
WP_002288397.1\|2793177_2793696_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002288396.1\|2793715_2794429_-	YpmS family protein	NA	NA	NA	NA
WP_002288395.1\|2794431_2795328_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002288394.1\|2795485_2796328_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.5e-19	40.2
WP_002288393.1\|2796459_2797113_+	hemolysin III family protein	NA	NA	NA	NA
WP_002288392.1\|2797175_2797703_-	dihydrofolate reductase	A0A1D6X864	Bacillus_phage	6.7e-22	37.1
WP_002294416.1\|2797722_2798670_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.1e-123	64.6
WP_002288390.1\|2798681_2800568_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.6e-52	29.8
WP_002288388.1\|2800727_2802806_-	sodium:proton antiporter	NA	NA	NA	NA
WP_002290188.1\|2802818_2803094_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|2803488_2804784_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

Anti-CRISPR protein detection

Acr_ID: NZ_CP025754.1|WP_002364278.1|1204420_1204831_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP025754.1|WP_002348684.1|1204911_1205532_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP025754.1|WP_002364278.1|1204420_1204831_+|hypothetical-protein

1204420_1204831_+

136 aa aa

1173834-1212611

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP025754_2	Orphan	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	1179843-1179877	2
NZ_CP025754_2	Orphan	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	1179843-1179877	2
NZ_CP025754_2	Orphan	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	1179900-1179928	1

1. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179843-1179877, mismatch: 2

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

2. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179843-1179877, mismatch: 2

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

3. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179900-1179928, mismatch: 1

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

NZ_CP025754.1|WP_002348684.1|1204911_1205532_+|hypothetical-protein

1204911_1205532_+

206 aa aa

1173834-1212611

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP025754_2	Orphan	2.1\|1179951\|35\|NZ_CP025754\|PILER-CR	1179951-1179985	35	1179843-1179877	2
NZ_CP025754_2	Orphan	2.3\|1180059\|35\|NZ_CP025754\|PILER-CR	1180059-1180093	35	1179843-1179877	2
NZ_CP025754_2	Orphan	2.2\|1180008\|29\|NZ_CP025754\|PILER-CR	1180008-1180036	29	1179900-1179928	1

1. spacer 2.1|1179951|35|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179843-1179877, mismatch: 2

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

2. spacer 2.3|1180059|35|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179843-1179877, mismatch: 2

cttgcagaatactacaagtagtcaaaatggaaatc	CRISPR spacer
cttacaaaatactacaagtagtcaaaatggaaatc	Protospacer
***.**.****************************

3. spacer 2.2|1180008|29|NZ_CP025754|PILER-CR matches to NZ_CP025754 position: 1179900-1179928, mismatch: 1

tgtacaaagtagtgggacaagtcaaccga	CRISPR spacer
tgtacaaagtagtgggacaagccaaccga	Protospacer
*********************.*******

3. NZ_CP025755

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3998 : 11367

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011117477.1\|3998_4685_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-126	98.7
WP_001814874.1\|4824_4908_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001038792.1\|5032_5770_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_000085862.1\|5774_5906_+	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
WP_000567888.1\|7063_7309_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_000228166.1\|7411_8281_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000662263.1\|8261_8996_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000627290.1\|9937_10480_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001096887.1\|10572_11367_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0

DBSCAN-SWA_2

26027 : 35095

Streptococcus_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000754864.1\|26027_26357_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	2.6e-16	44.6
WP_000629052.1\|26661_26991_+	hypothetical protein	NA	NA	NA	NA
WP_000312841.1\|26980_27268_+	hypothetical protein	NA	NA	NA	NA
WP_000017403.1\|27546_28110_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.3e-36	46.4
WP_000222571.1\|28752_29706_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-34	36.1
WP_002354485.1\|30562_31249_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_016171138.1\|31296_32556_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.1e-54	38.2
WP_010782630.1\|32705_33320_-	recombinase family protein	M9Q1K0	Clostridium_phage	4.9e-16	30.9
WP_000969590.1\|33769_35095_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.3e-101	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025756

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025754

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

3. NZ_CP025755

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection