CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP025985	Ralstonia solanacearum strain RSCM chromosome, complete genome	0 crisprs	cas3,csa3,DEDDh,DinG,WYL	0	0	24	0
NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	3 crisprs	csa3,WYL	1	4	9	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

204809 : 216499

Leptospira_phage(50.0%)

integrase,transposase

attL 197811:197827|attR 220289:220305

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
197811:197827	attL	NA	NA	NA	NA
WP_103025505.1\|204809_205274_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|205273_205624_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|205655_207227_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025507.1\|207294_208425_-\|integrase	site-specific integrase	A0A1S6L1B6	Ralstonia_phage	1.4e-45	36.1
WP_038938784.1\|210080_211094_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025508.1\|211734_212969_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_103025509.1\|213315_214158_-	hypothetical protein	NA	NA	NA	NA
WP_011003443.1\|215167_216499_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
220289:220305	attR	NA	NA	NA	NA

DBSCAN-SWA_2

219716 : 284010

Acidithiobacillus_phage(53.66%)

capsid,portal,terminase,head,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103025512.1\|219716_220187_-	hypothetical protein	K4I1C7	Acidithiobacillus_phage	3.2e-39	54.8
WP_103025513.1\|220183_220558_-	site-specific recombinase resolvase	K4HZX2	Acidithiobacillus_phage	3.3e-39	62.2
WP_103025514.1\|220554_221943_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	3.9e-218	82.3
WP_103025515.1\|221939_222389_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	1.1e-54	71.6
WP_082240025.1\|222388_222607_-	hypothetical protein	K4HZ94	Acidithiobacillus_phage	3.2e-10	55.6
WP_103025516.1\|223316_225554_-	hypothetical protein	K4I1D0	Acidithiobacillus_phage	2.7e-290	66.5
WP_103025517.1\|225603_226065_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	5.8e-46	62.1
WP_071508479.1\|226293_226557_+	DNA-binding protein	K4I3X3	Acidithiobacillus_phage	1.8e-20	67.9
WP_103025518.1\|226567_227050_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.4e-45	59.4
WP_103025519.1\|227046_227907_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	6.5e-107	71.4
WP_103025520.1\|227903_228545_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	3.0e-80	73.3
WP_043885967.1\|228552_229029_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	1.5e-52	65.6
WP_058907375.1\|229028_229766_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	6.4e-111	77.0
WP_058907374.1\|229762_230023_+	hypothetical protein	K4I1D6	Acidithiobacillus_phage	8.4e-18	76.8
WP_058907373.1\|230019_232308_+	hypothetical protein	K4HZY1	Acidithiobacillus_phage	1.2e-285	63.1
WP_103025521.1\|232438_232903_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	2.9e-53	66.9
WP_011003115.1\|232904_233114_+	hypothetical protein	NA	NA	NA	NA
WP_103025522.1\|233106_233490_+	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_011003113.1\|233544_233811_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_016725630.1\|233810_234110_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_071654065.1\|234063_234279_+	hypothetical protein	NA	NA	NA	NA
WP_103025524.1\|234660_236049_+	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	1.1e-164	61.9
WP_103025525.1\|236045_237314_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	5.0e-196	79.1
WP_011003873.1\|237321_237978_-	hypothetical protein	NA	NA	NA	NA
WP_058908873.1\|238231_238597_-	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	6.5e-32	58.0
WP_089190869.1\|238821_239010_-	hypothetical protein	K4HZY7	Acidithiobacillus_phage	1.0e-12	64.2
WP_069079339.1\|239106_239457_-	hypothetical protein	NA	NA	NA	NA
WP_103025526.1\|239584_240079_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	7.0e-21	56.3
WP_103025527.1\|240175_240712_+	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	3.5e-74	82.0
WP_103025850.1\|240714_242694_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.0
WP_103025528.1\|242737_243247_+	hypothetical protein	A0A2I6PHW5	Pseudomonas_phage	1.4e-21	42.0
WP_103025529.1\|243257_243650_+	hypothetical protein	NA	NA	NA	NA
WP_020833008.1\|243650_243872_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
WP_103025530.1\|243871_245419_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	7.3e-149	57.1
WP_103025531.1\|245428_246679_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	5.1e-60	41.1
WP_071653952.1\|246688_247066_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.7e-24	48.0
WP_103025532.1\|247072_248077_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	2.1e-109	67.5
WP_103025533.1\|248079_248382_+	hypothetical protein	NA	NA	NA	NA
WP_103025534.1\|248387_248834_+	hypothetical protein	NA	NA	NA	NA
WP_058908386.1\|248959_249733_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6
WP_016723647.1\|249741_250137_+	hypothetical protein	NA	NA	NA	NA
WP_103025851.1\|250133_250355_+	hypothetical protein	NA	NA	NA	NA
WP_103025535.1\|250329_250974_+	hypothetical protein	NA	NA	NA	NA
WP_103025536.1\|251016_251304_-	H-NS histone family protein	NA	NA	NA	NA
WP_020832996.1\|251489_252956_-	type III secretion system YopJ family effector PopP2	NA	NA	NA	NA
WP_103025852.1\|253565_254693_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	1.3e-99	53.4
WP_103025537.1\|254758_258862_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-24	27.5
WP_103025538.1\|258867_259263_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.4e-32	53.0
WP_103025539.1\|259263_262854_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.5
WP_103025540.1\|262865_264032_+	hypothetical protein	NA	NA	NA	NA
WP_103025541.1\|264035_264518_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	2.6e-12	42.7
WP_064820726.1\|264514_264913_+	hypothetical protein	NA	NA	NA	NA
WP_103025542.1\|264917_266762_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	8.2e-107	46.5
WP_064047651.1\|266771_266996_+	hypothetical protein	NA	NA	NA	NA
WP_003270772.1\|267062_267353_+	membrane protein	K4I011	Acidithiobacillus_phage	3.1e-13	47.6
WP_020832987.1\|267349_267826_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
WP_043897848.1\|267822_268284_+	lysozyme	K4I410	Acidithiobacillus_phage	7.8e-67	83.0
WP_071615616.1\|268351_268648_+	hypothetical protein	NA	NA	NA	NA
WP_043897899.1\|269677_269995_+	hypothetical protein	NA	NA	NA	NA
WP_043897662.1\|270275_270614_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_081365912.1\|271921_272134_-	HrgA protein	NA	NA	NA	NA
WP_103025543.1\|272491_282034_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.1e-36	36.1
WP_139274337.1\|282030_282603_+	hypothetical protein	NA	NA	NA	NA
WP_103025544.1\|282759_284010_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	41.2

DBSCAN-SWA_3

288839 : 356265

Burkholderia_phage(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087451503.1\|288839_289644_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_021156161.1\|290177_291983_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_028861115.1\|292161_292740_-	adenylyl-sulfate kinase	A0A2P1ELS9	Moumouvirus	4.5e-19	38.7
WP_058908714.1\|292736_293639_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_081049985.1\|293651_294815_-	glycosyl transferase family 8	NA	NA	NA	NA
WP_058908712.1\|297076_300121_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_011003050.1\|300285_300981_+	response regulator transcription factor	NA	NA	NA	NA
WP_058908711.1\|301046_302978_+	sensor histidine kinase	NA	NA	NA	NA
WP_058908710.1\|303305_304436_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_058908709.1\|304476_305754_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011003046.1\|306039_306876_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_020831502.1\|307368_308697_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011003045.1\|308750_308954_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.1e-16	63.6
WP_019718985.1\|309281_309488_+	hypothetical protein	NA	NA	NA	NA
WP_016724430.1\|310075_311254_+	antibiotic hydrolase	NA	NA	NA	NA
WP_016724429.1\|311690_312527_+	cytochrome c	NA	NA	NA	NA
WP_103025546.1\|314595_315582_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_058908555.1\|316106_316949_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_058908554.1\|317166_319290_-	tryptophan 2-monooxygenase oxidoreductase	NA	NA	NA	NA
WP_011003039.1\|320030_320462_-	hypothetical protein	NA	NA	NA	NA
WP_016724425.1\|321504_321846_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016724424.1\|322157_322436_+	hypothetical protein	NA	NA	NA	NA
WP_103025547.1\|322435_323584_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011003035.1\|323711_324104_+	hypothetical protein	NA	NA	NA	NA
WP_021154951.1\|324434_325340_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_103025548.1\|325393_326773_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.8e-13	32.4
WP_058908552.1\|327088_327688_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_016724421.1\|327944_328499_+	hypothetical protein	NA	NA	NA	NA
WP_028853785.1\|328543_329530_+\|protease	serine protease	A0A0F6R5W6	Sinorhizobium_phage	1.4e-07	30.0
WP_011003029.1\|329919_330399_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_019718973.1\|330668_331457_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.7e-09	28.1
WP_058908557.1\|331792_334741_+	hypothetical protein	NA	NA	NA	NA
WP_028853783.1\|334862_336848_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.7e-15	40.5
WP_016724416.1\|336869_337670_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_058908551.1\|337891_339145_-	MFS transporter	NA	NA	NA	NA
WP_016724414.1\|339335_339884_-	N-acetyltransferase	NA	NA	NA	NA
WP_058908550.1\|339963_340593_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020832947.1\|340696_341692_-	2-hydroxyacid dehydrogenase	M1I636	Acanthocystis_turfacea_Chlorella_virus	1.8e-60	44.3
WP_011003020.1\|341756_342782_-	alcohol dehydrogenase AdhP	A0A0G2YAX3	Acanthamoeba_polyphaga_mimivirus	4.3e-33	28.3
WP_058908549.1\|342849_344763_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_058908548.1\|345013_346534_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_058908547.1\|346617_348012_+	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_058908546.1\|348020_348833_+	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_016724407.1\|348859_350329_+	exodeoxyribonuclease I	NA	NA	NA	NA
WP_086004961.1\|350610_351728_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.0e-47	40.0
WP_139274372.1\|352044_352380_+	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|352950_353916_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_103025549.1\|353982_355065_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_103025546.1\|355278_356265_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3

DBSCAN-SWA_4

402419 : 442146

Ralstonia_virus(52.08%)

capsid,portal,terminase,head,tail,plate,holin,transposase,integrase

attL 399236:399281|attR 442200:442245

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
399236:399281	attL	NA	NA	NA	NA
WP_020832917.1\|402419_402830_+	PAAR domain-containing protein	A4PE23	Ralstonia_virus	2.0e-66	99.2
WP_021155085.1\|402831_403335_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	1.0e-91	98.8
WP_103025853.1\|403344_404277_+	hypothetical protein	A4PE25	Ralstonia_virus	3.3e-165	98.7
WP_052331361.1\|404186_405002_+	hypothetical protein	A4PE26	Ralstonia_virus	1.3e-152	97.4
WP_103025556.1\|404986_406093_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	9.0e-210	97.0
WP_103025557.1\|406089_407871_-\|terminase	terminase ATPase subunit family protein	A0A077K8Q7	Ralstonia_phage	0.0e+00	98.0
WP_103025558.1\|408012_408852_+\|capsid	GPO family capsid scaffolding protein	A4PE29	Ralstonia_virus	3.4e-145	95.7
WP_011001874.1\|408905_409922_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	4.7e-189	100.0
WP_089190560.1\|409918_410641_+\|terminase	terminase endonuclease subunit	A0A077K804	Ralstonia_phage	1.1e-126	99.6
WP_011001872.1\|410737_411217_+\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	2.3e-85	100.0
WP_011001871.1\|411216_411423_+\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	1.8e-31	100.0
WP_015985092.1\|411438_411843_+	phage-related protein	A0A077K9X1	Ralstonia_phage	2.8e-28	100.0
WP_103025559.1\|411839_412154_+\|holin	phage holin family protein	A4PE35	Ralstonia_virus	1.1e-48	96.1
WP_103025560.1\|412150_412957_+	DUF3380 domain-containing protein	A4PE36	Ralstonia_virus	2.7e-147	98.5
WP_103025561.1\|412953_413454_+	hypothetical protein	A0A077K9R7	Ralstonia_phage	2.1e-81	98.8
WP_015985096.1\|413450_413885_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	2.9e-79	100.0
WP_103025562.1\|413881_414328_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	3.3e-62	85.7
WP_103025563.1\|414499_415414_+	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	1.9e-11	27.5
WP_103025546.1\|415538_416525_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_103025564.1\|416938_417604_+	hypothetical protein	NA	NA	NA	NA
WP_103025565.1\|417607_418858_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	41.2
WP_103025566.1\|419182_419800_+\|plate	phage baseplate assembly protein V	A0A077K9S0	Ralstonia_phage	5.9e-110	95.1
WP_103025567.1\|419796_420144_+\|plate	baseplate assembly protein	A0A077K8R5	Ralstonia_phage	1.6e-56	98.2
WP_103025568.1\|420146_421055_+\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	8.0e-156	95.7
WP_023470164.1\|421047_421665_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	1.5e-100	96.2
WP_103025569.1\|421671_423336_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	2.1e-303	94.6
WP_103025570.1\|423348_424101_+\|tail	phage tail protein	A4PE47	Ralstonia_virus	1.2e-125	95.2
WP_103025571.1\|424097_424562_+	hypothetical protein	A0A077K8R9	Ralstonia_phage	2.8e-80	92.9
WP_103025572.1\|424655_425831_+\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	7.0e-221	97.4
WP_103025573.1\|425862_426372_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	7.3e-82	87.0
WP_103025854.1\|426447_426774_+\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	4.0e-49	97.2
WP_003267618.1\|426770_426872_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
WP_103025574.1\|426868_429532_+\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	95.6
WP_103025575.1\|429534_429957_+\|tail	phage tail protein	A4PE53	Ralstonia_virus	8.8e-73	97.9
WP_103025576.1\|429953_431081_+	phage late control D family protein	A4PE54	Ralstonia_virus	4.1e-202	96.5
WP_071615623.1\|431393_431603_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	2.4e-15	70.4
WP_021155111.1\|431553_432336_+	site-specific DNA-methyltransferase	A0A1S5NPU0	Burkholderia_phage	2.4e-92	67.8
WP_016727351.1\|433156_433579_-	helix-turn-helix domain-containing protein	A4PE57	Ralstonia_virus	6.7e-73	100.0
WP_071615658.1\|433654_433855_+	hypothetical protein	NA	NA	NA	NA
WP_016727352.1\|433874_434066_+	hypothetical protein	E5E3U0	Burkholderia_phage	3.4e-08	50.9
WP_015985115.1\|434094_434289_+	hypothetical protein	A4PE59	Ralstonia_virus	1.8e-25	100.0
WP_015985116.1\|434285_434534_+	ogr/Delta-like zinc finger family protein	A4PE60	Ralstonia_virus	1.0e-41	100.0
WP_015985117.1\|434648_435203_+	Bro-N domain-containing protein	A4PE61	Ralstonia_virus	1.2e-98	100.0
WP_015985118.1\|435212_435446_+	hypothetical protein	A4PE62	Ralstonia_virus	1.5e-34	100.0
WP_015985120.1\|435603_435810_+	hypothetical protein	A4PE64	Ralstonia_virus	6.4e-29	100.0
WP_015985121.1\|435809_436046_+	hypothetical protein	A4PE65	Ralstonia_virus	2.1e-39	100.0
WP_023470166.1\|436038_436251_+	hypothetical protein	A4PE66	Ralstonia_virus	2.3e-29	94.3
WP_016725459.1\|436270_436579_+	hypothetical protein	NA	NA	NA	NA
WP_103025577.1\|436580_436802_+	hypothetical protein	A4PE67	Ralstonia_virus	7.1e-34	94.5
WP_103025578.1\|437189_439967_+	hypothetical protein	A4PE69	Ralstonia_virus	0.0e+00	85.9
WP_158655367.1\|439953_440127_+	hypothetical protein	NA	NA	NA	NA
WP_158655368.1\|440842_441190_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_103025581.1\|441057_442146_+\|integrase	site-specific integrase	A4PE72	Ralstonia_virus	2.1e-158	77.9
442200:442245	attR	NA	NA	NA	NA

DBSCAN-SWA_5

553339 : 616073

uncultured_Mediterranean_phage(20.0%)

integrase,protease,transposase

attL 608716:608732|attR 623624:623640

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020831502.1\|553339_554668_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011002881.1\|554800_557206_-	penicillin-binding protein 1A	NA	NA	NA	NA
WP_011002880.1\|557658_558729_+	pilus assembly protein PilM	NA	NA	NA	NA
WP_011002879.1\|558742_559375_+	PilN domain-containing protein	NA	NA	NA	NA
WP_020832821.1\|559377_560037_+	type 4a pilus biogenesis protein PilO	NA	NA	NA	NA
WP_011002877.1\|560033_560579_+	pilus assembly protein PilP	NA	NA	NA	NA
WP_011002876.1\|560575_562720_+	type IV pilus secretin PilQ	R9TEZ5	Vibrio_phage	5.2e-20	26.4
WP_103025586.1\|562894_563434_+	shikimate kinase	NA	NA	NA	NA
WP_019718894.1\|563430_564537_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_058907609.1\|564556_565720_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_011002872.1\|565869_566544_-	OmpW family protein	NA	NA	NA	NA
WP_019718892.1\|566810_567536_+\|transposase	transposase	NA	NA	NA	NA
WP_058907608.1\|567786_572535_+	glutamate synthase subunit alpha	NA	NA	NA	NA
WP_011002869.1\|572663_574127_+	glutamate synthase subunit beta	NA	NA	NA	NA
WP_028853722.1\|574282_575317_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011002867.1\|575553_576393_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-15	31.3
WP_011002866.1\|576389_577157_+	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_011002865.1\|577185_577707_+	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_011002864.1\|577710_578520_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_011002863.1\|578674_579310_+	phospholipid-binding protein MlaC	NA	NA	NA	NA
WP_028853721.1\|579376_579691_+	STAS domain-containing protein	NA	NA	NA	NA
WP_016725133.1\|579925_580891_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	9.5e-22	33.3
WP_016725132.1\|580887_581676_+	ABC transporter permease	NA	NA	NA	NA
WP_011002859.1\|581732_581969_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_103025856.1\|582060_583326_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_016725130.1\|583344_584046_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_011002857.1\|584042_585371_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_011002856.1\|585387_586512_+	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	3.3e-10	25.4
WP_011002855.1\|586508_587099_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_011002854.1\|587154_587778_+	NAAT family transporter	NA	NA	NA	NA
WP_016725127.1\|587774_588428_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_011002852.1\|588503_589247_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_028853716.1\|589313_590087_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_011002850.1\|590089_590512_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_011002849.1\|590504_590879_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_011002848.1\|590925_591300_+	membrane protein	NA	NA	NA	NA
WP_011002847.1\|591361_591619_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_011002846.1\|591640_592159_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_011002845.1\|592215_593019_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.5e-28	32.8
WP_011002844.1\|593102_594179_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-29	37.1
WP_103025587.1\|594171_595983_-	iron ABC transporter permease	NA	NA	NA	NA
WP_058907607.1\|596067_597165_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_028861031.1\|597282_598785_-	sensor histidine kinase	NA	NA	NA	NA
WP_011002840.1\|598781_599489_-	response regulator	NA	NA	NA	NA
WP_016724686.1\|599583_600726_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011002838.1\|601061_602201_+	porin	NA	NA	NA	NA
WP_011002837.1\|602658_603870_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	1.2e-10	33.6
WP_011002836.1\|603889_604636_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_003263430.1\|604649_605075_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_011002835.1\|605320_605929_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_020832800.1\|605931_607335_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_011002833.1\|607361_608108_+	cytochrome c1	NA	NA	NA	NA
WP_011002832.1\|608255_608867_+	transcription modulator protein	NA	NA	NA	NA
608716:608732	attL	NA	NA	NA	NA
WP_011002831.1\|608925_609423_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	8.6e-19	47.6
WP_103025857.1\|609625_610672_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	8.6e-53	38.4
WP_103025588.1\|610725_610941_-	antitoxin MazE family protein	NA	NA	NA	NA
WP_086004961.1\|611088_612206_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.0e-47	40.0
WP_103025858.1\|613684_613939_+	hypothetical protein	NA	NA	NA	NA
WP_103025859.1\|614621_616073_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
623624:623640	attR	NA	NA	NA	NA

DBSCAN-SWA_6

630657 : 662961

Burkholderia_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|630657_631623_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_011000174.1\|631778_633005_-	MFS transporter	NA	NA	NA	NA
WP_058908322.1\|633066_634095_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011000172.1\|634316_635219_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011000171.1\|635681_637205_-	thymidine phosphorylase	NA	NA	NA	NA
WP_016722500.1\|637227_637506_-	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_016722501.1\|637558_638521_-	ribose-phosphate pyrophosphokinase	NA	NA	NA	NA
WP_011000168.1\|638523_639882_-	MBL fold metallo-hydrolase	Q331V3	Clostridium_botulinum_C_phage	3.1e-18	29.8
WP_011000167.1\|639897_640320_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_103025591.1\|641560_642085_+	cytochrome b	NA	NA	NA	NA
WP_011000165.1\|642113_642755_+	hypothetical protein	NA	NA	NA	NA
WP_103025478.1\|642798_643601_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_020829879.1\|643783_644785_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011000164.1\|645067_645688_-	cytochrome c4	NA	NA	NA	NA
WP_011000163.1\|645723_647064_-	hypothetical protein	NA	NA	NA	NA
WP_103025505.1\|647350_647815_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|647814_648165_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|648196_649768_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025592.1\|650603_653570_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.7
WP_103025593.1\|653729_654020_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_103025594.1\|654016_654388_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_103025595.1\|654384_654852_+	hypothetical protein	NA	NA	NA	NA
WP_103025596.1\|654845_655403_+	recombinase family protein	A0A0C4UR34	Shigella_phage	1.1e-59	63.5
WP_158655369.1\|655444_655603_+	hypothetical protein	NA	NA	NA	NA
WP_103025597.1\|655619_655859_+	hypothetical protein	NA	NA	NA	NA
WP_103025598.1\|656207_657449_-	restriction endonuclease	E5E3X4	Burkholderia_phage	1.8e-129	57.1
WP_103025599.1\|657445_657892_-	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	2.6e-67	77.7
WP_103025860.1\|657891_659157_-	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	1.5e-221	85.3
WP_158655370.1\|659288_659696_-	DUF192 domain-containing protein	NA	NA	NA	NA
WP_103025601.1\|659946_662961_-	conjugative relaxase	V5UQN3	Mycobacterium_phage	3.5e-06	28.5

DBSCAN-SWA_7

875815 : 1012215

107

uncultured_Mediterranean_phage(17.65%)

tRNA,transposase,integrase

attL 943309:943368|attR 982857:984175

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723738.1\|875815_878449_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	6.9e-176	39.8
WP_011002650.1\|878488_878998_+	hypothetical protein	NA	NA	NA	NA
WP_058908285.1\|879022_880099_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_011002648.1\|880176_881457_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.0e-84	44.9
WP_011002647.1\|881527_881950_+	CopD family protein	NA	NA	NA	NA
WP_011002646.1\|881971_883387_+	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_019718258.1\|883411_884422_-	response regulator	NA	NA	NA	NA
WP_011002644.1\|884483_885608_-	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_011002643.1\|885616_886945_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_011002642.1\|886958_888362_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011002641.1\|888958_889996_-	response regulator	NA	NA	NA	NA
WP_011002640.1\|890161_891622_-	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_011002639.1\|891618_891942_-	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_011002638.1\|892013_892376_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_011002637.1\|892446_893586_-	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_058908284.1\|893880_895950_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_058908283.1\|895952_897095_+	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_103025620.1\|897096_898632_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_028853618.1\|898628_899795_-	HlyD family secretion protein	NA	NA	NA	NA
WP_011002632.1\|899870_900344_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016723725.1\|900477_900984_+	NUDIX hydrolase	NA	NA	NA	NA
WP_011002630.1\|900980_902093_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_103025621.1\|902181_903783_+	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_103025859.1\|903874_905326_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_058908281.1\|905460_906069_-	glutathione S-transferase	NA	NA	NA	NA
WP_011002627.1\|906302_907676_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.8e-109	47.0
WP_058908280.1\|907922_908510_+	cytochrome b	NA	NA	NA	NA
WP_016723720.1\|908610_909177_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_028853616.1\|909234_909831_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_028853615.1\|909906_910875_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.8e-44	37.7
WP_103025622.1\|910952_912833_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_020832658.1\|912954_913290_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.0e-12	40.2
WP_016723717.1\|913395_914547_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	9.4e-77	42.1
WP_058908293.1\|914540_915629_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_043876653.1\|915705_917898_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_058908292.1\|917916_918120_-	hypothetical protein	NA	NA	NA	NA
WP_011002617.1\|918131_918572_-	hypothetical protein	NA	NA	NA	NA
WP_021154756.1\|919115_920246_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_058908291.1\|920387_921329_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_103025623.1\|921519_922743_-	diaminopropionate ammonia-lyase	NA	NA	NA	NA
WP_058908277.1\|922787_924074_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_020832649.1\|924433_924895_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_058908276.1\|925105_926302_-	amidohydrolase	NA	NA	NA	NA
WP_049832842.1\|926782_927982_-	UDP-glucuronosyltransferase	NA	NA	NA	NA
WP_058908804.1\|928590_928926_+	hypothetical protein	NA	NA	NA	NA
WP_158655374.1\|929015_932957_+	hypothetical protein	NA	NA	NA	NA
WP_103025478.1\|932922_933725_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_158655409.1\|933623_938312_+	hypothetical protein	NA	NA	NA	NA
WP_071624213.1\|938456_940028_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025506.1\|940059_940410_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|940409_940874_-\|transposase	transposase	NA	NA	NA	NA
WP_158655375.1\|941141_942131_-	hypothetical protein	NA	NA	NA	NA
WP_103025626.1\|942114_943101_-	hypothetical protein	NA	NA	NA	NA
WP_016724509.1\|943032_943311_+\|transposase	IS3 family transposase	U5P4I9	Shigella_phage	2.6e-17	60.0
943309:943368	attL	NA	NA	NA	NA
WP_103025508.1\|943342_944577_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_020832465.1\|944629_945505_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.3e-94	61.1
WP_043885598.1\|945660_946518_-	AAA family ATPase	NA	NA	NA	NA
WP_103025627.1\|946514_948479_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_043885887.1\|948459_949095_-	hypothetical protein	NA	NA	NA	NA
WP_103025628.1\|949256_949673_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058908783.1\|949856_950201_-	hypothetical protein	NA	NA	NA	NA
WP_103025629.1\|950197_953368_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_103025630.1\|953364_954897_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_103025631.1\|954893_956210_-	TolC family protein	NA	NA	NA	NA
WP_103025632.1\|956281_956701_-	copper resistance protein	NA	NA	NA	NA
WP_103025633.1\|957152_958124_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_103025634.1\|958247_959585_+	MFS transporter	NA	NA	NA	NA
WP_103025635.1\|959581_960967_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_103025636.1\|960987_961737_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_103025637.1\|961791_962727_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_103025638.1\|962758_963838_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_103025639.1\|963857_964823_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_103025640.1\|964873_965704_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_103025864.1\|965757_966705_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_103025641.1\|966846_967470_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_103025642.1\|967535_967844_+	hypothetical protein	NA	NA	NA	NA
WP_103025643.1\|967898_968810_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_103025644.1\|968820_969870_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_103025645.1\|970028_970640_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_103025549.1\|971449_972532_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_086706442.1\|972766_974476_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_071653928.1\|976152_976977_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103025508.1\|981647_982881_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_103025546.1\|983469_984456_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
982857:984175	attR	NA	NA	NA	NA
WP_103025549.1\|984541_985624_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011003443.1\|985825_987157_-\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_158655376.1\|987218_988175_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_103025647.1\|988483_988867_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_103025648.1\|988897_989314_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_103025649.1\|989506_990565_-	DMT family transporter	NA	NA	NA	NA
WP_016723619.1\|990779_991745_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_103025650.1\|991937_992354_+	DUF1924 domain-containing protein	NA	NA	NA	NA
WP_103025651.1\|992401_992893_+	cytochrome C	NA	NA	NA	NA
WP_103025652.1\|992864_993596_+	cytochrome B	NA	NA	NA	NA
WP_103025653.1\|993627_994302_+	response regulator	NA	NA	NA	NA
WP_103025654.1\|994298_995672_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_103025655.1\|995865_996792_+	cation transporter	NA	NA	NA	NA
WP_103025656.1\|996862_997333_+	hypothetical protein	NA	NA	NA	NA
WP_103025657.1\|997595_998681_+	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_103025658.1\|998680_1001794_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	9.1e-58	21.8
WP_103025659.1\|1001790_1003068_+	TolC family protein	NA	NA	NA	NA
WP_103025660.1\|1003113_1003638_+	cytochrome b	NA	NA	NA	NA
WP_103025865.1\|1003689_1005981_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.7e-50	28.7
WP_103025661.1\|1006795_1007257_+	universal stress protein	NA	NA	NA	NA
WP_103025662.1\|1008049_1008754_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-35	38.7
WP_103025663.1\|1008747_1011117_+	ABC transporter permease	NA	NA	NA	NA
WP_103025478.1\|1011413_1012215_+\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1159995 : 1217306

Ralstonia_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058908220.1\|1159995_1160898_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	8.9e-14	31.8
WP_058908219.1\|1161002_1163177_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_103025549.1\|1163508_1164591_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_016723380.1\|1164587_1165001_-	bacteriohemerythrin	NA	NA	NA	NA
WP_011000732.1\|1165085_1165751_-	DsbA family protein	NA	NA	NA	NA
WP_058908218.1\|1165759_1166602_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.8e-13	37.9
WP_058908217.1\|1166788_1168495_+	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
WP_103025670.1\|1168550_1169336_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_028852723.1\|1169348_1170095_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_011000738.1\|1170606_1170960_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011000739.1\|1170997_1171546_-	YaeQ family protein	NA	NA	NA	NA
WP_071624043.1\|1171758_1174575_+	DUF2339 domain-containing protein	NA	NA	NA	NA
WP_081049964.1\|1174571_1175924_+	DUF3999 domain-containing protein	NA	NA	NA	NA
WP_020831449.1\|1175982_1176366_-	hypothetical protein	NA	NA	NA	NA
WP_016723370.1\|1176410_1176632_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_016723369.1\|1176639_1177209_-	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_011000745.1\|1177253_1178996_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	1.3e-183	55.7
WP_058908214.1\|1179063_1179417_-	hypothetical protein	NA	NA	NA	NA
WP_011000747.1\|1179479_1180982_-	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_011000748.1\|1180992_1181478_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_016723368.1\|1181690_1182143_-	DUF2214 family protein	NA	NA	NA	NA
WP_103025671.1\|1182174_1183395_-	CoA transferase	NA	NA	NA	NA
WP_011000751.1\|1183580_1186235_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.7
WP_021155849.1\|1186524_1187631_+	purine nucleoside permease	NA	NA	NA	NA
WP_011000753.1\|1187627_1188668_+	hypothetical protein	NA	NA	NA	NA
WP_058908211.1\|1188905_1191014_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_058908210.1\|1191040_1191751_+	hypothetical protein	NA	NA	NA	NA
WP_011000756.1\|1191760_1192510_-	slipin family protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	3.9e-23	31.6
WP_011000757.1\|1192521_1193934_-	nodulation protein NfeD	NA	NA	NA	NA
WP_058908209.1\|1194008_1194917_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058908233.1\|1195025_1196246_+	MFS transporter	NA	NA	NA	NA
WP_058908208.1\|1196328_1197114_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_011000761.1\|1197126_1197315_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_011000762.1\|1197367_1198405_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_011000763.1\|1198423_1199005_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003263554.1\|1199044_1199272_+	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_058908207.1\|1199285_1199657_-	hypothetical protein	NA	NA	NA	NA
WP_058908206.1\|1199667_1200918_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_028860303.1\|1200989_1201622_-	LysE family translocator	NA	NA	NA	NA
WP_011000768.1\|1202010_1202409_+	RcnB family protein	NA	NA	NA	NA
WP_043897895.1\|1202898_1203519_+	glutathione transferase GstA	NA	NA	NA	NA
WP_028860305.1\|1203906_1204713_+	endoglucanase	NA	NA	NA	NA
WP_071615352.1\|1204727_1204943_-	hypothetical protein	NA	NA	NA	NA
WP_063612204.1\|1205162_1205762_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058908204.1\|1205895_1206624_+	nitroreductase family protein	NA	NA	NA	NA
WP_011000775.1\|1206644_1206950_+	hypothetical protein	NA	NA	NA	NA
WP_103025866.1\|1207033_1208196_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.1e-80	51.5
WP_016723619.1\|1208296_1209262_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_158655382.1\|1209345_1209591_-	hypothetical protein	NA	NA	NA	NA
WP_103025867.1\|1209987_1210203_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_016723619.1\|1210670_1211636_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_049800424.1\|1212049_1212766_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_058908775.1\|1213481_1213721_+	hypothetical protein	NA	NA	NA	NA
WP_103025549.1\|1215073_1216156_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_103025546.1\|1216319_1217306_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3

DBSCAN-SWA_9

1238029 : 1284527

Acidithiobacillus_phage(33.33%)

capsid,portal,terminase,head,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086004961.1\|1238029_1239146_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.0e-47	40.0
WP_103025508.1\|1240178_1241413_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_003274149.1\|1241797_1242610_-	oxidoreductase	NA	NA	NA	NA
WP_016724993.1\|1242764_1243370_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021156149.1\|1243791_1244076_+	hypothetical protein	NA	NA	NA	NA
WP_021156150.1\|1244072_1244570_+	hypothetical protein	NA	NA	NA	NA
WP_103025673.1\|1244566_1245439_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	1.4e-101	65.7
WP_016724999.1\|1245456_1246089_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	7.2e-63	61.0
WP_103025674.1\|1246161_1246566_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	1.4e-27	49.6
WP_103025675.1\|1246571_1246961_+	hypothetical protein	NA	NA	NA	NA
WP_064047862.1\|1246944_1249242_+	hypothetical protein	K4HZY1	Acidithiobacillus_phage	0.0e+00	72.1
WP_064047861.1\|1249476_1249686_+	hypothetical protein	NA	NA	NA	NA
WP_058908853.1\|1249675_1250083_+	hypothetical protein	NA	NA	NA	NA
WP_103025676.1\|1250580_1251981_+	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	8.5e-165	62.1
WP_103025525.1\|1251977_1253246_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	5.0e-196	79.1
WP_103025677.1\|1254160_1254466_-	hypothetical protein	NA	NA	NA	NA
WP_103025526.1\|1255510_1256005_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	7.0e-21	56.3
WP_103025527.1\|1256101_1256638_+	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	3.5e-74	82.0
WP_103025850.1\|1256640_1258620_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.0
WP_103025528.1\|1258663_1259173_+	hypothetical protein	A0A2I6PHW5	Pseudomonas_phage	1.4e-21	42.0
WP_103025529.1\|1259183_1259576_+	hypothetical protein	NA	NA	NA	NA
WP_020833008.1\|1259576_1259798_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
WP_103025530.1\|1259797_1261345_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	7.3e-149	57.1
WP_103025531.1\|1261354_1262605_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	5.1e-60	41.1
WP_071653952.1\|1262614_1262992_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.7e-24	48.0
WP_103025532.1\|1262998_1264003_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	2.1e-109	67.5
WP_103025533.1\|1264005_1264308_+	hypothetical protein	NA	NA	NA	NA
WP_103025534.1\|1264313_1264760_+	hypothetical protein	NA	NA	NA	NA
WP_058908386.1\|1264885_1265659_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6
WP_103025678.1\|1265667_1266057_+	hypothetical protein	NA	NA	NA	NA
WP_020833043.1\|1266053_1266275_+	hypothetical protein	NA	NA	NA	NA
WP_043885690.1\|1266249_1266894_+	hypothetical protein	NA	NA	NA	NA
WP_103025852.1\|1269808_1270936_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	1.3e-99	53.4
WP_103025537.1\|1271001_1275105_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-24	27.5
WP_103025538.1\|1275110_1275506_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.4e-32	53.0
WP_103025539.1\|1275506_1279097_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.5
WP_103025540.1\|1279108_1280275_+	hypothetical protein	NA	NA	NA	NA
WP_103025541.1\|1280278_1280761_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	2.6e-12	42.7
WP_064820726.1\|1280757_1281156_+	hypothetical protein	NA	NA	NA	NA
WP_103025542.1\|1281160_1283005_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	8.2e-107	46.5
WP_064047651.1\|1283014_1283239_+	hypothetical protein	NA	NA	NA	NA
WP_003270772.1\|1283305_1283596_+	membrane protein	K4I011	Acidithiobacillus_phage	3.1e-13	47.6
WP_020832987.1\|1283592_1284069_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
WP_064820722.1\|1284065_1284527_+	lysozyme	K4I410	Acidithiobacillus_phage	8.7e-66	81.0

DBSCAN-SWA_10

1304841 : 1386329

Leptospira_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071624213.1\|1304841_1306413_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025506.1\|1306444_1306795_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|1306794_1307259_-\|transposase	transposase	NA	NA	NA	NA
WP_089190366.1\|1307799_1308297_+	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	2.0e-20	38.1
WP_058908852.1\|1308293_1309676_+	recombinase family protein	K4ICM1	Acidithiobacillus_phage	7.7e-134	59.6
WP_081050001.1\|1309708_1310149_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_086004752.1\|1310430_1311233_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_103025681.1\|1312184_1313108_+	hypothetical protein	NA	NA	NA	NA
WP_038938784.1\|1313952_1314966_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025508.1\|1315882_1317117_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_028861894.1\|1317226_1317979_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_011004625.1\|1317975_1318278_+	AzlD family protein	NA	NA	NA	NA
WP_146605472.1\|1318370_1318622_-	hypothetical protein	NA	NA	NA	NA
WP_103025870.1\|1318608_1320279_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_103025549.1\|1320511_1321594_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_103025546.1\|1321679_1322666_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_158655383.1\|1322909_1323530_-	hypothetical protein	NA	NA	NA	NA
WP_139274363.1\|1323535_1323781_-	hypothetical protein	NA	NA	NA	NA
WP_071615431.1\|1334164_1341703_-	type III effector protein skwp2	NA	NA	NA	NA
WP_058908591.1\|1342122_1342653_-	nitrous oxide reductase accessory protein NosL	NA	NA	NA	NA
WP_058908592.1\|1342649_1343474_-	ABC transporter permease	NA	NA	NA	NA
WP_019719967.1\|1343470_1344415_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-28	33.7
WP_016727950.1\|1344398_1345670_-	nitrous oxide reductase family maturation protein NosD	NA	NA	NA	NA
WP_058908596.1\|1345666_1348285_-	regulatory protein NosR	NA	NA	NA	NA
WP_103025682.1\|1348342_1350283_-	nitrous-oxide reductase	NA	NA	NA	NA
WP_011004617.1\|1350511_1350919_+	cytochrome c5 family protein	NA	NA	NA	NA
WP_058908594.1\|1350923_1351946_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_011004615.1\|1352058_1352961_+	acyltransferase	NA	NA	NA	NA
WP_103025546.1\|1354399_1355386_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_028854566.1\|1357024_1357402_+	RidA family protein	NA	NA	NA	NA
WP_058908652.1\|1357724_1358207_-	ATPase	NA	NA	NA	NA
WP_019719980.1\|1358199_1358535_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_028854564.1\|1358784_1359369_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058908651.1\|1359481_1360363_+	oxidoreductase	NA	NA	NA	NA
WP_019719983.1\|1360806_1361301_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_058908650.1\|1361404_1362445_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_058908649.1\|1362486_1362924_+	RidA family protein	NA	NA	NA	NA
WP_058908648.1\|1362968_1363928_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_058908647.1\|1364162_1364432_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_058908646.1\|1364464_1365631_+	hypothetical protein	NA	NA	NA	NA
WP_071615426.1\|1365968_1366178_-	hypothetical protein	NA	NA	NA	NA
WP_071624213.1\|1368091_1369663_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025506.1\|1369694_1370045_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|1370044_1370509_-\|transposase	transposase	NA	NA	NA	NA
WP_158655384.1\|1370579_1370726_-	hypothetical protein	NA	NA	NA	NA
WP_158655385.1\|1370908_1371238_+	hypothetical protein	NA	NA	NA	NA
WP_103025684.1\|1371600_1373349_-	ATP-dependent helicase	NA	NA	NA	NA
WP_103025685.1\|1373345_1375388_-	AAA family ATPase	NA	NA	NA	NA
WP_103025686.1\|1375450_1378519_-	N-6 DNA methylase	A0A2R2ZGH5	Clostridioides_phage	3.2e-15	23.1
WP_103025871.1\|1378515_1380255_-	N-6 DNA methylase	NA	NA	NA	NA
WP_101838923.1\|1380263_1380458_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_081049931.1\|1380981_1382007_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_019718510.1\|1382124_1382826_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016722823.1\|1382806_1383625_-	FprA family A-type flavoprotein	NA	NA	NA	NA
WP_011002139.1\|1383860_1385348_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.9e-52	33.7
WP_058907657.1\|1385381_1386329_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA

DBSCAN-SWA_11

1443563 : 1514055

Ralstonia_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103025549.1\|1443563_1444646_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_103025546.1\|1444859_1445846_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_058907636.1\|1446122_1447397_-	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
WP_058907664.1\|1447403_1448009_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_016722867.1\|1448020_1448737_-	ribonuclease PH	NA	NA	NA	NA
WP_011002087.1\|1448831_1449746_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_016722868.1\|1449842_1450871_-	serine/threonine protein kinase	M1HP99	Paramecium_bursaria_Chlorella_virus	2.7e-11	24.7
WP_011002085.1\|1451015_1451951_+	YicC family protein	NA	NA	NA	NA
WP_011002084.1\|1451975_1452641_+	guanylate kinase	A0A223FNL1	NY_014_poxvirus	6.1e-12	26.5
WP_003262123.1\|1452771_1452975_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_016722870.1\|1453213_1455646_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	2.8e-14	35.5
WP_058907634.1\|1456018_1456582_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_103025872.1\|1456872_1457274_+	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
WP_016722872.1\|1457376_1457682_+	hypothetical protein	NA	NA	NA	NA
WP_058907633.1\|1457699_1458731_-	PHB depolymerase family esterase	NA	NA	NA	NA
WP_011002078.1\|1459022_1459505_+	peptidoglycan-binding protein LysM	NA	NA	NA	NA
WP_021155724.1\|1460096_1460873_+	L-iditol 2-dehydrogenase	NA	NA	NA	NA
WP_058907632.1\|1460877_1461834_+	sugar kinase	NA	NA	NA	NA
WP_058907631.1\|1461821_1463177_+	D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit	NA	NA	NA	NA
WP_028860772.1\|1463228_1464554_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_103025687.1\|1464736_1465537_+\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_103025688.1\|1465531_1466464_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_058907630.1\|1466460_1467321_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_011002071.1\|1467317_1468016_+	HAD family phosphatase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	4.3e-08	42.7
WP_016722881.1\|1468067_1469177_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.6e-25	35.1
WP_103025689.1\|1469299_1472503_-	hypothetical protein	NA	NA	NA	NA
WP_103025690.1\|1473022_1473463_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_103025691.1\|1473475_1473940_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_158655386.1\|1474055_1474223_-	hypothetical protein	NA	NA	NA	NA
WP_103025508.1\|1474290_1475524_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_058907661.1\|1476805_1477063_+	hypothetical protein	NA	NA	NA	NA
WP_139274257.1\|1477301_1477571_-	hypothetical protein	NA	NA	NA	NA
WP_058907627.1\|1477696_1477924_+	hypothetical protein	NA	NA	NA	NA
WP_103672917.1\|1478151_1479546_+	type III secretion system YopJ family effector RipJ	NA	NA	NA	NA
WP_103025692.1\|1480365_1482531_+	hypothetical protein	NA	NA	NA	NA
WP_058907623.1\|1482751_1484149_+	mannitol dehydrogenase family protein	NA	NA	NA	NA
WP_058907622.1\|1484241_1485717_+	xylulokinase	NA	NA	NA	NA
WP_016722893.1\|1485778_1486726_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_028860762.1\|1487073_1488090_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-46	34.1
WP_058907621.1\|1488139_1490857_-	aminopeptidase N	NA	NA	NA	NA
WP_011002055.1\|1491020_1491662_+	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_011002054.1\|1491954_1494276_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_058907620.1\|1494691_1495213_-	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	NA	NA	NA	NA
WP_043876629.1\|1495209_1496172_-	allantoinase PuuE	NA	NA	NA	NA
WP_058907618.1\|1496192_1497617_-	8-oxoguanine deaminase	NA	NA	NA	NA
WP_058907617.1\|1497621_1499028_-	purine permease	Q9KX94	Enterobacteria_phage	3.9e-24	27.1
WP_058907616.1\|1499120_1499873_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011002047.1\|1500239_1500593_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_058907615.1\|1500605_1501850_+	urate hydroxylase PuuD	NA	NA	NA	NA
WP_011002045.1\|1502072_1502804_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_016723619.1\|1503441_1504407_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_103025693.1\|1504592_1505912_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_011002043.1\|1506048_1507377_+	MFS transporter	NA	NA	NA	NA
WP_011002042.1\|1507461_1508370_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_058907171.1\|1508369_1509878_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_103025694.1\|1509991_1510942_+	drug/metabolite DMT transporter permease	NA	NA	NA	NA
WP_058907173.1\|1511158_1512304_+	porin	NA	NA	NA	NA
WP_011002038.1\|1512459_1512735_-	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|1513089_1514055_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0

DBSCAN-SWA_12

1756022 : 1810131

Burkholderia_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|1756022_1756988_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_071653928.1\|1757390_1758215_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011003443.1\|1758323_1759655_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_011003941.1\|1773725_1774037_+	hypothetical protein	NA	NA	NA	NA
WP_086004755.1\|1774249_1774705_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_016725238.1\|1774918_1775935_+	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_019719365.1\|1776020_1777193_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_019719366.1\|1777189_1777990_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_019719367.1\|1777986_1778883_-	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
WP_071615411.1\|1778904_1780452_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_019719369.1\|1780553_1782257_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	8.2e-53	33.6
WP_019719370.1\|1782318_1783452_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_139274298.1\|1783500_1783749_-	hypothetical protein	NA	NA	NA	NA
WP_058908569.1\|1783717_1784734_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011003952.1\|1784791_1786192_-	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_016727922.1\|1786188_1786875_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-32	36.2
WP_058908570.1\|1787071_1788898_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_103025705.1\|1788894_1789929_+	copper resistance protein B	NA	NA	NA	NA
WP_011003956.1\|1789966_1790353_+	copper homeostasis periplasmic binding protein CopC	NA	NA	NA	NA
WP_103025706.1\|1790357_1791287_+	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_071507840.1\|1791469_1792534_-	porin	NA	NA	NA	NA
WP_016725486.1\|1793375_1793831_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_103025707.1\|1794081_1795440_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.5e-38	31.5
WP_058908573.1\|1795525_1796455_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058908574.1\|1796579_1797113_+	phosphonopyruvate decarboxylase	NA	NA	NA	NA
WP_058908586.1\|1797118_1797715_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_071507839.1\|1797739_1799209_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_058908576.1\|1799237_1799870_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_058908577.1\|1799873_1800785_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058908578.1\|1800966_1802145_+	CoA transferase	NA	NA	NA	NA
WP_058908587.1\|1802190_1803006_+	CoA ester lyase	NA	NA	NA	NA
WP_139274297.1\|1803016_1803592_-	hypothetical protein	NA	NA	NA	NA
WP_103025708.1\|1803800_1804151_+	hypothetical protein	NA	NA	NA	NA
WP_086005422.1\|1805272_1806423_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_103025508.1\|1806979_1808213_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_071615663.1\|1808255_1808831_+	hypothetical protein	NA	NA	NA	NA
WP_103025549.1\|1809048_1810131_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1894326 : 1911243

Leptospira_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|1894326_1895292_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_071615268.1\|1896143_1897202_-	hypothetical protein	NA	NA	NA	NA
WP_146605530.1\|1897198_1897777_-	hypothetical protein	NA	NA	NA	NA
WP_011003443.1\|1897844_1899176_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_058908884.1\|1899509_1900148_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_103025505.1\|1900677_1901142_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|1901141_1901492_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|1901523_1903095_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_038938784.1\|1903264_1904278_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025505.1\|1910778_1911243_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2022123 : 2071766

Bacillus_phage(22.22%)

tRNA,transposase,integrase

attL 2019979:2019993|attR 2058759:2058773

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2019979:2019993	attL	NA	NA	NA	NA
WP_019718806.1\|2022123_2023614_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_019718805.1\|2023613_2025002_-	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_011001754.1\|2025337_2025784_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_058908358.1\|2026039_2029024_-	avrbs3 family type III effector protein	NA	NA	NA	NA
WP_020832012.1\|2030716_2031628_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016723094.1\|2031702_2032119_-	hypothetical protein	NA	NA	NA	NA
WP_103025716.1\|2032208_2038229_-	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	5.0e-28	26.0
WP_071615359.1\|2038660_2045803_+	KR domain-containing protein	NA	NA	NA	NA
WP_058908439.1\|2046103_2047849_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.7e-33	26.2
WP_011001746.1\|2047845_2049702_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-36	27.7
WP_058908438.1\|2049809_2051885_-	TonB-dependent receptor	NA	NA	NA	NA
WP_103025875.1\|2052093_2055078_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_086706442.1\|2055083_2056793_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_103025549.1\|2056949_2058032_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_016727451.1\|2058692_2059100_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	7.3e-08	32.1
2058759:2058773	attR	NA	NA	NA	NA
WP_020371926.1\|2059285_2059852_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_038938484.1\|2060051_2060438_+	hypothetical protein	NA	NA	NA	NA
WP_103025478.1\|2062758_2063561_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_103025479.1\|2063722_2064154_+	DNA mismatch endonuclease Vsr	I6NSG0	Burkholderia_phage	1.8e-33	51.2
WP_103025480.1\|2064256_2064490_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_103025481.1\|2064486_2065584_+	DNA cytosine methyltransferase	Q7Y4B5	Escherichia_virus	6.4e-67	42.6
WP_158655360.1\|2065628_2068721_+	N-6 DNA methylase	R4TFP1	Halovirus	2.7e-09	33.8
WP_103025505.1\|2069348_2069813_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|2069812_2070163_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|2070194_2071766_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2

DBSCAN-SWA_15

2191937 : 2270522

Burkholderia_phage(24.24%)

capsid,portal,terminase,head,tRNA,tail,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|2191937_2192903_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_103025722.1\|2192986_2195677_-	hypothetical protein	NA	NA	NA	NA
WP_058908139.1\|2195654_2196788_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_158655387.1\|2197140_2197413_-	hypothetical protein	NA	NA	NA	NA
WP_103025859.1\|2197506_2198958_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_019718748.1\|2199119_2200595_-	GDL motif peptide-associated radical SAM/SPASM maturase	NA	NA	NA	NA
WP_058908140.1\|2200691_2201273_-	DUF1842 domain-containing protein	NA	NA	NA	NA
WP_011001664.1\|2201324_2201951_-	DUF1842 domain-containing protein	NA	NA	NA	NA
WP_011001663.1\|2202017_2202209_-	DUF1843 domain-containing protein	NA	NA	NA	NA
WP_158655388.1\|2202379_2202823_+	hypothetical protein	NA	NA	NA	NA
WP_019718747.1\|2203089_2207199_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	8.9e-178	73.2
WP_011001660.1\|2207336_2207903_-	winged helix DNA-binding protein	NA	NA	NA	NA
WP_011001659.1\|2207977_2209573_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_103025724.1\|2209631_2211251_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_011001657.1\|2211263_2211974_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-40	42.8
WP_020832084.1\|2212047_2212668_+	arylesterase	NA	NA	NA	NA
WP_011001655.1\|2212744_2213437_+	signal peptidase I	NA	NA	NA	NA
WP_020831502.1\|2213478_2214807_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_058907544.1\|2214940_2216887_-	hypothetical protein	NA	NA	NA	NA
WP_003267811.1\|2217309_2217582_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.6e-19	57.3
WP_011001653.1\|2217755_2220176_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.8e-224	53.1
WP_011001652.1\|2220346_2221621_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.9e-135	58.9
WP_003267806.1\|2221786_2222440_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.8e-53	54.9
WP_058907545.1\|2222469_2223819_-	trigger factor	NA	NA	NA	NA
WP_058907546.1\|2224073_2226047_-\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_011001649.1\|2226118_2226313_-	hypothetical protein	NA	NA	NA	NA
WP_103025877.1\|2226809_2227847_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_158655389.1\|2228412_2228985_+	hypothetical protein	Q3HQY5	Burkholderia_phage	8.9e-36	43.4
WP_158655390.1\|2228981_2229173_+	hypothetical protein	NA	NA	NA	NA
WP_103025565.1\|2229299_2230550_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	41.2
WP_103025726.1\|2230678_2231224_-	hypothetical protein	A0A0H5AUG6	Pseudomonas_phage	7.0e-06	35.4
WP_103025727.1\|2231223_2231499_-	hypothetical protein	NA	NA	NA	NA
WP_011001642.1\|2231501_2231810_-	hypothetical protein	NA	NA	NA	NA
WP_011001641.1\|2231809_2232301_-	glycoside hydrolase family protein	D5LH07	Escherichia_phage	8.7e-56	67.7
WP_072633591.1\|2232369_2233026_-	hypothetical protein	NA	NA	NA	NA
WP_103025728.1\|2233362_2236518_-	host specificity protein J	A4JX16	Burkholderia_virus	0.0e+00	56.8
WP_072633588.1\|2236568_2236823_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_028853154.1\|2236819_2237158_+	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_072633645.1\|2237227_2237830_-\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	4.6e-51	56.0
WP_072633587.1\|2237833_2238544_-	C40 family peptidase	D6PG99	uncultured_phage	9.0e-70	54.5
WP_103025729.1\|2238545_2239247_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	8.8e-78	63.3
WP_103025730.1\|2239243_2239840_-\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_103025731.1\|2239845_2240523_-\|tail	phage tail protein	D5LGZ0	Escherichia_phage	3.9e-30	50.6
WP_103025732.1\|2240519_2240858_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	3.4e-27	51.8
WP_103025733.1\|2240860_2243734_-\|tail	phage tail tape measure protein	A0A1V0E821	Vibrio_phage	1.8e-92	34.0
WP_081365331.1\|2243735_2243996_-	DUF1799 domain-containing protein	A0A2R3UAE2	Siphoviridae_environmental_samples	2.7e-08	43.9
WP_072633580.1\|2244043_2244364_-	hypothetical protein	I6PDG2	Cronobacter_phage	3.6e-10	40.0
WP_072633579.1\|2244370_2245024_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	3.4e-55	54.0
WP_103025734.1\|2245087_2245441_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_103025735.1\|2245430_2245931_-	hypothetical protein	I7GSL4	Xanthomonas_virus	5.1e-11	36.5
WP_103025736.1\|2245933_2246260_-\|head	phage head closure protein	A0A1W6JP44	Morganella_phage	1.1e-11	40.7
WP_103025737.1\|2246260_2246815_-	hypothetical protein	NA	NA	NA	NA
WP_103025738.1\|2246818_2247214_-	hypothetical protein	NA	NA	NA	NA
WP_103025739.1\|2247251_2248508_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	3.2e-139	60.3
WP_103025740.1\|2248572_2249337_-\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	2.1e-69	66.8
WP_103025741.1\|2249302_2250610_-\|portal	phage portal protein	C7BGG8	Burkholderia_phage	1.9e-113	52.7
WP_103025742.1\|2250606_2252265_-\|terminase	terminase large subunit	C7BGG7	Burkholderia_phage	2.8e-199	58.9
WP_103025878.1\|2252315_2252678_-	hypothetical protein	C7BGG6	Burkholderia_phage	9.3e-31	58.3
WP_103025743.1\|2253053_2253491_-	HNH endonuclease	C7BGG5	Burkholderia_phage	8.9e-28	53.4
WP_103025744.1\|2253662_2254265_-	hypothetical protein	NA	NA	NA	NA
WP_103025745.1\|2254288_2254585_-	hypothetical protein	NA	NA	NA	NA
WP_103025746.1\|2254581_2255616_-	hypothetical protein	NA	NA	NA	NA
WP_011001618.1\|2255612_2255810_-	hypothetical protein	NA	NA	NA	NA
WP_103025747.1\|2255818_2256229_-	hypothetical protein	NA	NA	NA	NA
WP_072633567.1\|2256225_2256729_-	hypothetical protein	NA	NA	NA	NA
WP_158655391.1\|2256974_2257223_-	hypothetical protein	NA	NA	NA	NA
WP_078222094.1\|2257285_2257810_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_103025879.1\|2258092_2258713_+	hypothetical protein	NA	NA	NA	NA
WP_103025748.1\|2259407_2259782_+	hypothetical protein	NA	NA	NA	NA
WP_103025749.1\|2259778_2260216_+	hypothetical protein	NA	NA	NA	NA
WP_103025750.1\|2260370_2260586_+	hypothetical protein	NA	NA	NA	NA
WP_072633562.1\|2260595_2261027_+	hypothetical protein	A0A291LIA5	Streptomyces_phage	4.7e-05	35.5
WP_103025751.1\|2261023_2261260_+	hypothetical protein	NA	NA	NA	NA
WP_103025752.1\|2261285_2261879_+	PRTRC system protein E	NA	NA	NA	NA
WP_071623742.1\|2261891_2262281_+	PRTRC system protein C	NA	NA	NA	NA
WP_103025753.1\|2262277_2263327_+	PRTRC system protein F	NA	NA	NA	NA
WP_072633557.1\|2263334_2264057_+	PRTRC system protein B	NA	NA	NA	NA
WP_103025754.1\|2264058_2264844_+	PRTRC system protein A	NA	NA	NA	NA
WP_103025755.1\|2264840_2265641_+	PRTRC system ThiF family protein	NA	NA	NA	NA
WP_103025756.1\|2265642_2267121_+	hypothetical protein	Q8W6Q9	Burkholderia_virus	7.7e-31	51.9
WP_071623736.1\|2267175_2267484_+	hypothetical protein	NA	NA	NA	NA
WP_103025505.1\|2268104_2268569_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|2268568_2268919_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|2268950_2270522_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2

DBSCAN-SWA_16

2541243 : 2549479

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011000872.1\|2541243_2542296_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-33	39.4
WP_011000871.1\|2542452_2543376_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	9.3e-43	35.9
WP_058907684.1\|2543493_2544606_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_011000869.1\|2544686_2545589_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
WP_011000868.1\|2545692_2546010_-	ComEA family DNA-binding protein	NA	NA	NA	NA
WP_011000867.1\|2546139_2547135_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	32.3
WP_049842162.1\|2547131_2548079_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
WP_016723343.1\|2548105_2549479_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9

DBSCAN-SWA_17

2572472 : 2616153

Leptospira_phage(18.18%)

integrase,tRNA,transposase

attL 2559174:2559192|attR 2622806:2622824

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2559174:2559192	attL	NA	NA	NA	NA
WP_038938784.1\|2572472_2573486_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058908641.1\|2575044_2576304_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014631870.1\|2576352_2577222_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_019719997.1\|2577218_2578187_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_028861886.1\|2578183_2578933_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.2e-16	28.2
WP_020830396.1\|2578929_2579640_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.0e-12	24.4
WP_058908642.1\|2579770_2581348_+	polyamine aminopropyltransferase	A0A1C9C533	Heterosigma_akashiwo_virus	5.5e-11	27.0
WP_058908643.1\|2581361_2582984_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_011004587.1\|2583019_2583736_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_014631877.1\|2583865_2584228_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_058908644.1\|2584265_2584955_+	glutathione S-transferase	NA	NA	NA	NA
WP_103025774.1\|2585070_2585259_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_103025505.1\|2585719_2586184_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|2586183_2586534_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|2586565_2588137_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_158655397.1\|2588180_2588759_-	hypothetical protein	NA	NA	NA	NA
WP_158655398.1\|2589389_2590565_-	hypothetical protein	NA	NA	NA	NA
WP_103025777.1\|2590561_2590993_-	hypothetical protein	NA	NA	NA	NA
WP_103025778.1\|2590985_2592884_-	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_103025779.1\|2592886_2593111_-	hypothetical protein	NA	NA	NA	NA
WP_103025780.1\|2593103_2593328_-	hypothetical protein	NA	NA	NA	NA
WP_158655399.1\|2593371_2594067_-	P-type conjugative transfer protein TrbJ	NA	NA	NA	NA
WP_103025508.1\|2594297_2595531_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_158655410.1\|2595718_2596462_-	plasmid stabilization protein	NA	NA	NA	NA
WP_103025782.1\|2596601_2596814_-	plasmid-related protein	NA	NA	NA	NA
WP_103025783.1\|2596897_2597734_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_158655400.1\|2597730_2597943_-	hypothetical protein	NA	NA	NA	NA
WP_103025784.1\|2597955_2599029_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	1.4e-42	37.0
WP_038962216.1\|2599420_2601907_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.3e-34	30.8
WP_058907659.1\|2602219_2604031_-	DNA primase	A0A1S5RH70	Helicobacter_phage	1.2e-46	34.2
WP_011002145.1\|2604071_2604521_-	GatB/YqeY domain-containing protein	A0A2I7SAL1	Vibrio_phage	5.2e-07	32.8
WP_058907660.1\|2604634_2605873_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011002147.1\|2605980_2607024_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.1e-95	52.0
WP_011002148.1\|2607069_2607876_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_011002149.1\|2608116_2610027_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_011002150.1\|2610085_2610985_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_028853416.1\|2610981_2611266_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_016722814.1\|2611598_2612696_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_011002153.1\|2612793_2613768_+	DMT family transporter	NA	NA	NA	NA
WP_016722812.1\|2613797_2614688_+	sulfurtransferase	NA	NA	NA	NA
WP_020831502.1\|2614824_2616153_+\|transposase	IS4 family transposase	NA	NA	NA	NA
2622806:2622824	attR	NA	NA	NA	NA

DBSCAN-SWA_18

2714187 : 2731107

Ralstonia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016721735.1\|2714187_2715153_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|2715149_2715299_+	hypothetical protein	NA	NA	NA	NA
WP_087451503.1\|2715295_2716101_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_016722750.1\|2716478_2716853_+	hypothetical protein	NA	NA	NA	NA
WP_011002241.1\|2717155_2718355_-	MFS transporter	NA	NA	NA	NA
WP_071615607.1\|2718386_2718935_-	serine hydrolase family protein	NA	NA	NA	NA
WP_011002243.1\|2719058_2719514_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_011002244.1\|2719621_2720581_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_064477942.1\|2720914_2721331_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_011002246.1\|2721350_2722178_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_071507948.1\|2722277_2722652_+	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_064477944.1\|2722874_2724440_-	MFS transporter	NA	NA	NA	NA
WP_086005422.1\|2725713_2726864_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_011003086.1\|2727015_2727552_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.8e-46	50.3
WP_020831479.1\|2727609_2728434_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103025478.1\|2728459_2729262_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_103025508.1\|2729872_2731107_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5

DBSCAN-SWA_19

2745115 : 2759480

Ralstonia_phage(33.33%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020829879.1\|2745115_2746117_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025787.1\|2746250_2747053_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_087451503.1\|2747163_2747968_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_016721735.1\|2748112_2749078_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_071624170.1\|2749199_2750165_-\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
WP_016726935.1\|2750371_2750893_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.2e-23	61.9
WP_058908760.1\|2751021_2751312_+	hypothetical protein	NA	NA	NA	NA
WP_016724179.1\|2751369_2751708_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_103025505.1\|2753109_2753574_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|2753573_2753924_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|2753955_2755527_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_016723619.1\|2756228_2757194_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_016722739.1\|2758163_2759480_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.1e-96	43.6

DBSCAN-SWA_20

2993013 : 3083104

Paramecium_bursaria_Chlorella_virus(12.5%)

protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020832586.1\|2993013_2994561_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6
WP_003271964.1\|2994560_2995070_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_011002539.1\|2995103_2995748_+	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	1.7e-06	27.8
WP_011002540.1\|2995804_2996629_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.9e-34	31.3
WP_011002541.1\|2996640_2997348_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_058907902.1\|2997355_2998042_+	energy-coupling factor ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	8.8e-14	27.2
WP_028860933.1\|2997997_2999878_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	A0A0B5J984	Pandoravirus	4.6e-57	37.4
WP_011002544.1\|2999913_3001056_-	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
WP_021155204.1\|3001190_3003152_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8
WP_058907913.1\|3003515_3003920_-	transcription elongation factor GreAB	NA	NA	NA	NA
WP_011002548.1\|3004183_3004606_-	thioredoxin family protein	NA	NA	NA	NA
WP_103025798.1\|3004621_3005266_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_071615277.1\|3005298_3005502_+\|transposase	transposase	NA	NA	NA	NA
WP_011002551.1\|3005549_3005738_+	hypothetical protein	NA	NA	NA	NA
WP_016724062.1\|3005751_3006147_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_058907901.1\|3006143_3007259_-	ferrochelatase	NA	NA	NA	NA
WP_021155202.1\|3007317_3008544_-	imidazolonepropionase	NA	NA	NA	NA
WP_058907900.1\|3008536_3009520_-	formimidoylglutamase	NA	NA	NA	NA
WP_028853576.1\|3009516_3011073_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.1e-67	38.3
WP_016725980.1\|3011090_3012896_-	urocanate hydratase	NA	NA	NA	NA
WP_011002558.1\|3013028_3013742_+	histidine utilization repressor	NA	NA	NA	NA
WP_011002559.1\|3013763_3014822_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_016723658.1\|3014936_3015866_+	NAD kinase	NA	NA	NA	NA
WP_011002561.1\|3015895_3017605_+	DNA repair protein RecN	NA	NA	NA	NA
WP_011002562.1\|3017686_3018133_+	hypothetical protein	NA	NA	NA	NA
WP_058907899.1\|3018311_3019943_+\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	NA	NA	NA	NA
WP_058907898.1\|3020158_3022201_+\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A1B0T6A2	Bacillus_phage	6.0e-10	34.7
WP_011002565.1\|3022256_3022877_-	rhombosortase	NA	NA	NA	NA
WP_058907897.1\|3022873_3025741_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_058907896.1\|3025920_3030201_+	TIGR02099 family protein	NA	NA	NA	NA
WP_011002568.1\|3030206_3031076_+	carbon-nitrogen hydrolase family protein	M1H5W0	Paramecium_bursaria_Chlorella_virus	8.3e-09	25.3
WP_058907895.1\|3031103_3032564_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_103025799.1\|3032956_3034036_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	1.5e-76	45.0
WP_058907894.1\|3034159_3034495_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011002572.1\|3034779_3035676_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_020832612.1\|3035749_3036307_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_103025800.1\|3036427_3037846_+	FAD-binding protein	NA	NA	NA	NA
WP_058907893.1\|3037856_3038747_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058907892.1\|3038917_3040411_+	FAD-binding protein	NA	NA	NA	NA
WP_058907891.1\|3040421_3041540_+	glycolate oxidase subunit GlcE	NA	NA	NA	NA
WP_058907890.1\|3041549_3042797_+	glycolate oxidase subunit GlcF	NA	NA	NA	NA
WP_058907889.1\|3042848_3043226_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_028853586.1\|3043222_3043945_+	LrgB family protein	NA	NA	NA	NA
WP_016723678.1\|3044102_3044498_+	VOC family protein	NA	NA	NA	NA
WP_016726000.1\|3044548_3045028_+	cupin domain-containing protein	NA	NA	NA	NA
WP_016723680.1\|3045070_3045769_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_011002584.1\|3045785_3046283_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	5.5e-26	40.2
WP_071623704.1\|3046378_3049591_-	pilus assembly protein	NA	NA	NA	NA
WP_011002586.1\|3049622_3050159_-	pilus assembly protein	NA	NA	NA	NA
WP_016723683.1\|3050162_3051191_-	PilW family protein	NA	NA	NA	NA
WP_028860948.1\|3051187_3051778_-	type IV pilus modification protein PilV	NA	NA	NA	NA
WP_016723684.1\|3051774_3052263_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_016723685.1\|3052266_3052707_-	type IV pilin protein	NA	NA	NA	NA
WP_103025801.1\|3052901_3054041_-	PilT/PilU family type 4a pilus ATPase	NA	NA	NA	NA
WP_011002592.1\|3054093_3055137_-	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_011002593.1\|3055261_3055984_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_028853591.1\|3056018_3056843_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_058907887.1\|3056864_3057143_+	hypothetical protein	NA	NA	NA	NA
WP_011002596.1\|3057139_3058015_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_003271865.1\|3058088_3058589_-	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	2.1e-20	36.2
WP_011002597.1\|3058747_3058990_-	hypothetical protein	NA	NA	NA	NA
WP_058907886.1\|3059048_3059297_-	hypothetical protein	NA	NA	NA	NA
WP_016723690.1\|3059515_3060460_-	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.0e-09	23.9
WP_011002600.1\|3061065_3061608_-	hypothetical protein	NA	NA	NA	NA
WP_011002601.1\|3061677_3062187_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_058907885.1\|3062183_3064448_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_049842205.1\|3064497_3065217_-	molecular chaperone	NA	NA	NA	NA
WP_058907884.1\|3065335_3065839_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_011002605.1\|3065888_3066392_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_103025859.1\|3067707_3069159_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_071615274.1\|3069392_3069653_+	hypothetical protein	NA	NA	NA	NA
WP_011002607.1\|3070625_3070922_-	hypothetical protein	NA	NA	NA	NA
WP_011002608.1\|3071072_3071390_-	hypothetical protein	NA	NA	NA	NA
WP_011002609.1\|3072728_3073013_-	hypothetical protein	NA	NA	NA	NA
WP_011002610.1\|3073106_3073433_-	hypothetical protein	NA	NA	NA	NA
WP_020831502.1\|3073945_3075274_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_071615273.1\|3075320_3075485_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-06	55.1
WP_103025885.1\|3076253_3076508_+	translation initiation factor 1	NA	NA	NA	NA
WP_020832646.1\|3076606_3076819_+	hypothetical protein	NA	NA	NA	NA
WP_019718280.1\|3077300_3077618_+	hypothetical protein	NA	NA	NA	NA
WP_038938784.1\|3078346_3079360_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025549.1\|3081015_3082098_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_103025506.1\|3082289_3082640_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|3082639_3083104_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_21

3311022 : 3318463

Microbacterium_phage(100.0%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019717364.1\|3311022_3311544_-\|tail	phage tail protein	A0A2R4A082	Microbacterium_phage	1.2e-15	36.0
WP_058908151.1\|3311558_3312092_-\|tail	phage tail protein	A0A2R3ZZT3	Microbacterium_phage	1.2e-13	32.7
WP_103025827.1\|3312101_3312650_-\|tail	phage tail protein	NA	NA	NA	NA
WP_103025859.1\|3314493_3315945_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_103025828.1\|3316029_3316813_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011003443.1\|3317131_3318463_-\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

3333881 : 3386645

Leptospira_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071624213.1\|3333881_3335453_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025506.1\|3335484_3335835_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|3335834_3336299_-\|transposase	transposase	NA	NA	NA	NA
WP_103025829.1\|3337209_3340185_-	conjugative relaxase	NA	NA	NA	NA
WP_103025830.1\|3340594_3340876_-	hypothetical protein	NA	NA	NA	NA
WP_158655407.1\|3341028_3341280_-	hypothetical protein	NA	NA	NA	NA
WP_103025832.1\|3341339_3342188_-	type IV secretion system protein	NA	NA	NA	NA
WP_158655408.1\|3342180_3342573_-	hypothetical protein	NA	NA	NA	NA
WP_103025834.1\|3342722_3343524_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103025859.1\|3343636_3345088_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_058908327.1\|3346115_3346958_+	nucleotidyltransferase domain-containing protein	A0A2D1GQQ2	Pseudomonas_phage	3.6e-49	45.3
WP_058908328.1\|3346999_3348043_+	RNA 3'-terminal phosphate cyclase	NA	NA	NA	NA
WP_080705157.1\|3348735_3349014_+	hypothetical protein	NA	NA	NA	NA
WP_011000196.1\|3349327_3350536_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_011000197.1\|3350755_3351952_-	membrane protein	NA	NA	NA	NA
WP_058908329.1\|3351959_3352595_-	LysE family translocator	NA	NA	NA	NA
WP_103025546.1\|3353041_3354028_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_011000199.1\|3354225_3355032_+	hypothetical protein	NA	NA	NA	NA
WP_071615382.1\|3355188_3356169_-	DMT family transporter	NA	NA	NA	NA
WP_058908331.1\|3356295_3357042_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_058908332.1\|3357592_3357949_-	DUF427 domain-containing protein	NA	NA	NA	NA
WP_058908333.1\|3358130_3359201_-	hypothetical protein	NA	NA	NA	NA
WP_058908334.1\|3359556_3362856_+	methylmalonyl-CoA mutase family protein	NA	NA	NA	NA
WP_011000205.1\|3363048_3363759_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_071615379.1\|3363748_3365587_-	amidohydrolase	NA	NA	NA	NA
WP_028860116.1\|3365591_3366029_-	DoxX family protein	NA	NA	NA	NA
WP_028852503.1\|3366043_3366334_-	XapX domain-containing protein	NA	NA	NA	NA
WP_058908336.1\|3366428_3367115_-	hydrolase	NA	NA	NA	NA
WP_016722398.1\|3367327_3368260_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011000211.1\|3368443_3369298_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_058908337.1\|3369323_3370796_-	type III effector	NA	NA	NA	NA
WP_038938784.1\|3371685_3372699_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058908338.1\|3373921_3374386_-	hypothetical protein	NA	NA	NA	NA
WP_086005422.1\|3376235_3377385_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_139274287.1\|3381205_3381607_-	hypothetical protein	NA	NA	NA	NA
WP_058908834.1\|3382332_3383190_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_058908835.1\|3383220_3384744_-	DUF1254 domain-containing protein	M1HNU9	Paramecium_bursaria_Chlorella_virus	1.4e-19	23.9
WP_089190850.1\|3385278_3386645_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.2e-76	53.8

DBSCAN-SWA_23

3600709 : 3662170

Tupanvirus(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058907490.1\|3600709_3602533_+\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	9.2e-10	26.0
WP_020831230.1\|3602706_3603576_+	hypothetical protein	NA	NA	NA	NA
WP_016726635.1\|3603652_3604126_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_011000430.1\|3604127_3604874_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_011000431.1\|3604870_3606139_+	cardiolipin synthase ClsB	NA	NA	NA	NA
WP_058907483.1\|3606174_3607836_+	CoA-transferase	NA	NA	NA	NA
WP_020831236.1\|3608264_3608855_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_028852596.1\|3608907_3610695_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_019717522.1\|3610771_3613255_+	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_011000436.1\|3613287_3614487_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_011000437.1\|3614595_3615360_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_020831502.1\|3615498_3616827_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011000438.1\|3616873_3617293_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_028860191.1\|3617399_3619226_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.7e-46	28.2
WP_020831241.1\|3619440_3620385_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011000441.1\|3620538_3621840_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_028852598.1\|3622377_3623274_+	glutamate/aspartate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020831242.1\|3623373_3624102_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011000444.1\|3624122_3624806_+	glutamate/aspartate ABC transporter permease GltK	NA	NA	NA	NA
WP_011000445.1\|3624802_3625537_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-31	39.7
WP_011000446.1\|3625604_3626435_-	class II glutamine amidotransferase	NA	NA	NA	NA
WP_021156006.1\|3626608_3627700_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_058907485.1\|3627696_3628995_+	glycerate kinase	NA	NA	NA	NA
WP_011000448.1\|3629031_3630066_+	dihydroorotase	NA	NA	NA	NA
WP_011000449.1\|3630068_3630881_+	DUF3025 domain-containing protein	NA	NA	NA	NA
WP_058907486.1\|3631240_3631687_-	OsmC family protein	NA	NA	NA	NA
WP_103025843.1\|3632376_3632793_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_011000451.1\|3632802_3633195_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_011000452.1\|3633424_3634180_+	hypothetical protein	NA	NA	NA	NA
WP_011000453.1\|3634214_3634619_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_003265486.1\|3634747_3635122_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	2.6e-28	56.5
WP_028852601.1\|3635185_3636346_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_016724018.1\|3636520_3637792_+\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_011000456.1\|3637788_3638289_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_058907487.1\|3638306_3638438_+	hypothetical protein	NA	NA	NA	NA
WP_011000458.1\|3638437_3639121_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_011000459.1\|3639200_3640274_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.7e-08	26.8
WP_019717529.1\|3640337_3640919_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_020831261.1\|3640970_3642107_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_016726644.1\|3642202_3642748_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_103025478.1\|3642886_3643688_+\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_020829879.1\|3643822_3644824_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_071653928.1\|3645160_3645985_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103025859.1\|3646196_3647648_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_028852449.1\|3651569_3652754_-	nitronate monooxygenase	NA	NA	NA	NA
WP_019717361.1\|3653171_3655067_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_011000079.1\|3655080_3656220_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013213874.1\|3656216_3656444_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_058908149.1\|3656453_3657281_+	thiazole synthase	NA	NA	NA	NA
WP_058908148.1\|3657277_3658429_+	thiamine monophosphate synthase	NA	NA	NA	NA
WP_011000074.1\|3658555_3659035_+	VOC family protein	A0A2K9L4N3	Tupanvirus	7.5e-28	46.0
WP_058908147.1\|3659481_3660306_+	hypothetical protein	NA	NA	NA	NA
WP_087451503.1\|3661365_3662170_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3698356 : 3756718

Prochlorococcus_phage(11.11%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011000041.1\|3698356_3699217_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_028860038.1\|3699335_3699983_-	LysE family translocator	NA	NA	NA	NA
WP_028860037.1\|3700017_3701001_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.1e-08	32.8
WP_058907960.1\|3701046_3703020_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_011000037.1\|3703067_3703577_-	peptide deformylase	NA	NA	NA	NA
WP_011000036.1\|3703830_3705003_+	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	2.9e-09	50.0
WP_011000035.1\|3705020_3706226_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	4.2e-27	41.5
WP_011000034.1\|3706266_3706656_+	thioredoxin family protein	NA	NA	NA	NA
WP_058907959.1\|3706886_3709520_+	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	2.8e-15	24.8
WP_011000032.1\|3709621_3710560_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058907958.1\|3711015_3712710_+	AMP-binding protein	A0A1V0SBX8	Catovirus	4.0e-15	25.2
WP_011000030.1\|3712742_3713885_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_020830846.1\|3713908_3716314_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_011000028.1\|3716336_3716849_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_011000027.1\|3716860_3717901_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_011000026.1\|3718078_3719122_-	rod shape-determining protein	NA	NA	NA	NA
WP_011000025.1\|3719599_3719899_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_058907956.1\|3719990_3721478_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_011000023.1\|3721518_3722019_+	hypothetical protein	NA	NA	NA	NA
WP_071615197.1\|3721997_3722975_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_028852425.1\|3723060_3724527_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_011000020.1\|3724526_3725240_+	DUF484 family protein	NA	NA	NA	NA
WP_058907953.1\|3725253_3726243_+	tyrosine recombinase XerC	A0A2H4PCY2	Mycobacterium_phage	1.1e-12	29.8
WP_028860027.1\|3726282_3727476_+	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_087451503.1\|3727584_3728389_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_058907952.1\|3728489_3730016_+	FAD-binding oxidoreductase	S4VXI2	Pandoravirus	7.9e-23	26.3
WP_058907951.1\|3730028_3731285_+	lactonase family protein	NA	NA	NA	NA
WP_011000015.1\|3731373_3731892_+	transcriptional repressor	NA	NA	NA	NA
WP_016722621.1\|3731879_3732968_+	GTP-binding protein	NA	NA	NA	NA
WP_011000013.1\|3733377_3733797_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_043876519.1\|3733866_3735165_+	GTP-binding protein	NA	NA	NA	NA
WP_071615196.1\|3735265_3736858_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011000010.1\|3737003_3737540_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_011000009.1\|3737574_3738906_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.3e-42	30.2
WP_016726757.1\|3739123_3740416_-	hypothetical protein	NA	NA	NA	NA
WP_011000007.1\|3740613_3741192_-	response regulator transcription factor	NA	NA	NA	NA
WP_071615246.1\|3741238_3742585_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_016722626.1\|3742727_3743231_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_103025845.1\|3743279_3743495_+	hypothetical protein	NA	NA	NA	NA
WP_058907950.1\|3743536_3743734_-	hypothetical protein	NA	NA	NA	NA
WP_028852417.1\|3743779_3743995_-	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_011000001.1\|3744007_3744601_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011000000.1\|3744776_3745709_+	acetylglutamate kinase	NA	NA	NA	NA
WP_020830828.1\|3745708_3746572_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_058907949.1\|3746610_3747276_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_020831502.1\|3747403_3748732_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_028852416.1\|3748778_3750275_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010999996.1\|3750425_3751706_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.7e-24	27.7
WP_058908841.1\|3751710_3753204_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_058908842.1\|3753483_3754695_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_010999993.1\|3754691_3755339_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_020831502.1\|3755389_3756718_-\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025986

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025986_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025986_2

307538-307602

Orphan

Consensus_repeat	Method
CCACGACGGGCAGCACCGGCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025986_2

>merge|NZ_CP025986|2|307538-307602|CRISPRCasFinder
CCGGTCTGGGCAGCATCGGCACCAACCCGAATCCGATCGGCACCACCGTCGCCAGCAGCGGCAAC

>NZ_CP025986|2|2|307538-307602|CRISPRCasFinder
CCGGTCTGGGCAGCATCGGCACC	AACCCGAATCCGATCGGCA
CCACCGTCGCCAGCAGCGGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025986.1\|WP_028861309.1\|308648_308852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025986.1\|WP_103025913.1\|317624_317969_+\|toxin	unknown	unknown	unknown
NZ_CP025986.1\|WP_011003438.1\|313320_314484_-\|2-methylcitrate-synthase	unknown	unknown	gnl\|CDD\|183463
NZ_CP025986.1\|WP_038962849.1\|314535_315432_-\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_CP025986.1\|WP_020425351.1\|317965_318277_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225495
NZ_CP025986.1\|WP_071507368.1\|309448_310639_-\|2-methylaconitate-cis-trans-isomerase-PrpF	unknown	unknown	gnl\|CDD\|131387
NZ_CP025986.1\|WP_019719753.1\|295040_295814_+\|molybdate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270255
NZ_CP025986.1\|WP_043885575.1\|318416_319226_-\|DUF2242-domain-containing-protein	unknown	unknown	gnl\|CDD\|378349
NZ_CP025986.1\|WP_103025912.1\|303367_304930_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP025986.1\|WP_058907717.1\|297293_297944_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025986.1\|WP_058907754.1\|300076_302122_+\|DUF3488-domain-containing-protein	unknown	unknown	gnl\|CDD\|378784
NZ_CP025986.1\|WP_011003431.1\|305197_305980_+\|membrane-protein	unknown	unknown	gnl\|CDD\|227049
NZ_CP025986.1\|WP_011003424.1\|295827_297126_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_CP025986.1\|WP_058907715.1\|302602_303247_+\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|238448
NZ_CP025986.1\|WP_058907711.1\|310635_313233_-\|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD	unknown	unknown	gnl\|CDD\|131386
NZ_CP025986.1\|WP_028853948.1\|306033_306441_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025986.1\|WP_011003435.1\|308936_309320_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370209
NZ_CP025986.1\|WP_058907710.1\|315624_317574_+\|propionate-catabolism-operon-regulatory-protein-PrpR	unknown	unknown	gnl\|CDD\|226350
NZ_CP025986.1\|WP_058907755.1\|299033_300080_+\|DUF58-domain-containing-protein	unknown	unknown	gnl\|CDD\|224635
NZ_CP025986.1\|WP_058907716.1\|298048_299014_+\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786

Protein	Function_ID	Function_description	E-value
NZ_CP025986.1\|WP_058907711.1\|310635_313233_-\|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD	gnl\|CDD\|131386	TIGR02333, 2-methyl_citrate_dehydratase_Fe-S_dependent_AcnD, 2-methylisocitrate dehydratase, Fe/S-dependent. Members of this family appear in an operon for the degradation of propionyl-CoA via 2-methylcitrate. This family is homologous to aconitases A and B and appears to act the part as 2-methylisocitrate dehydratase, the enzyme after PrpD and before PrpB. In Escherichia coli, which lacks a member of this family, 2-methylisocitrate dehydratase activity was traced to aconitase B (TIGR00117) ().	0
NZ_CP025986.1\|WP_011003438.1\|313320_314484_-\|2-methylcitrate-synthase	gnl\|CDD\|183463	PRK12351, PRK12351, methylcitrate synthase; Provisional.	0
NZ_CP025986.1\|WP_038962849.1\|314535_315432_-\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0
NZ_CP025986.1\|WP_020425351.1\|317965_318277_+\|transcriptional-regulator	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	2.13173e-15
NZ_CP025986.1\|WP_103025912.1\|303367_304930_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.23449e-97
NZ_CP025986.1\|WP_019719753.1\|295040_295814_+\|molybdate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270255	cd13537, PBP2_YvgL_like, Substrate binding domain of putative molybdate-binding protein YvgL and similar proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.41465e-80
NZ_CP025986.1\|WP_043885575.1\|318416_319226_-\|DUF2242-domain-containing-protein	gnl\|CDD\|378349	pfam10001, DUF2242, Uncharacterized protein conserved in bacteria (DUF2242). This domain is found in various hypothetical bacterial proteins, and has no known function.	7.31013e-71
NZ_CP025986.1\|WP_071507368.1\|309448_310639_-\|2-methylaconitate-cis-trans-isomerase-PrpF	gnl\|CDD\|131387	TIGR02334, conserved_hypothetical_protein, probable AcnD-accessory protein PrpF. The 2-methylcitrate cycle is one of at least five degradation pathways for propionate via propionyl-CoA. Degradation of propionate toward pyruvate consumes oxaloacetate and releases succinate. Oxidation of succinate back into oxaloacetate by the TCA cycle makes the 2-methylcitrate pathway a cycle. This family consists of PrpF, an incompletely characterized protein that appears to be an essential accessory protein for the Fe/S-dependent 2-methylisocitrate dehydratase AcnD (TIGR02333). This protein is related to but distinct from FldA (part of pfam04303), a putative fluorene degradation protein of Sphingomonas sp. LB126. [Energy metabolism, Fermentation].	0
NZ_CP025986.1\|WP_058907717.1\|297293_297944_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.37502e-12
NZ_CP025986.1\|WP_058907754.1\|300076_302122_+\|DUF3488-domain-containing-protein	gnl\|CDD\|378784	pfam11992, DUF3488, Domain of unknown function (DUF3488). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is typically between 323 to 339 amino acids in length. This domain is found associated with pfam01841. This domain has a conserved PLW sequence motif. This domain contains 6 transmembrane helices.	5.08637e-93
NZ_CP025986.1\|WP_011003431.1\|305197_305980_+\|membrane-protein	gnl\|CDD\|227049	COG4705, COG4705, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	5.74696e-113
NZ_CP025986.1\|WP_011003424.1\|295827_297126_-\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.32886e-91
NZ_CP025986.1\|WP_058907715.1\|302602_303247_+\|carbonic-anhydrase	gnl\|CDD\|238448	cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	3.69648e-98
NZ_CP025986.1\|WP_011003435.1\|308936_309320_+\|hypothetical-protein	gnl\|CDD\|370209	pfam08956, DUF1869, Domain of unknown function (DUF1869). This domain is found in a set of hypothetical bacterial proteins.	0.000872881
NZ_CP025986.1\|WP_058907710.1\|315624_317574_+\|propionate-catabolism-operon-regulatory-protein-PrpR	gnl\|CDD\|226350	COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms].	0
NZ_CP025986.1\|WP_058907755.1\|299033_300080_+\|DUF58-domain-containing-protein	gnl\|CDD\|224635	COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only].	5.88245e-39
NZ_CP025986.1\|WP_058907716.1\|298048_299014_+\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	1.81415e-91

>NZ_CP025986.1|WP_028853948.1|306033_306441_+|hypothetical-protein
MIRKLTPTLAAASLVLFMAAAGHVVPTHFSVINTAHAATAALGDLGAFRAIAVDTAAIVDRGDLPGAKQRIKDLEVSWDAAEAGLKPRSASDWHRVDKAIDRALDALRAGKPDAATCRQTLAELIQTIDQASGKR
>NZ_CP025986.1|WP_011003431.1|305197_305980_+|membrane-protein
MDARPMRALPGALNKVPQVALGFWIIKILSTTVGETGADFLAVNVGLGTAITGGAMAALLLAALGAQLRARRYVPWLYWLTVVLVSIVGTQITDLLTDRLGVSLYVSTAVFSVALLAIFAIWYRTERTLSIQAIDTRRRELFYWAAILCTFALGTAAGDLATEAIGLGFQRGIVVFGMLIALAAAAYRLGADKVLAFWAAYILTRPLGAALGDFLSQSPAYGGAGLGAMVTSAVFLAVIAVLVAFAQREASRADVAVTVS
>NZ_CP025986.1|WP_103025912.1|303367_304930_+|SulP-family-inorganic-anion-transporter
MQTPTQPAFFPRDMLAGTIVFFVALPLCLGIASASGVDPLAGLMSGMIGGLVVALLSGSQLSVSGPAAGLVVIVVDGIAKLGGFSAFLMAVLLSGVLQFVFGMLRAGRFAAYVPSSVIKGMLAAIGLLLIIKQVPLAFGFARADAAAAAGAIVTPFGSVSAAAMAVTALSAAVLIGWETRALRRFLLVRALPAPLMVVALGIGVTLLLDAVAPGVAPPVEHRVGLPSLASFGALFDALQSPSLDALTNPDVWQLALALAIVASLETLLSLEAVEQIDPKKRPAPADRELKAQGIGNMMAGVFGALPITSVIVRSSANVQAGAQSRWSAVVHGALLLASVFTLTSIVNLIPLACLATILIFTGFKLAKPSLFVSVARQGVERFAPFIVTIVGVLLTDLLIGILMGIALSIALAIRANLRRSIVMARHHDHFLLSFRKDVSFMGKVPLKRYLAQVPDYTTLIIDASRADYIDPDVRELVERFIEDAPSRGILIERHHFDAAAPQPARASKLLKLRFSRCPAR
>NZ_CP025986.1|WP_058907715.1|302602_303247_+|carbonic-anhydrase
MYRPKRMLVGNVAWAHEIAERDPRFFSRLAQGQKPQVLWIGCADSRVPAETITHSNPGDLFVHRNIANLVCPADDNTMSVLEYAVRVLKVGHIIVCGHDGCGGVRASLLPQSDALPHVNRRIGPLCALAGRHRAELDAVPDMDDRVNRLAELNVLEQVRWLRESSIVREAEPAPRVHGWIFGLADGRIRVLGSGEPGEAPPVRGDILEPAEAEA
>NZ_CP025986.1|WP_058907754.1|300076_302122_+|DUF3488-domain-containing-protein
MNAAFGSARALTHREHGRLIALLALVLAPLLRSLPLVTCSVFGVLLLWRTGLWVRRAPLPNKWLLGVTGAAVLGITLVLALRTGGNIGRDLSVAVLGAFLVLKLMESHTVRNGILVTQLCCFLLLSQTLFDQPPWMAATLLASVGLLLHHWMVLLHPQAPARLSVAGVLLRLVMTGLPCAAVLFLLFPRLDHPLWRLPQGADVATSGLTDRMAPGSIGQLILSDDLAFRADFNGVPPPSGARYWRGIVLWRFDGQAWTASSFRQRAEPASVPNSAGVSDSGGVPDSANARPGAGRLVDYSITLEPTRQRWLFALDRGVSIDARDGLRRSIDAEFLSAHPLDERIRYHARSRLPGPGTGDEEALDPLTQQLALALPPGNPQARALAAQWAGLAPAERVASALKLFRDAPFAYTLEPEPLRGEQIDDFLFRTRRGFCEHYAGSFVFLMRAAGVPARVVVGYQGGEDNAVSGDLIVRQSDAHAWAEVWLRGRGWVRVDPTAAVAPQRVERGLAGAVPASEFRSRRVQEPAWLRSVRWGLDGLISGWNRWVLGYDRARQARLFAWLGLEAADPRAVLWGVSALFLLAALPLLWQQRRPRPDPVQAQWQRVCDRLARHGCVRGAAEGPMAYAERAAARFPQAADALRRVAAGYVALRYGRDDGDAQARAQRLAQWRKDIAALRVSG
>NZ_CP025986.1|WP_058907755.1|299033_300080_+|DUF58-domain-containing-protein
MPLWSALSRALPGLRFARERVQRFLSRPRRPRDGAIRLDRRHVYILPTATGAGFALLLVAMLLTSLNYNVSLGFLLTFLLAGVMASAMWQTHRNLVDLEVRGAVGEPVFAGRAVNVSVALANATAWARVGVETGARDAASAESSLDAHDGTLTALSFGAQPRGWFRLPRLTVSTRFPLGLFRAWSYADAPLTLLVYPEPEAAAPPLPAAFAPDPGEADDPRVARPRPDEAADQLRPYRPGDPLRSIAWKHSARLDTWLARSGQQVRHAQCVLAWDALPPPMEAEARLSRLCAWVLAAEQAPAGEAPEYTLVLPGLAIGPARGPAHRDACLRALALWGRPPVPEPEEAA
>NZ_CP025986.1|WP_058907716.1|298048_299014_+|MoxR-family-ATPase
MTSVQSSLSSVHPAPATQPLSLPAALSQAQRALDRIVLGKPLQIRLALACLLARGHLLLEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIYVKDTGAFEFHPGPLFAQVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFVIATQNPLNQIGTHPLPESQLDRFTMRLSLGYPDQRSERALYLGGGAAQAIEPALTAAQVVALQTATDAVHVAPALVDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALIDGRDAVLPEDVQAVFNAVAAHRLLPTGGMLSATALAQRLLDTVAIP
>NZ_CP025986.1|WP_058907717.1|297293_297944_+|TetR/AcrR-family-transcriptional-regulator
MAARGPRALSSTDNTKTASRRISGEAAQASLLEAARELFYQEGVRAVGVEAVVERAGVNKMSLYRQFKSKDDLVLAYLARSAENFWGYFNASMDAHPDDARAQLLQFFIDLSGRASQAGYRGCPFVNVAAEFRDPSHPARQFVERNKSQLLARLRERAAAAGAIDPDTLADDLAFLIEGAYTASQTFGAGAPRLMRSLPRTAATLLAAAIPARTAA
>NZ_CP025986.1|WP_011003424.1|295827_297126_-|MFS-transporter
MQRLARLIAPRFHYGWIALAVVFLILLCAAGTRATPSVMMLPLEHEFGWSRGTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALVVLISGTALSAMMSQPWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTTHRGLAMGILTASSATGQLVFLPMMAAVVERHGWRPVVLIVAGALVLLLPIVGLLLPESPKSVGLRTYGEPADAPEADHGPRANPIALAMHTLMQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGLTEVKGASLLAAMGIFDLVGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGLDWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGLMRASLGNYTLASMISGGLCVAGAFLVLRIHRQRKPDAQASGQPATA
>NZ_CP025986.1|WP_019719753.1|295040_295814_+|molybdate-ABC-transporter-substrate-binding-protein
MSRFSLRACVRAAGLAAVLSLGLGAQAQAAELVVSAAASLTNAFKTLAQSYEAQHPDTRVVLNFGASDVLMQQIVRGAPADVFASADQEAMDKAVSEKVIQSGSRRDFVANQLVLIVPSASAVPVHALGDLARPEVQRVAIGNPASVPVGRYAKRALEAAGLWQPVSAKAVLAQNVRQALDYVARGEVEAGLVFATDAAIAADKVKVAAPVPLSVPLTYPIAVTAGTRQPQQAADFVAFVLSPAGQAILARYGFLKP
>NZ_CP025986.1|WP_028861309.1|308648_308852_+|hypothetical-protein
MRELDSQFKAQRVRSEPLGKTLNGFARSGSLPSDLYSELGGLCQGMQATEKELAAITACMEERDGGG
>NZ_CP025986.1|WP_011003435.1|308936_309320_+|hypothetical-protein
MSEQRNASPSHPQDAVYMPDGVRIDNPDGGYTVTNPNGVSVDYQPDGSIEGQIPVIRALCVQDIAKVVRHDIARVFDTVSHTLHFEGGGVLSYMHASNGRGYEFSGHNVFVQADKDGCVIVHGTCME
>NZ_CP025986.1|WP_071507368.1|309448_310639_-|2-methylaconitate-cis-trans-isomerase-PrpF
MTHPAQIRIPATYMRGGTSKGVFFRLQDLPAAAQVPGAARDALLLRVIGSPDPYGKQIDGMGGATSSTSKTVILSKSARPDHDVDYLFGQVSIDKPFVDWSGNCGNLSAAVGPFAISNGLVDAGRIPHNGVATVRIWQANISKTIVAHVPIAHGAVQETGDFELDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLDVPGIGTLKATLINAGIPTIFVDAASIGYTGTELQDAINGDPKALAMFETLRAHGAVRMGLIRHVDEAATRQHTPKVAFVAPPRDYVASSGKRVDAGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGERHAVRFGHPSGTLRVGAEASRADGEWTVTKAIMSRSARVLMEGWVRVPGAG
>NZ_CP025986.1|WP_058907711.1|310635_313233_-|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD
MNTAYRKPLPGTSLDYFDARAAVEAIAPGAYDTLPYTSRVLAENLVRRCDPATLADSLRQLIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDHSLAVECGGDDPDAFAKNRAIEDRRNEDRFHFIEWTKLAFKNVDVIPAGNGIMHQINLEKMSPVIHAKDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGVELTGERQPGITATDIVLALTEFLRQQKVVGAYLEFHGEGAARLTLGDRATISNMAPEYGATAAMFSIDPQTLDYLRLTGRADEQVRLVETYAKAAGLWSDTLKHAAYERVLRFDVSSVVRNMAGPSNPHARVATTDLAAKGIAGRWDDVPGQMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANRLGLVRKPWVKSSLAPGSKAVALYLEAAGLKTELEALGFGIVAFACTTCNGMSGALDPTIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTVRFDIERDSFGTGPDGQPITLKDLWPSDAEIDAIVRASVKPEQFRQVYIPMFDQRSEATASVSPLYDWRAQSTYIRRPPYWEGALAGERTLRGLRPLAVLGDNITTDHLSPSNAILADSAAGEYLAKMGLPEADFNSYATHRGDHLTAQRATFANPTLRNEMAVVDGEVKKGSLARIEPEGKVTRMWEAIEAYMARKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTTRITLGIDGTETFDVIGARTPRADLTLVVHRKNGERVDVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESAKEAA
>NZ_CP025986.1|WP_011003438.1|313320_314484_-|2-methylcitrate-synthase
MSEADSSTPAGAFKPKKSVALSGVTAGNTALCTVGRTGNDLHYRGYDILDLAAACEFEEVAYLLVHGKLPNKAELTTYKARLKALRGLPANVKAALEWVPASAHPMDVMRTGVSVLGTVLPERDDHNLPGARDIADRLMASLGSMLLYWYHYSHNGRRIEVETDDDSIGGHFLHLLHGVEPSKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQKRYDTPDEAEADVRRRVEAKEVIIGFGHPVYTISDPRNKVIKEVARKLSKEAGNTRMFDIAERLETVMWDVKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVISRTSGWAAHVIEQRIDNKIIRPSANYTGPEDLKFVPLGKR
>NZ_CP025986.1|WP_038962849.1|314535_315432_-|methylisocitrate-lyase
MSTSKRHPASAGARFRQAVAESQPLQVVGAITAYAARMAEQTGFKAVYLSGGGVAANSLGIPDLGISTMDDVLIDARRITDAVGIPLLVDIDTGWGGAFNIARTVRSFIKAGVAAVHLEDQVGQKRCGHRPGKEVVCADEMVDRVKAAVDARTDGDFVIMARTDAAASEGLDAAIARAVAYVEAGADMIFPEAMKTLDDYRRFKAAVKVPILANLTEFGSTPLFTVDELRGADVDIALYCCGAYRAMNAAALGFYRTVMRDGTQQAAVQTMQTRADLYHYLGYHAYEDKLDALFAAQK
>NZ_CP025986.1|WP_058907710.1|315624_317574_+|propionate-catabolism-operon-regulatory-protein-PrpR
MSTAPHLAFRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRGFEDIVREIEAAGAERPDVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARREAESVALVTHGDTPDEVRRFVAAYGMDVVFAAYQSRQDAESCVLDLRDRGVGAVVGPGLVTDLAAQAGLHAVFLYSRDSVRAAFDTALEVVQATRREGQRRQRLDNLLQHLRDGVVALDAQGRVEAINQRLATALGIDARQAAGQPLLASAPNLLGLLPDTDGDTLGTVRGVSYVIHRGPLASTGAGAADGTVFTFQESRAVERLDRTLRSGQRAPQFTARYRIDDLIGASAPMERVRALVRRYARSDATVLVLGESGTGKEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFGYEEGAFTGARKGGKTGLIEAAHRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTDAVEAGTFRADLYYRLNILSIALPPLRDRPGDVLPLAAELLVQAARREPRLLLRIPDTEVAARVLAGVADPLRRYPWAGNVRELQSVVERIAVELADTDAMDAGAITQDVLRVIAPEVFEARRQGKKAALSLRERSRGVEAEAIRAALAAHGGDRDAVCKALRISKTTLWRRLNAE
>NZ_CP025986.1|WP_103025913.1|317624_317969_+|toxin
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWMFVVYDKGEADDLSSDERKVLARLLEQDVKARSER
>NZ_CP025986.1|WP_020425351.1|317965_318277_+|transcriptional-regulator
MKRNLFAELKEGMDALAAEREGKMTLRKVKVRVLQPLDVTAEEIKAVRAAAHASQAVMARRLRVNVRTYQNWEQGTAKPNTQAAVLIKLVEKHPETLQMLEAL
>NZ_CP025986.1|WP_043885575.1|318416_319226_-|DUF2242-domain-containing-protein
MPYRFRQLSASCAIATLLSACNSAPTPLYQQEEFDAAKSPYARTFQAKSDATCEAARRALLSQGYVSSSPRLDTIDGSKNFQPSNDSHVVIAFHVVCADASADGASSTAYVNAVQDRYTLKKTSTSASVGLSVLGSVSLPISSSDDSMVKVASETIPAGVFYERFFNLVDHFLKIDPTQRDRATVKAAEKEHVAPLPEPAPTPQGEPMKMTTPVAPTPPAPPVPVAPAAAAATAPASKAPAEPTPAATTDATAPTAASAPAAANAGDAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025986_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025986_1

307190-307309

Orphan

Consensus_repeat	Method
CCACGACGGGCAGCACCGGCAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP025986_1

>merge|NZ_CP025986|1|307190-307309|CRISPRCasFinder
CCACGACGGGCAGCACCGGCAGCGGTTCCGACGACACCACGACGGGCAGCACGGGCAGCGGCTCCGGCAGCACGACGACGGGCAGCACCGGCAGCACCACGGCCGGCAGCACCGGGACGG

>NZ_CP025986|1|1|307190-307309|CRISPRCasFinder
CCACGACGGGCAGCACCGGCAGC	GGTTCCGACGACACCACGACGGGCA
GCACGGGCAGCGGCTCCGGCAGC	ACGACGACGGGCAGCACCGGCAGCA
CCACGGCCGGCAGCACCGGGACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025986.1\|WP_028861309.1\|308648_308852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025986.1\|WP_103025913.1\|317624_317969_+\|toxin	unknown	unknown	unknown
NZ_CP025986.1\|WP_011003438.1\|313320_314484_-\|2-methylcitrate-synthase	unknown	unknown	gnl\|CDD\|183463
NZ_CP025986.1\|WP_038962849.1\|314535_315432_-\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_CP025986.1\|WP_020425351.1\|317965_318277_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225495
NZ_CP025986.1\|WP_071507368.1\|309448_310639_-\|2-methylaconitate-cis-trans-isomerase-PrpF	unknown	unknown	gnl\|CDD\|131387
NZ_CP025986.1\|WP_019719753.1\|295040_295814_+\|molybdate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270255
NZ_CP025986.1\|WP_043885575.1\|318416_319226_-\|DUF2242-domain-containing-protein	unknown	unknown	gnl\|CDD\|378349
NZ_CP025986.1\|WP_103025912.1\|303367_304930_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP025986.1\|WP_058907717.1\|297293_297944_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025986.1\|WP_058907754.1\|300076_302122_+\|DUF3488-domain-containing-protein	unknown	unknown	gnl\|CDD\|378784
NZ_CP025986.1\|WP_011003431.1\|305197_305980_+\|membrane-protein	unknown	unknown	gnl\|CDD\|227049
NZ_CP025986.1\|WP_011003424.1\|295827_297126_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_CP025986.1\|WP_058907715.1\|302602_303247_+\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|238448
NZ_CP025986.1\|WP_058907711.1\|310635_313233_-\|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD	unknown	unknown	gnl\|CDD\|131386
NZ_CP025986.1\|WP_028853948.1\|306033_306441_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025986.1\|WP_011003435.1\|308936_309320_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370209
NZ_CP025986.1\|WP_058907710.1\|315624_317574_+\|propionate-catabolism-operon-regulatory-protein-PrpR	unknown	unknown	gnl\|CDD\|226350
NZ_CP025986.1\|WP_058907755.1\|299033_300080_+\|DUF58-domain-containing-protein	unknown	unknown	gnl\|CDD\|224635
NZ_CP025986.1\|WP_058907716.1\|298048_299014_+\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786

Protein	Function_ID	Function_description	E-value
NZ_CP025986.1\|WP_058907711.1\|310635_313233_-\|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD	gnl\|CDD\|131386	TIGR02333, 2-methyl_citrate_dehydratase_Fe-S_dependent_AcnD, 2-methylisocitrate dehydratase, Fe/S-dependent. Members of this family appear in an operon for the degradation of propionyl-CoA via 2-methylcitrate. This family is homologous to aconitases A and B and appears to act the part as 2-methylisocitrate dehydratase, the enzyme after PrpD and before PrpB. In Escherichia coli, which lacks a member of this family, 2-methylisocitrate dehydratase activity was traced to aconitase B (TIGR00117) ().	0
NZ_CP025986.1\|WP_011003438.1\|313320_314484_-\|2-methylcitrate-synthase	gnl\|CDD\|183463	PRK12351, PRK12351, methylcitrate synthase; Provisional.	0
NZ_CP025986.1\|WP_038962849.1\|314535_315432_-\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0
NZ_CP025986.1\|WP_020425351.1\|317965_318277_+\|transcriptional-regulator	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	2.13173e-15
NZ_CP025986.1\|WP_103025912.1\|303367_304930_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.23449e-97
NZ_CP025986.1\|WP_019719753.1\|295040_295814_+\|molybdate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270255	cd13537, PBP2_YvgL_like, Substrate binding domain of putative molybdate-binding protein YvgL and similar proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.41465e-80
NZ_CP025986.1\|WP_043885575.1\|318416_319226_-\|DUF2242-domain-containing-protein	gnl\|CDD\|378349	pfam10001, DUF2242, Uncharacterized protein conserved in bacteria (DUF2242). This domain is found in various hypothetical bacterial proteins, and has no known function.	7.31013e-71
NZ_CP025986.1\|WP_071507368.1\|309448_310639_-\|2-methylaconitate-cis-trans-isomerase-PrpF	gnl\|CDD\|131387	TIGR02334, conserved_hypothetical_protein, probable AcnD-accessory protein PrpF. The 2-methylcitrate cycle is one of at least five degradation pathways for propionate via propionyl-CoA. Degradation of propionate toward pyruvate consumes oxaloacetate and releases succinate. Oxidation of succinate back into oxaloacetate by the TCA cycle makes the 2-methylcitrate pathway a cycle. This family consists of PrpF, an incompletely characterized protein that appears to be an essential accessory protein for the Fe/S-dependent 2-methylisocitrate dehydratase AcnD (TIGR02333). This protein is related to but distinct from FldA (part of pfam04303), a putative fluorene degradation protein of Sphingomonas sp. LB126. [Energy metabolism, Fermentation].	0
NZ_CP025986.1\|WP_058907717.1\|297293_297944_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.37502e-12
NZ_CP025986.1\|WP_058907754.1\|300076_302122_+\|DUF3488-domain-containing-protein	gnl\|CDD\|378784	pfam11992, DUF3488, Domain of unknown function (DUF3488). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is typically between 323 to 339 amino acids in length. This domain is found associated with pfam01841. This domain has a conserved PLW sequence motif. This domain contains 6 transmembrane helices.	5.08637e-93
NZ_CP025986.1\|WP_011003431.1\|305197_305980_+\|membrane-protein	gnl\|CDD\|227049	COG4705, COG4705, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	5.74696e-113
NZ_CP025986.1\|WP_011003424.1\|295827_297126_-\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.32886e-91
NZ_CP025986.1\|WP_058907715.1\|302602_303247_+\|carbonic-anhydrase	gnl\|CDD\|238448	cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	3.69648e-98
NZ_CP025986.1\|WP_011003435.1\|308936_309320_+\|hypothetical-protein	gnl\|CDD\|370209	pfam08956, DUF1869, Domain of unknown function (DUF1869). This domain is found in a set of hypothetical bacterial proteins.	0.000872881
NZ_CP025986.1\|WP_058907710.1\|315624_317574_+\|propionate-catabolism-operon-regulatory-protein-PrpR	gnl\|CDD\|226350	COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms].	0
NZ_CP025986.1\|WP_058907755.1\|299033_300080_+\|DUF58-domain-containing-protein	gnl\|CDD\|224635	COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only].	5.88245e-39
NZ_CP025986.1\|WP_058907716.1\|298048_299014_+\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	1.81415e-91

>NZ_CP025986.1|WP_028853948.1|306033_306441_+|hypothetical-protein
MIRKLTPTLAAASLVLFMAAAGHVVPTHFSVINTAHAATAALGDLGAFRAIAVDTAAIVDRGDLPGAKQRIKDLEVSWDAAEAGLKPRSASDWHRVDKAIDRALDALRAGKPDAATCRQTLAELIQTIDQASGKR
>NZ_CP025986.1|WP_011003431.1|305197_305980_+|membrane-protein
MDARPMRALPGALNKVPQVALGFWIIKILSTTVGETGADFLAVNVGLGTAITGGAMAALLLAALGAQLRARRYVPWLYWLTVVLVSIVGTQITDLLTDRLGVSLYVSTAVFSVALLAIFAIWYRTERTLSIQAIDTRRRELFYWAAILCTFALGTAAGDLATEAIGLGFQRGIVVFGMLIALAAAAYRLGADKVLAFWAAYILTRPLGAALGDFLSQSPAYGGAGLGAMVTSAVFLAVIAVLVAFAQREASRADVAVTVS
>NZ_CP025986.1|WP_103025912.1|303367_304930_+|SulP-family-inorganic-anion-transporter
MQTPTQPAFFPRDMLAGTIVFFVALPLCLGIASASGVDPLAGLMSGMIGGLVVALLSGSQLSVSGPAAGLVVIVVDGIAKLGGFSAFLMAVLLSGVLQFVFGMLRAGRFAAYVPSSVIKGMLAAIGLLLIIKQVPLAFGFARADAAAAAGAIVTPFGSVSAAAMAVTALSAAVLIGWETRALRRFLLVRALPAPLMVVALGIGVTLLLDAVAPGVAPPVEHRVGLPSLASFGALFDALQSPSLDALTNPDVWQLALALAIVASLETLLSLEAVEQIDPKKRPAPADRELKAQGIGNMMAGVFGALPITSVIVRSSANVQAGAQSRWSAVVHGALLLASVFTLTSIVNLIPLACLATILIFTGFKLAKPSLFVSVARQGVERFAPFIVTIVGVLLTDLLIGILMGIALSIALAIRANLRRSIVMARHHDHFLLSFRKDVSFMGKVPLKRYLAQVPDYTTLIIDASRADYIDPDVRELVERFIEDAPSRGILIERHHFDAAAPQPARASKLLKLRFSRCPAR
>NZ_CP025986.1|WP_058907715.1|302602_303247_+|carbonic-anhydrase
MYRPKRMLVGNVAWAHEIAERDPRFFSRLAQGQKPQVLWIGCADSRVPAETITHSNPGDLFVHRNIANLVCPADDNTMSVLEYAVRVLKVGHIIVCGHDGCGGVRASLLPQSDALPHVNRRIGPLCALAGRHRAELDAVPDMDDRVNRLAELNVLEQVRWLRESSIVREAEPAPRVHGWIFGLADGRIRVLGSGEPGEAPPVRGDILEPAEAEA
>NZ_CP025986.1|WP_058907754.1|300076_302122_+|DUF3488-domain-containing-protein
MNAAFGSARALTHREHGRLIALLALVLAPLLRSLPLVTCSVFGVLLLWRTGLWVRRAPLPNKWLLGVTGAAVLGITLVLALRTGGNIGRDLSVAVLGAFLVLKLMESHTVRNGILVTQLCCFLLLSQTLFDQPPWMAATLLASVGLLLHHWMVLLHPQAPARLSVAGVLLRLVMTGLPCAAVLFLLFPRLDHPLWRLPQGADVATSGLTDRMAPGSIGQLILSDDLAFRADFNGVPPPSGARYWRGIVLWRFDGQAWTASSFRQRAEPASVPNSAGVSDSGGVPDSANARPGAGRLVDYSITLEPTRQRWLFALDRGVSIDARDGLRRSIDAEFLSAHPLDERIRYHARSRLPGPGTGDEEALDPLTQQLALALPPGNPQARALAAQWAGLAPAERVASALKLFRDAPFAYTLEPEPLRGEQIDDFLFRTRRGFCEHYAGSFVFLMRAAGVPARVVVGYQGGEDNAVSGDLIVRQSDAHAWAEVWLRGRGWVRVDPTAAVAPQRVERGLAGAVPASEFRSRRVQEPAWLRSVRWGLDGLISGWNRWVLGYDRARQARLFAWLGLEAADPRAVLWGVSALFLLAALPLLWQQRRPRPDPVQAQWQRVCDRLARHGCVRGAAEGPMAYAERAAARFPQAADALRRVAAGYVALRYGRDDGDAQARAQRLAQWRKDIAALRVSG
>NZ_CP025986.1|WP_058907755.1|299033_300080_+|DUF58-domain-containing-protein
MPLWSALSRALPGLRFARERVQRFLSRPRRPRDGAIRLDRRHVYILPTATGAGFALLLVAMLLTSLNYNVSLGFLLTFLLAGVMASAMWQTHRNLVDLEVRGAVGEPVFAGRAVNVSVALANATAWARVGVETGARDAASAESSLDAHDGTLTALSFGAQPRGWFRLPRLTVSTRFPLGLFRAWSYADAPLTLLVYPEPEAAAPPLPAAFAPDPGEADDPRVARPRPDEAADQLRPYRPGDPLRSIAWKHSARLDTWLARSGQQVRHAQCVLAWDALPPPMEAEARLSRLCAWVLAAEQAPAGEAPEYTLVLPGLAIGPARGPAHRDACLRALALWGRPPVPEPEEAA
>NZ_CP025986.1|WP_058907716.1|298048_299014_+|MoxR-family-ATPase
MTSVQSSLSSVHPAPATQPLSLPAALSQAQRALDRIVLGKPLQIRLALACLLARGHLLLEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIYVKDTGAFEFHPGPLFAQVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFVIATQNPLNQIGTHPLPESQLDRFTMRLSLGYPDQRSERALYLGGGAAQAIEPALTAAQVVALQTATDAVHVAPALVDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALIDGRDAVLPEDVQAVFNAVAAHRLLPTGGMLSATALAQRLLDTVAIP
>NZ_CP025986.1|WP_058907717.1|297293_297944_+|TetR/AcrR-family-transcriptional-regulator
MAARGPRALSSTDNTKTASRRISGEAAQASLLEAARELFYQEGVRAVGVEAVVERAGVNKMSLYRQFKSKDDLVLAYLARSAENFWGYFNASMDAHPDDARAQLLQFFIDLSGRASQAGYRGCPFVNVAAEFRDPSHPARQFVERNKSQLLARLRERAAAAGAIDPDTLADDLAFLIEGAYTASQTFGAGAPRLMRSLPRTAATLLAAAIPARTAA
>NZ_CP025986.1|WP_011003424.1|295827_297126_-|MFS-transporter
MQRLARLIAPRFHYGWIALAVVFLILLCAAGTRATPSVMMLPLEHEFGWSRGTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALVVLISGTALSAMMSQPWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTTHRGLAMGILTASSATGQLVFLPMMAAVVERHGWRPVVLIVAGALVLLLPIVGLLLPESPKSVGLRTYGEPADAPEADHGPRANPIALAMHTLMQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGLTEVKGASLLAAMGIFDLVGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGLDWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGLMRASLGNYTLASMISGGLCVAGAFLVLRIHRQRKPDAQASGQPATA
>NZ_CP025986.1|WP_019719753.1|295040_295814_+|molybdate-ABC-transporter-substrate-binding-protein
MSRFSLRACVRAAGLAAVLSLGLGAQAQAAELVVSAAASLTNAFKTLAQSYEAQHPDTRVVLNFGASDVLMQQIVRGAPADVFASADQEAMDKAVSEKVIQSGSRRDFVANQLVLIVPSASAVPVHALGDLARPEVQRVAIGNPASVPVGRYAKRALEAAGLWQPVSAKAVLAQNVRQALDYVARGEVEAGLVFATDAAIAADKVKVAAPVPLSVPLTYPIAVTAGTRQPQQAADFVAFVLSPAGQAILARYGFLKP
>NZ_CP025986.1|WP_028861309.1|308648_308852_+|hypothetical-protein
MRELDSQFKAQRVRSEPLGKTLNGFARSGSLPSDLYSELGGLCQGMQATEKELAAITACMEERDGGG
>NZ_CP025986.1|WP_011003435.1|308936_309320_+|hypothetical-protein
MSEQRNASPSHPQDAVYMPDGVRIDNPDGGYTVTNPNGVSVDYQPDGSIEGQIPVIRALCVQDIAKVVRHDIARVFDTVSHTLHFEGGGVLSYMHASNGRGYEFSGHNVFVQADKDGCVIVHGTCME
>NZ_CP025986.1|WP_071507368.1|309448_310639_-|2-methylaconitate-cis-trans-isomerase-PrpF
MTHPAQIRIPATYMRGGTSKGVFFRLQDLPAAAQVPGAARDALLLRVIGSPDPYGKQIDGMGGATSSTSKTVILSKSARPDHDVDYLFGQVSIDKPFVDWSGNCGNLSAAVGPFAISNGLVDAGRIPHNGVATVRIWQANISKTIVAHVPIAHGAVQETGDFELDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLDVPGIGTLKATLINAGIPTIFVDAASIGYTGTELQDAINGDPKALAMFETLRAHGAVRMGLIRHVDEAATRQHTPKVAFVAPPRDYVASSGKRVDAGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGERHAVRFGHPSGTLRVGAEASRADGEWTVTKAIMSRSARVLMEGWVRVPGAG
>NZ_CP025986.1|WP_058907711.1|310635_313233_-|Fe/S-dependent-2-methylisocitrate-dehydratase-AcnD
MNTAYRKPLPGTSLDYFDARAAVEAIAPGAYDTLPYTSRVLAENLVRRCDPATLADSLRQLIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDHSLAVECGGDDPDAFAKNRAIEDRRNEDRFHFIEWTKLAFKNVDVIPAGNGIMHQINLEKMSPVIHAKDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGVELTGERQPGITATDIVLALTEFLRQQKVVGAYLEFHGEGAARLTLGDRATISNMAPEYGATAAMFSIDPQTLDYLRLTGRADEQVRLVETYAKAAGLWSDTLKHAAYERVLRFDVSSVVRNMAGPSNPHARVATTDLAAKGIAGRWDDVPGQMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANRLGLVRKPWVKSSLAPGSKAVALYLEAAGLKTELEALGFGIVAFACTTCNGMSGALDPTIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTVRFDIERDSFGTGPDGQPITLKDLWPSDAEIDAIVRASVKPEQFRQVYIPMFDQRSEATASVSPLYDWRAQSTYIRRPPYWEGALAGERTLRGLRPLAVLGDNITTDHLSPSNAILADSAAGEYLAKMGLPEADFNSYATHRGDHLTAQRATFANPTLRNEMAVVDGEVKKGSLARIEPEGKVTRMWEAIEAYMARKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTTRITLGIDGTETFDVIGARTPRADLTLVVHRKNGERVDVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESAKEAA
>NZ_CP025986.1|WP_011003438.1|313320_314484_-|2-methylcitrate-synthase
MSEADSSTPAGAFKPKKSVALSGVTAGNTALCTVGRTGNDLHYRGYDILDLAAACEFEEVAYLLVHGKLPNKAELTTYKARLKALRGLPANVKAALEWVPASAHPMDVMRTGVSVLGTVLPERDDHNLPGARDIADRLMASLGSMLLYWYHYSHNGRRIEVETDDDSIGGHFLHLLHGVEPSKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQKRYDTPDEAEADVRRRVEAKEVIIGFGHPVYTISDPRNKVIKEVARKLSKEAGNTRMFDIAERLETVMWDVKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVISRTSGWAAHVIEQRIDNKIIRPSANYTGPEDLKFVPLGKR
>NZ_CP025986.1|WP_038962849.1|314535_315432_-|methylisocitrate-lyase
MSTSKRHPASAGARFRQAVAESQPLQVVGAITAYAARMAEQTGFKAVYLSGGGVAANSLGIPDLGISTMDDVLIDARRITDAVGIPLLVDIDTGWGGAFNIARTVRSFIKAGVAAVHLEDQVGQKRCGHRPGKEVVCADEMVDRVKAAVDARTDGDFVIMARTDAAASEGLDAAIARAVAYVEAGADMIFPEAMKTLDDYRRFKAAVKVPILANLTEFGSTPLFTVDELRGADVDIALYCCGAYRAMNAAALGFYRTVMRDGTQQAAVQTMQTRADLYHYLGYHAYEDKLDALFAAQK
>NZ_CP025986.1|WP_058907710.1|315624_317574_+|propionate-catabolism-operon-regulatory-protein-PrpR
MSTAPHLAFRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRGFEDIVREIEAAGAERPDVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARREAESVALVTHGDTPDEVRRFVAAYGMDVVFAAYQSRQDAESCVLDLRDRGVGAVVGPGLVTDLAAQAGLHAVFLYSRDSVRAAFDTALEVVQATRREGQRRQRLDNLLQHLRDGVVALDAQGRVEAINQRLATALGIDARQAAGQPLLASAPNLLGLLPDTDGDTLGTVRGVSYVIHRGPLASTGAGAADGTVFTFQESRAVERLDRTLRSGQRAPQFTARYRIDDLIGASAPMERVRALVRRYARSDATVLVLGESGTGKEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFGYEEGAFTGARKGGKTGLIEAAHRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTDAVEAGTFRADLYYRLNILSIALPPLRDRPGDVLPLAAELLVQAARREPRLLLRIPDTEVAARVLAGVADPLRRYPWAGNVRELQSVVERIAVELADTDAMDAGAITQDVLRVIAPEVFEARRQGKKAALSLRERSRGVEAEAIRAALAAHGGDRDAVCKALRISKTTLWRRLNAE
>NZ_CP025986.1|WP_103025913.1|317624_317969_+|toxin
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWMFVVYDKGEADDLSSDERKVLARLLEQDVKARSER
>NZ_CP025986.1|WP_020425351.1|317965_318277_+|transcriptional-regulator
MKRNLFAELKEGMDALAAEREGKMTLRKVKVRVLQPLDVTAEEIKAVRAAAHASQAVMARRLRVNVRTYQNWEQGTAKPNTQAAVLIKLVEKHPETLQMLEAL
>NZ_CP025986.1|WP_043885575.1|318416_319226_-|DUF2242-domain-containing-protein
MPYRFRQLSASCAIATLLSACNSAPTPLYQQEEFDAAKSPYARTFQAKSDATCEAARRALLSQGYVSSSPRLDTIDGSKNFQPSNDSHVVIAFHVVCADASADGASSTAYVNAVQDRYTLKKTSTSASVGLSVLGSVSLPISSSDDSMVKVASETIPAGVFYERFFNLVDHFLKIDPTQRDRATVKAAEKEHVAPLPEPAPTPQGEPMKMTTPVAPTPPAPPVPVAPAAAAATAPASKAPAEPTPAATTDATAPTAASAPAAANAGDAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025986_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025986_3

1200193-1200303

Orphan

Consensus_repeat	Method
TCCCTATGTTCGTCCCGAGCCGTCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025986_3

>merge|NZ_CP025986|3|1200193-1200303|CRISPRCasFinder
TCCCTATGTTCGTCCCGAGCCGTCCGCGCCTCCGCTGCCGGAGCAGGGCGCCCCGTCCGGGCGCGCCGCCAACAGCGCTTCCCATCCCTATATTCGTCCCGAGCCGTCCGC

>NZ_CP025986|3|3|1200193-1200303|CRISPRCasFinder
TCCCTATGTTCGTCCCGAGCCGTCCGC	GCCTCCGCTGCCGGAGCAGGGCGCCCCGTCCGGGCGCGCCGCCAACAGCGCTTCCCA
TCCCTATATTCGTCCCGAGCCGTCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025986.1\|WP_020371745.1\|1204039_1204474_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP025986.1\|WP_011001297.1\|1187554_1188538_+\|CysB-family-HTH-type-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237172
NZ_CP025986.1\|WP_021154817.1\|1211604_1212138_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP025986.1\|WP_011001313.1\|1208372_1208843_+\|DUF1857-family-protein	unknown	unknown	gnl\|CDD\|176872
NZ_CP025986.1\|WP_103025970.1\|1192482_1193295_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818
NZ_CP025986.1\|WP_103025968.1\|1188686_1190744_+\|type-III-effector-protein	unknown	unknown	gnl\|CDD\|339245
NZ_CP025986.1\|WP_028852996.1\|1195642_1196056_+\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP025986.1\|WP_016722033.1\|1210454_1210724_-\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|226731
NZ_CP025986.1\|WP_011001316.1\|1210876_1211608_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP025986.1\|WP_028860519.1\|1202603_1203908_+\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP025986.1\|WP_103025971.1\|1193379_1195116_+\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285
NZ_CP025986.1\|WP_064047690.1\|1190941_1191235_+\|2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|379083
NZ_CP025986.1\|WP_020831877.1\|1195143_1195650_+\|RraA-family-protein	unknown	unknown	gnl\|CDD\|236487
NZ_CP025986.1\|WP_011001311.1\|1205899_1206601_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NZ_CP025986.1\|WP_103025972.1\|1197888_1199754_+\|GALA-protein	unknown	unknown	gnl\|CDD\|275380
NZ_CP025986.1\|WP_103025973.1\|1208939_1210403_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP025986.1\|WP_103025969.1\|1191234_1192479_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP025986.1\|WP_049832877.1\|1206685_1208266_+\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NZ_CP025986.1\|WP_103025859.1\|1196232_1197684_-\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|226192
NZ_CP025986.1\|WP_011001309.1\|1204550_1205480_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114

Protein	Function_ID	Function_description	E-value
NZ_CP025986.1\|WP_020371745.1\|1204039_1204474_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	5.66819e-31
NZ_CP025986.1\|WP_011001297.1\|1187554_1188538_+\|CysB-family-HTH-type-transcriptional-regulator	gnl\|CDD\|237172	PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed.	0
NZ_CP025986.1\|WP_021154817.1\|1211604_1212138_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.1062e-41
NZ_CP025986.1\|WP_011001313.1\|1208372_1208843_+\|DUF1857-family-protein	gnl\|CDD\|176872	cd08863, SRPBCC_DUF1857, DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily. Uncharacterized family of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.21381e-54
NZ_CP025986.1\|WP_103025970.1\|1192482_1193295_+\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	6.0792e-65
NZ_CP025986.1\|WP_103025968.1\|1188686_1190744_+\|type-III-effector-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	1.66905e-52
NZ_CP025986.1\|WP_028852996.1\|1195642_1196056_+\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	6.6866e-29
NZ_CP025986.1\|WP_016722033.1\|1210454_1210724_-\|acyl-CoA-binding-protein	gnl\|CDD\|226731	COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism].	2.01415e-46
NZ_CP025986.1\|WP_011001316.1\|1210876_1211608_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	3.2287e-55
NZ_CP025986.1\|WP_028860519.1\|1202603_1203908_+\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP025986.1\|WP_103025971.1\|1193379_1195116_+\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0
NZ_CP025986.1\|WP_064047690.1\|1190941_1191235_+\|2TM-domain-containing-protein	gnl\|CDD\|379083	pfam13239, 2TM, 2TM domain. This short region contains two transmembrane alpha helices that are found associated with a wide range of other domains. This domain may be involved in cell lysis or peptidoglycan turnover.	3.50944e-14
NZ_CP025986.1\|WP_020831877.1\|1195143_1195650_+\|RraA-family-protein	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	5.28194e-95
NZ_CP025986.1\|WP_011001311.1\|1205899_1206601_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	1.61219e-91
NZ_CP025986.1\|WP_103025972.1\|1197888_1199754_+\|GALA-protein	gnl\|CDD\|275380	sd00033, LRR_RI, leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.	6.79575e-34
NZ_CP025986.1\|WP_103025973.1\|1208939_1210403_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.00071e-66
NZ_CP025986.1\|WP_103025969.1\|1191234_1192479_+\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	5.81031e-90
NZ_CP025986.1\|WP_049832877.1\|1206685_1208266_+\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NZ_CP025986.1\|WP_103025859.1\|1196232_1197684_-\|IS1182-family-transposase	gnl\|CDD\|226192	COG3666, COG3666, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.41046e-28
NZ_CP025986.1\|WP_011001309.1\|1204550_1205480_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22847e-92

>NZ_CP025986.1|WP_103025972.1|1197888_1199754_+|GALA-protein
MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGPSASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGALTLEALKALPPTLEHLEIGRCTGSAISAEGLAHLAAMPLKSLNLNGIEIGVEGARTLATSKSLVSLSLIGCGIGDRAAQALAASRSIRSLDLSVNMIGRDGAQALADAPLVSLNLYSNEIGDDGARALATSQTLTSLELRRNGIGNAGAGAFANNTVLRKLNLANNMIDKRGARVLAGNTSLTELDLGGNRLGDKGARALAGNRSLLSLKVDHNEISDEGVQALAQHATLRSLDLSFNFVGLQGAGALGGNTRLSELNLSLCGINSYSASALARNKSLASLYLNGNRIGDDGARALAKNSTLTLLDLSRNNIQNAGAEALGGNQALISLKLAGNGIDDDGAAALARHPRLTTLDLSQNRIGSEGARHLAQSATLAELDLSENRIGPEGAKALSLSTVLTTLKVIDNAIGEDGARALADSTSLTSLDARRNGIGEAGAKVLEANTRITGTPQNPNFLAEDVPRPDVRWRD
>NZ_CP025986.1|WP_103025859.1|1196232_1197684_-|IS1182-family-transposase
MKRFIEGEDRQQVTLLPACLDDYIGLDNPVRVVEAFVEELDLVSHGFEGAQPAATGRPSYHPAVLLKLYIYGYLNRIQSSRRLEREAQRNVELMWLTGRLAPDFKTIADFRRDNAAGIRNVCRCFIGLCRDLKLFSQAIVAIDGSKFKAVNSRDRNFTPGKIDGRQRQIEQSIQRYLDALETADRTQPAEVEAKTERLQDKIRKLREQMKQLDDTKEALKSEPDGQRSLTDPDSRSMNSQAKGTGLVGYNVQAAVDARHHLIVAHEVTNEGNDRAQLSKMAKAAREAMGKTKLQALADRGYFNGAQLKACEDAGIKTFVPKPMTSSAKADGRFDKSDFIYIAKDDEYQCPAGERAIYRFSTFEKKSGQQARLYWTSACPTCPMKGRCTPSDYRRIRRWEHEAVLERVQQRLDRKPEAMTMRRSTIEHVFGTLKHWMGSTHFLTKTLPHVNTEMSLHVLAYNMKRVIAILGITRTMKAMKLVGA
>NZ_CP025986.1|WP_028852996.1|1195642_1196056_+|gamma-glutamylcyclotransferase
MTEAIHVFAYGTLRAGEANDLRVAASRRGIAEPKLIGHATLHGRLYDFGAYPGLVPDPTGTAVRGDVYRIDPGLVPVLDTIEAVYPGGDALFLRETHTVMLGSEPLDCIVYPVSAGQVAGRHVITGGDWVAYRLARG
>NZ_CP025986.1|WP_020831877.1|1195143_1195650_+|RraA-family-protein
MTTMMIPVTDLCDAHEDQLASGAVRVLAPVFHSFGARAAFAGPAATLKVFEDNGLVRAMLEQPGEGRVLVVDGGGSLRCALVGGNLAKLAEDNGWEGVLVNGCVRDTRELAACNVGVHALVAHPRKSFKKNQGERDIGVQMPGAYIHPGEWIYGDEDGVLVSRERLHD
>NZ_CP025986.1|WP_103025971.1|1193379_1195116_+|thiamine-pyrophosphate-binding-protein
METAVARPVSAGPTDSGSRPVPRHGGQILVDALIAHGTDLAFGVPGESYLAVLEGFYQRRDRARFIVCRQEGGAATMADAHGKLTGRPGIVFCTRGPGATNASIGVHTAFQDSTPLILFIGQVGRDCVDREAFQEIDYRRMFGQMAKWVAQIDSVERIPEYIARAFQTATAGRPGPVVLALPEDMLTQVATVADVPPMPRAMAWPAPHDLARLKALLGRAERPLLLLGGAGWTPQAAARLQAFAERWRLPVGCVFRRQDLFDNRHPNYAGDVGIAINPKLAARVREADVVLAIGTRLGEMATSGYSLFDVPRPRQTLIHVHAGAEELGRVYQADLMIHAAMPAIAEALDGVAPDAPPRWQAWTEAAHADYLANIAPPPFAGRGIDLARAMQWLRERLPRNAILTNGAGNYATWLHRFYQYGPLAAGSRTQLAPTSGAMGYGAPAAVAAKIACPQTPVICLAGDGCFLMNGQELATAMQYDAPVIFIVVNNGMYGTIRMHQERAYPEHVSGTELRNPDFAALARAYGAEGHTVRSLEGFQAAVEAALAAPVATVIEVQTDPEIISPRATLQSLRAQARG
>NZ_CP025986.1|WP_103025970.1|1192482_1193295_+|response-regulator-transcription-factor
MPIAPRLLIADDEPALADSLIAELAALWPGARIAPAVHDGQSALDAIDRPRAGEAPDVVFLDIRMPGLSGIEVARELAGRAQRPLVVFVTAYDQFALDAFEQAAVDYVLKPVQTERLAATVRRLTARLAERPDGGAAADSAQTLAQLVERLAGLPAAGGANGAYLRFIKALVGQEIRFIPVEEVLYLEATDKYVNVVTHAGASLIRTSLRELLSQLDPQHFWQVHRGTVVNVAHVASAVHLSLGRLALKMRGRTETLPVARQYAHLFRQM
>NZ_CP025986.1|WP_103025969.1|1191234_1192479_+|sensor-histidine-kinase
MRDRPRFDPATPSSKIGRMLANVSLPPLAECLRIAMRWLRAFAWIVAINTGIAAVLAFGIKPDDTFWHDLVYSQAIGLSMWLLIDIPRHLLWGNGPPSRRVLPWIVVAAVLIGVPFGQWVARRILCTGDQPWRADSLRMSFIIAMLAALGATYFYWSRGKLATLQRQAALDALEREEAEKQVVRAQLMALQAQIEPHFLFNALAHVDVLIARDPAGARRLLQHLIGFLRTSLAHARAEQCTLEQEFALLRAYLDIQALRFGARLRFSLALDDTIAGLVVPPMLIQPLVENAVVHGIEPSREGGTIALSARREGDRLRLEVRDTGIGFGRDAAPGKGSGMGLTHVRERLARLFDADARLTIAETMPHGVTVTVELPLAHDAAGADASGAAVPQWRCRFSRPAVAPALAPRAPAGT
>NZ_CP025986.1|WP_064047690.1|1190941_1191235_+|2TM-domain-containing-protein
MSATTFPASDDAALLHRARRRAGARMGLRIHLLAFLAVNLMLAAMALSHGQSWFVWPLLAWGVGLAVHGLGLAWALGSGYRRLVDRELARLRNQAGR
>NZ_CP025986.1|WP_103025968.1|1188686_1190744_+|type-III-effector-protein
MPTRVPSPTLGRSHPVTGAASTATSTAATATRSGPATAPASGRSREGLLAELPTGRTARTPSVSAAGAHAGRPAWNVQGAIEAMAALSPEREKRLFKKSASPQYRYAKGLTAEQRGQLESALEQRFRNPAAPAEARDSALAMWLSVQQARLRTHTAGHRNHHNLEQFQLAALSVPIPLLALGYRRQRRRYYSSPLRPEYRTAFNNFMRVIGDPSLSEAVRQTVAQRLEYHRRSEETIARHERQLLGEHGVMGLAESGYQIGTNYDHVNLTALEREAVVESRGSGVPPALHIQALRTERSRVESGARRHQWLTRELRDAQARAGQGGAVAGSAGPSSARQVDTAESSAAAARLRRDTANDIRRLRRPLAAEIKQWLKLAHAEPLPDPKAFDNELYANAFARLLERRRPLSLISYFARWDPVVVDGAKVIQAIAKDANLRKEVFAAAETALGTCGDNVADGFANIVTMVDTHQLVDDVRSGKLDQPALEAWGRQRYRLDSLITEVNQWMASRRRQAGQHSIMTERRVAREPLETMLHAKVALKTVLDLPKNLPSSMRHRLASALKPDDLKRLAETVQAKEADPVELARYLLSNDAWRGAMKALHPAAFAALGKRFAPEKDALAKEIPPQPTDPEGLEFLDERMAYAERTDAFTQKCRAAEDTLLLSLAGRYALVPAVVGAGPSQGSR
>NZ_CP025986.1|WP_011001297.1|1187554_1188538_+|CysB-family-HTH-type-transcriptional-regulator
MNFQQLRSIREAVRRQFNLTEVANALYTSQPGVSRQIRELEDELGVEIFERYGKRLTGLTEPGREIVRIVERLLLEAENLRQAGEEFSGRQSGRLTVATTHTQARYALPKVVQAFRKAYPHVTLALQEASPSHIVELLLTGQADIGVATEAVASEPGLTSFEAYRWRHVLVVSPDHPLTKNPLPALEDVAQYPLITYDAGFTGRRNIDAAFAGAGLQPEIVLTAMDADVIKTYVALDVGVGIIASMAYDGRKDDNLVCIGADHLFEPNTTRVAVRRGAYLRGYAHDFIGMFAPHLSREAVAEAVASTVVAQPARPALVASPRQTLAA
>NZ_CP025986.1|WP_028860519.1|1202603_1203908_+|isocitrate-lyase
MSRELEVKALQQEWDTNPRWKGIKRGYTAQDVVRLRGSLQIEHTLARRGAEKLWTLMNSEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANSNGEMYPDQSLYSVDSVPKVVKRINNTFQRADQIQWSEGKDDVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVSKLVAARLAADVMGVPTVLIARTDAEAADLLTADVDDNDRPFCTGERTVEGFYRTKPGLQQAIARGLAYADYADLVWCETGKPDLEYAKKFAEAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIERDASTTALKGSTEDEQFFEEKAHAKKVA
>NZ_CP025986.1|WP_020371745.1|1204039_1204474_-|universal-stress-protein
MFQHILIPTDGSELSRKAVAGALDFAKTLGARLTAYTCLEEYPYTPFSEIVVETPQAFKERVEAQARVVLKDVEDTARAAGIDCDTDMSCFAVPYMGIIDAAERHGCDVIFMASHGRRGLAGLLLGSETQKVLTHTAIPVIVYR
>NZ_CP025986.1|WP_011001309.1|1204550_1205480_-|LysR-family-transcriptional-regulator
MAHFKQLETFVAVATRGSLSAAAAAEGVAPAIIGRRIDALEERLGVKLLVRTTRRITLTFEGSAFLEDCQRILNDLHNAEASVSAGGVKASGHLRVTAPAGFGRRHVAPMVPDFLAAHPDVSITLDLGDRIVDLVNEGFDCAIRLGDLPDSSLVSIRLWENRRVVVAAPAYLERRGRPEQLEQLAGHNCLAFGASANVQRGWVFQQGGKTVTVKVGGTMECTDGAVLREWCLQGHGLAWRSWWEVGHDIATGRLVTVLDAFEAPPIGIHAVFPQRKHLPLRVRLLIDFLKNTYGNPAYWRRADPTLLTD
>NZ_CP025986.1|WP_011001311.1|1205899_1206601_+|haloacid-dehalogenase-type-II
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR
>NZ_CP025986.1|WP_049832877.1|1206685_1208266_+|malate-synthase-A
MELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAERAERVKRLDAGERPDFLPETRHIREGDWTIAPIPPALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQDALGLPRGTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAKVTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAVAMQGIINDKKRDATDGYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLRMNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAELVRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
>NZ_CP025986.1|WP_011001313.1|1208372_1208843_+|DUF1857-family-protein
MRFEHLVEVNDPLNPLMDALTLNQIWQGLVLRVLEPTEFVEGLDEGIITARGEGWVERELRFGKARIQDRVTLEPHQRVTYTTAATGEHAGGSLTMTIETNEANAAFIRFVYDTTLPSADETGDTRYAEIVKSAYREADIDTVRRIREFAAIGRLG
>NZ_CP025986.1|WP_103025973.1|1208939_1210403_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MATFTPTLETLRARHGERFKWLVLFTLTVGAVSSIISATIVNVAIPDLSRHFVLGQERAQWVSASFMVAMTLAMLLTPRLLLRFGLRRTFIGALLLLGVGGLVGGLSPTYGVMIAMRVVGGVAAGIMQPLPNILILRVFPEREQGKAFGLFGFGVVLAPALGPSLGGFLVELFGWRSIFFVVVPFTLLGWAMARRFMAINSSMAGEPKPLDWRGLLLVGAATVALLNGLVELHADVTRGVALMAVSAVCLAVFLFWQRRVESPLLDLRLFSYRQFAMGAVVAFIYGAGLYGSTYLLPVYMQVALAYTPSSAGLVLLPPGLALAATIVVAGRLTSRIEPYRLVSFGLAALAVSFLLMTTNTRATGYLLLIGIAAIGRVGLGFVLPSLSLGAMRGVDFTLIPQGSSAVNFLRQLGGAIGVSATGIFLQWRLAARGIGAVGGVAVDPEARIVACDETFVFLGVLCALAVAAAWRMRRREPAAVVSAGVGP
>NZ_CP025986.1|WP_016722033.1|1210454_1210724_-|acyl-CoA-binding-protein
MSDLQTRFEQAQTDVKSLSERPSNMTLLRLYALFKQGSEGDAHGDKPGFTDIVGRYKYEAWAGLKGLSQDDARQKYIDLVEELKSGATT
>NZ_CP025986.1|WP_011001316.1|1210876_1211608_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MPWILAFDTSTEFCSVALGDGTRTLFRHEHTGARSSSRVLPAAGELLAEAGIALGDCAAIAFGAGPGSFTGLRTACGVAQGLAFGAGLPVVQVNSLMACAEQTRAALPAGTAVTVALDARMDECYWASFVPVAEDASGWHALSAVQVSAPQAVAPPQQPYWLAGNAAAVFGDRLAAATGAAAVLPDVAPHAREIVTLGLRLLAAGHTVRPEDAAPLYVRDKVALTIEERQAVQQAKAAAGARA
>NZ_CP025986.1|WP_021154817.1|1211604_1212138_+|ribosomal-protein-S18-alanine-N-acetyltransferase
MSQVQVDRALAGLIVRAPLPAGWRAERMSALDVAAVAAVEQAAFAFPWSRGNFEDSLKSGHLGIVLRDGGNQVAGYLILMPVVDEMHLLNVTVAPAWQRQGLGRWLLRAAQALTLAHGFASLLLEVRPSNTGAIALYRRVGFAEIGRRKRYYPAENNTREDALVMRIACEAGGVEAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP025986.1	1805686-1805704	1	0.947

1. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to position: 1805686-1805704, mismatch: 1, identity: 0.947

aacccgaatccgatcggca	CRISPR spacer
aacgcgaatccgatcggca	Protospacer
*** ***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	307213-307237	0	1.0
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	307261-307285	0	1.0
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	75544-75568	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	554150-554168	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	553386-553404	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1860492-1860510	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	845571-845589	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	334862-334880	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	306921-306939	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1933370-1933388	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1008241-1008259	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	154775-154793	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	74898-74916	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	98275-98293	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	76209-76227	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	133916-133934	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	234959-234977	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1804721-1804739	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	75890-75908	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	693095-693113	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1114874-1114892	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	307561-307579	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	77533-77551	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	79993-80011	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	74968-74986	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	74973-74991	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	75844-75862	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	74948-74966	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	77551-77569	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	93510-93528	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	93510-93528	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	93510-93528	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	93510-93528	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77450-77468	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	79994-80012	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	79989-80007	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	77428-77446	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	78334-78352	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	74729-74747	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	93510-93528	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	112203-112221	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	77703-77721	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	75907-75925	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	76282-76300	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	90954-90972	0	1.0
NZ_CP025986_2	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	76282-76300	0	1.0
NZ_CP025986_3	3.1\|1200220\|57\|NZ_CP025986\|CRISPRCasFinder	1200220-1200276	57	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1200220-1200276	0	1.0
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	554507-554531	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	74538-74562	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	97912-97936	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	553743-553767	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1860846-1860870	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	75846-75870	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	133553-133577	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	234596-234620	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1804358-1804382	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	335219-335243	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	75527-75551	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	692732-692756	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1114511-1114535	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	77170-77194	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	307275-307299	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	79630-79654	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	74608-74632	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1933727-1933751	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	74613-74637	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1008595-1008619	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	75496-75520	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	74588-74612	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	77188-77212	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	93147-93171	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	133568-133592	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	93147-93171	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	93147-93171	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	93147-93171	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77051-77075	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77087-77111	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	79631-79655	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	79626-79650	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	77065-77089	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	77971-77995	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	74366-74390	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	93147-93171	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111807-111831	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111843-111867	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	77343-77367	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	75544-75568	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	75919-75943	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	90591-90615	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	75919-75943	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	554459-554483	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	553695-553719	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1860798-1860822	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	335171-335195	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	307227-307251	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1933679-1933703	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1008547-1008571	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	154427-154451	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	154463-154487	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	74586-74610	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	97960-97984	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	75894-75918	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	133601-133625	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	234644-234668	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1804406-1804430	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	75575-75599	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	692780-692804	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1114559-1114583	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	77218-77242	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	79678-79702	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	74656-74680	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	74661-74685	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	74636-74660	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	77236-77260	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	93195-93219	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	133616-133640	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	93195-93219	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	93195-93219	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	93195-93219	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77135-77159	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	79679-79703	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	79674-79698	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	77113-77137	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	78019-78043	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	74414-74438	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	93195-93219	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111891-111915	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	77391-77415	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	75592-75616	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	75967-75991	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	90639-90663	1	0.96
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	75967-75991	1	0.96
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	845925-845949	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111819-111843	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1893143-1893167	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1896810-1896834	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1869535-1869559	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	23566-23590	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	95240-95264	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	95201-95225	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	110056-110080	2	0.92
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	110054-110078	2	0.92
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	94589-94613	3	0.88
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	94589-94613	3	0.88
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	58473-58497	3	0.88
NZ_CP025986_1	1.1\|307213\|25\|NZ_CP025986\|CRISPRCasFinder	307213-307237	25	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	47881-47905	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	307189-307213	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	307225-307249	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	75472-75496	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	75508-75532	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	554531-554555	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	554495-554519	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1860834-1860858	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	307299-307323	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	307263-307287	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1933751-1933775	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1933715-1933739	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1008619-1008643	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1008583-1008607	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	74514-74538	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	74550-74574	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	75822-75846	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	75858-75882	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	133529-133553	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	133565-133589	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	234572-234596	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	234608-234632	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1804334-1804358	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1804370-1804394	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	75503-75527	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	75539-75563	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1114487-1114511	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1114523-1114547	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	77146-77170	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	77182-77206	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	79606-79630	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	79642-79666	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	74584-74608	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	74620-74644	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	74589-74613	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	74625-74649	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	74564-74588	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	74600-74624	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	77164-77188	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	77200-77224	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	93123-93147	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	93159-93183	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	133544-133568	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	133580-133604	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	93123-93147	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	93159-93183	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	93123-93147	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	93159-93183	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	93123-93147	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	93159-93183	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77027-77051	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77063-77087	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	77099-77123	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	79607-79631	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	79643-79667	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	79602-79626	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	79638-79662	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	77041-77065	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	77077-77101	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	77947-77971	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	77983-78007	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	74342-74366	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	74378-74402	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	93123-93147	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	93159-93183	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111783-111807	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	111855-111879	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	77319-77343	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	77355-77379	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	75520-75544	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	75556-75580	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	75895-75919	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	75931-75955	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	90567-90591	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	90603-90627	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	75895-75919	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	75931-75955	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	90236-90260	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	88383-88407	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	117922-117946	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	90269-90293	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	117922-117946	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	90949-90973	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	90949-90973	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	117932-117956	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	117951-117975	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	117922-117946	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	90249-90273	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	90249-90273	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	90247-90271	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	845877-845901	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	845913-845937	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	845958-845982	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	58461-58485	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	47869-47893	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	110087-110111	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	94601-94625	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	964456-964480	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	110087-110111	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	94619-94643	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	94601-94625	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	266762-266786	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021407	Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence	103050-103074	3	0.88
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	553767-553791	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1860870-1860894	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	335243-335267	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	154391-154415	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	97888-97912	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	692708-692732	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1893209-1893233	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1896876-1896900	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1869601-1869625	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	109990-110014	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	109988-110012	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	47932-47956	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	142007-142031	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_KP289281	Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence	77965-77989	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	167220-167244	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	331407-331431	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	50839-50863	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	314571-314595	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	407177-407201	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	841735-841759	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1160518-1160542	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	AP018709	Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence	39047-39071	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	669576-669600	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	331409-331433	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_004956	Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence	77965-77989	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	204602-204626	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1362278-1362302	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1301581-1301605	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	58921-58945	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	421800-421824	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	204120-204144	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	11767-11791	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	69214-69238	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	110653-110677	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_019312	Delftia sp. KV29 plasmid pKV29, complete sequence	50250-50274	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	107806-107830	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_024998	Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83	34687-34711	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_MH053445	Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence	39505-39529	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_008385	Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence	33316-33340	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_MN366359	Bacterium plasmid pALTS31, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_001735	Enterobacter aerogenes plasmid R751, complete sequence	27841-27865	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_017908	Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence	10991-11015	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	AJ863570	Uncultured bacterium IncP-1beta multiresistance plasmid pB8	21856-21880	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KU238092	Uncultured bacterium plasmid pDTC28, complete sequence	59130-59154	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	27173-27197	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	28250-28274	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	12620-12644	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	151832-151856	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_014911	Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence	57706-57730	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	28250-28274	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	28250-28274	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MN386974	Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence	12754-12778	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	28250-28274	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	28364-28388	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	28129-28153	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP021650	Acidovorax sp. T1 plasmid p2-T1, complete sequence	37267-37291	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KF743817	Proteus mirabilis plasmid R772, complete sequence	10991-11015	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	10991-11015	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP038640	Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence	46972-46996	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	379189-379213	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KC170279	Uncultured bacterium plasmid pMBUI8, complete sequence	12617-12641	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KU356987	Variovorax paradoxus plasmid pBS64, complete sequence	12616-12640	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KU356988	Variovorax paradoxus plasmid pHB44, complete sequence	12618-12642	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP009797	Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence	13121-13145	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	7222-7246	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_019320	Variovorax sp. DB1 plasmid pDB1, complete sequence	46046-46070	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP017455	Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence	20212-20236	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	68465-68489	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_005088	Delftia acidovorans B plasmid pUO1, complete sequence	29546-29570	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MK433264	Gordonia phage Tiamoceli, complete genome	31430-31454	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MT952843	Gordonia phage Twonlo, complete genome	30048-30072	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MK977704	Gordonia Terrae phage RoadKill, complete genome	30097-30121	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	KR053200	Gordonia phage GTE6, complete genome	31094-31118	4	0.84
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	90272-90296	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	88419-88443	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	117958-117982	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	90305-90329	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	117958-117982	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	90985-91009	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	90985-91009	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	117968-117992	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	117987-118011	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	117958-117982	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	90285-90309	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	90285-90309	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	90283-90307	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP040822	Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence	114362-114386	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	214764-214788	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	AGRM01000006	Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence	9048-9072	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013746	Arthrobacter alpinus strain A3 plasmid unnamed, complete sequence	58350-58374	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	12626-12650	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	MN694571	Marine virus AFVG_250M1012, complete genome	21792-21816	5	0.8
NZ_CP025986_1	1.2\|307261\|25\|NZ_CP025986\|CRISPRCasFinder	307261-307285	25	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1757520-1757544	6	0.76

1. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacgacaccacgacgggca	Protospacer
*************************

2. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagca	Protospacer
*************************

3. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagca	Protospacer
*************************

4. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

5. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

6. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

7. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

8. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

9. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

10. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

11. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

12. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

13. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

14. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

15. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

16. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

17. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

18. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

19. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

20. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

21. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

22. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

23. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

24. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

25. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

26. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

27. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

28. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

29. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

30. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

31. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

32. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

33. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

34. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

35. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

36. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

37. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

38. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

39. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

40. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

41. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

42. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

43. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

44. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

45. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

46. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

47. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

48. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

49. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

50. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

51. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

52. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

53. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

54. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

55. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

56. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

57. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

58. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

59. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

60. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

61. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

62. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

63. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

64. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

65. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

66. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

aacccgaatccgatcggca	CRISPR spacer
aacccgaatccgatcggca	Protospacer
*******************

67. spacer 3.1|1200220|57|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

gcctccgctgccggagcagggcgccccgtccgggcgcgccgccaacagcgcttccca	CRISPR spacer
gcctccgctgccggagcagggcgccccgtccgggcgcgccgccaacagcgcttccca	Protospacer
*********************************************************

68. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

69. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

70. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

71. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

72. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

73. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

74. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

75. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

76. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

77. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

78. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

79. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

80. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

81. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

82. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

83. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

84. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

85. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

86. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

87. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

88. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

89. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

90. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

91. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

92. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

93. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

94. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

95. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

96. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

97. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

98. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

99. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

100. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

101. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

102. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

103. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

104. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

105. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

106. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

107. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

108. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

109. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

110. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

111. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

112. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

113. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

114. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

115. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

116. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

117. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

118. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

119. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

120. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

121. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

122. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

123. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

124. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

125. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

126. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

127. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

128. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

129. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

130. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcaccacgacgggca	Protospacer
**********.**************

131. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

132. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

133. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

134. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

135. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

136. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

137. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

138. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

139. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

140. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

141. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

142. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

143. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

144. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

145. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

146. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

147. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

148. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

149. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

150. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

151. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

152. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

153. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

154. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

155. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

156. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

157. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

158. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

159. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

160. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

161. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

162. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

163. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

164. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

165. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

166. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

167. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

168. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

169. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

170. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

171. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

172. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

173. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

174. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

175. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

176. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

177. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

178. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

179. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

180. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

181. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

182. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

183. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

184. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

185. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

186. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

187. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

188. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

189. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

190. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

191. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

192. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 1, identity: 0.96

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggcagcg	Protospacer
************************.

193. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 2, identity: 0.92

ggttccgacgacaccacgacgggca	CRISPR spacer
ggttccgacggcacgacgacgggca	Protospacer
**********.*** **********

194. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcaccggcagcg	Protospacer
** *********************.

195. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

196. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

197. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

198. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccgccagcg	Protospacer
******************* ****.

199. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

200. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagca	Protospacer
** ************** *******

201. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

202. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggtagcg	Protospacer
********************.***.

203. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggttccgacgacaccacgacgggca	CRISPR spacer
ggcgccgacggcaccacgacgggca	Protospacer
**. ******.**************

204. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggttccgacgacaccacgacgggca	CRISPR spacer
ggcgccgacggcaccacgacgggca	Protospacer
**. ******.**************

205. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggttccgacgacaccacgacgggca	CRISPR spacer
ggcgccgacggcaccacgacgggca	Protospacer
**. ******.**************

206. spacer 1.1|307213|25|NZ_CP025986|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggttccgacgacaccacgacgggca	CRISPR spacer
ggcgccgacggcaccacgacgggca	Protospacer
**. ******.**************

207. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

208. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

209. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

210. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

211. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

212. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

213. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

214. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

215. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

216. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

217. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

218. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

219. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

220. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

221. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

222. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

223. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

224. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

225. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

226. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

227. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

228. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

229. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

230. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

231. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

232. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

233. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

234. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

235. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

236. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

237. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

238. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

239. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

240. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

241. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

242. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

243. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

244. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

245. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

246. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

247. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

248. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

249. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

250. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

251. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

252. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

253. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

254. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

255. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

256. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

257. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

258. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

259. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

260. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

261. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

262. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

263. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

264. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

265. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

266. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

267. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

268. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

269. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

270. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

271. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

272. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

273. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

274. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

275. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

276. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

277. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

278. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

279. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

280. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

281. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

282. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

283. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

284. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

285. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

286. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

287. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

288. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

289. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

290. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

291. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

292. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

293. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

294. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

295. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

296. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

297. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

298. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

299. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

300. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

301. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

302. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

303. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

304. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

305. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

306. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

307. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

308. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

309. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

310. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

311. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

312. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

313. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

314. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

315. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

316. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

317. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

318. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

319. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

320. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

321. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

322. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

323. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

324. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

325. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

326. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

327. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

328. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

329. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

330. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

331. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

332. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
tccacgacgggcagcaccggcagcg	Protospacer
 * *********************.

333. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

334. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

335. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcaccggcagcg	Protospacer
.* *********************.

336. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcacgggcagcg	Protospacer
** ************** ******.

337. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcacgggcggcg	Protospacer
***************** ***.**.

338. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagca	Protospacer
.* ************** *******

339. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcaccggtagcg	Protospacer
** *****************.***.

340. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcaccggtagcg	Protospacer
** *****************.***.

341. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacaacgggcagcaccggtagcg	Protospacer
*****.**************.***.

342. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcaccggtagcg	Protospacer
** *****************.***.

343. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
gcgacgacgggcagcaccaccagca	Protospacer
.*****************. *****

344. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacaacgggcagcaccggtagcg	Protospacer
*****.**************.***.

345. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacaacgggcagcaccggtagcg	Protospacer
*****.**************.***.

346. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
accacgacgggcagcaccggtagcg	Protospacer
** *****************.***.

347. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
acgtcgacgggcagcaccggcaccc	Protospacer
*** ****************** *

348. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021407 (Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence) position: , mismatch: 3, identity: 0.88

acgacgacgggcagcaccggcagca	CRISPR spacer
atgacgaaggtcagcaccggcagca	Protospacer
*.***** ** **************

349. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

350. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

351. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

352. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

353. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

354. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccacgacgggcagcacgggcagcg	Protospacer
.* ************** ******.

355. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

356. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

357. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

358. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

359. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

360. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gccaccacgggcagcaccggcagcg	Protospacer
.* ** ******************.

361. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
ctgatgacgggcagcaccggcagcg	Protospacer
 .**.*******************.

362. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_KP289281 (Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

363. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
atgacgccgggcagcaccggcagat	Protospacer
*.**** ****************

364. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
acgatgccgggcagcaccggcagat	Protospacer
****.* ****************

365. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

366. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
atgacgccgggcagcaccggcagat	Protospacer
*.**** ****************

367. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgaccggcagcaccgccagtg	Protospacer
******** ********** ***..

368. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
ccgacgacggccggcaccggcagcg	Protospacer
 ********* *.***********.

369. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
tcgacgacgggcagcgcccgcagcc	Protospacer
 **************.** *****

370. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to AP018709 (Uncultured bacterium plasmid pSN1104-59 DNA, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

371. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
ttgacgacggtcatcaccggcagca	Protospacer
 .******** ** ***********

372. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
acgatgccgggcagcaccggcagat	Protospacer
****.* ****************

373. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_004956 (Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

374. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
acgatgccgggcagcaccggcagat	Protospacer
****.* ****************

375. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
tggacggcggtcagcaccggcagca	Protospacer
  ****.*** **************

376. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
ttgacgacggtcatcaccggcagca	Protospacer
 .******** ** ***********

377. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gagacgaaggccagcaccggcagca	Protospacer
. ***** ** **************

378. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
atgacgccgggcagcaccggcagat	Protospacer
*.**** ****************

379. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgtgcagcaccggccacg	Protospacer
********* *********** .*.

380. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

381. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

382. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
atgacgccgggcagcaccggcagat	Protospacer
*.**** ****************

383. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_019312 (Delftia sp. KV29 plasmid pKV29, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

384. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

385. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_024998 (Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

386. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_MH053445 (Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

387. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_008385 (Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

388. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

389. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_MN366359 (Bacterium plasmid pALTS31, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

390. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_001735 (Enterobacter aerogenes plasmid R751, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

391. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_017908 (Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

392. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to AJ863570 (Uncultured bacterium IncP-1beta multiresistance plasmid pB8) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

393. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KU238092 (Uncultured bacterium plasmid pDTC28, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

394. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

395. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

396. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

397. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

398. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

399. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

400. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
ttgacgacggtcatcaccggcagca	Protospacer
 .******** ** ***********

401. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

402. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

403. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

404. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

405. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_014911 (Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

406. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

407. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

408. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MN386974 (Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

409. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

410. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
cggacgacgaacagcaccggcagca	Protospacer
  *******..**************

411. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

412. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP021650 (Acidovorax sp. T1 plasmid p2-T1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

413. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

414. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

415. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP038640 (Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

416. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
aagacgacggtcagcaccggcaggt	Protospacer
* ******** ************

417. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KC170279 (Uncultured bacterium plasmid pMBUI8, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

418. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KU356987 (Variovorax paradoxus plasmid pBS64, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

419. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KU356988 (Variovorax paradoxus plasmid pHB44, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

420. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP009797 (Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

421. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

422. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_019320 (Variovorax sp. DB1 plasmid pDB1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

423. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP017455 (Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

424. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_007337 (Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

425. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_005088 (Delftia acidovorans B plasmid pUO1, complete sequence) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
agctcgacggccagcaccggcagca	Protospacer
*   ****** **************

426. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MK433264 (Gordonia phage Tiamoceli, complete genome) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gggacgacgggcagcgccggtagca	Protospacer
. *************.****.****

427. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MT952843 (Gordonia phage Twonlo, complete genome) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gggacgacgggcagtgccggcagca	Protospacer
. ************..*********

428. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MK977704 (Gordonia Terrae phage RoadKill, complete genome) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gggacgacgggcagtgccggcagca	Protospacer
. ************..*********

429. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to KR053200 (Gordonia phage GTE6, complete genome) position: , mismatch: 4, identity: 0.84

acgacgacgggcagcaccggcagca	CRISPR spacer
gggacgacgggcagtgccggcagca	Protospacer
. ************..*********

430. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

431. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

432. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

433. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

434. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

435. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

436. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

437. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

438. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

439. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

440. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

441. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

442. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
acgacgacgggcagcaccggatcgg	Protospacer
********************    .

443. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP040822 (Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
gtgacgaagggcagcaccggcaggc	Protospacer
..***** ***************

444. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
gcgacgacgggcagcatcggcacgc	Protospacer
.***************.*****

445. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to AGRM01000006 (Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
ggctcgacggccagcaccggcagca	Protospacer
.   ****** **************

446. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013746 (Arthrobacter alpinus strain A3 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
tcgacgacgggcagcaccgtcaaag	Protospacer
 ****************** **. .

447. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
ggctcgacggccagcaccggcagca	Protospacer
.   ****** **************

448. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to MN694571 (Marine virus AFVG_250M1012, complete genome) position: , mismatch: 5, identity: 0.8

acgacgacgggcagcaccggcagca	CRISPR spacer
ggcagcacgggcagcaccggcagca	Protospacer
.  *  *******************

449. spacer 1.2|307261|25|NZ_CP025986|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.76

acgacgacgggcagcaccggcagca	CRISPR spacer
ggcacgacgggcagcaccggcacgg	Protospacer
.  *******************  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

94477 : 161949

Ralstonia_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011003443.1\|94477_95809_-\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_103025899.1\|95890_96715_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_058908857.1\|96839_97793_-	oxidoreductase	NA	NA	NA	NA
WP_028853999.1\|97804_98833_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_058908858.1\|98958_99873_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058908859.1\|100063_101449_+	sensor histidine kinase	NA	NA	NA	NA
WP_072633681.1\|102317_104918_+	FAD-dependent oxidoreductase	A0A2H4UW49	Bodo_saltans_virus	3.7e-12	31.0
WP_103025901.1\|105768_107988_-	type III effector protein (hlk2)	NA	NA	NA	NA
WP_011003529.1\|108330_109812_+	AMP nucleosidase	NA	NA	NA	NA
WP_139274299.1\|110245_110782_+	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|110848_111814_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_011003443.1\|112021_113353_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_103025902.1\|113665_115228_-	carotenoid oxygenase family protein	NA	NA	NA	NA
WP_058908747.1\|115242_115689_-	DUF2141 domain-containing protein	NA	NA	NA	NA
WP_011003525.1\|115920_116142_-	hypothetical protein	NA	NA	NA	NA
WP_058908746.1\|116268_117060_-	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_058908745.1\|117648_119355_+	hypothetical protein	NA	NA	NA	NA
WP_071615413.1\|119351_120854_+	hypothetical protein	A0A077K801	Ralstonia_phage	7.3e-21	58.7
WP_058908728.1\|120900_121167_+	hypothetical protein	R9U4D0	Rhizobium_phage	6.9e-07	54.3
WP_011003518.1\|121661_122156_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_011003517.1\|123309_124056_-	hypothetical protein	NA	NA	NA	NA
WP_058908727.1\|125050_127477_+	decarboxylase	NA	NA	NA	NA
WP_103025903.1\|127500_130011_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	9.0e-24	27.6
WP_011003514.1\|130203_130758_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_016724828.1\|131563_132154_-	chorismate mutase	NA	NA	NA	NA
WP_028861347.1\|132299_133262_+	prolyl aminopeptidase	NA	NA	NA	NA
WP_103025904.1\|133334_133655_+	hypothetical protein	NA	NA	NA	NA
WP_011003509.1\|133777_134899_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_103025905.1\|135692_136517_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_058908597.1\|140601_141126_+	hypothetical protein	NA	NA	NA	NA
WP_058908598.1\|141702_142494_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_058908599.1\|142858_144886_+	FimV family protein	NA	NA	NA	NA
WP_058908600.1\|144909_145071_+	hypothetical protein	NA	NA	NA	NA
WP_020829558.1\|145291_146029_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_071615442.1\|146640_147873_+	lactonase family protein	NA	NA	NA	NA
WP_058908610.1\|147928_149245_+	MFS transporter	NA	NA	NA	NA
WP_058908601.1\|149515_149920_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_011003495.1\|149983_150406_+	DUF4259 domain-containing protein	NA	NA	NA	NA
WP_038938725.1\|150450_150915_-	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_058908602.1\|150944_151727_-	hypothetical protein	NA	NA	NA	NA
WP_058908603.1\|151838_154061_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_016724813.1\|154062_154614_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_058908604.1\|154637_155474_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_058908605.1\|155501_158390_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.2e-15	23.1
WP_016724810.1\|158607_159432_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_058908606.1\|159428_160598_-	cysteine desulfurase	NA	NA	NA	NA
WP_103025546.1\|160962_161949_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3

DBSCAN-SWA_2

275238 : 348449

Brucella_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|275238_276204_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_011003443.1\|276411_277743_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_016726511.1\|277913_278399_+	hypothetical protein	NA	NA	NA	NA
WP_058907724.1\|278729_279011_-	hypothetical protein	NA	NA	NA	NA
WP_011003391.1\|279142_279427_-	hypothetical protein	NA	NA	NA	NA
WP_058907723.1\|280115_280784_+	hypothetical protein	NA	NA	NA	NA
WP_019719758.1\|280889_282167_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.4e-42	30.2
WP_016722339.1\|282415_282721_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.4e-16	49.5
WP_058907722.1\|282717_283026_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.1e-19	46.9
WP_058907721.1\|283101_284301_-	MFS transporter	NA	NA	NA	NA
WP_011003398.1\|284427_285249_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011003399.1\|285426_285978_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071507364.1\|286110_286710_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_071507365.1\|287068_290452_+	hypothetical protein	NA	NA	NA	NA
WP_020425354.1\|290482_292594_-	TonB-dependent receptor	NA	NA	NA	NA
WP_019719753.1\|295040_295814_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011003424.1\|295827_297126_-	MFS transporter	NA	NA	NA	NA
WP_058907717.1\|297293_297944_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058907716.1\|298048_299014_+	MoxR family ATPase	NA	NA	NA	NA
WP_058907755.1\|299033_300080_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_058907754.1\|300076_302122_+	DUF3488 domain-containing protein	NA	NA	NA	NA
WP_058907715.1\|302602_303247_+	carbonic anhydrase	NA	NA	NA	NA
WP_103025912.1\|303367_304930_+	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_011003431.1\|305197_305980_+	membrane protein	NA	NA	NA	NA
WP_028853948.1\|306033_306441_+	hypothetical protein	NA	NA	NA	NA
WP_058907713.1\|307059_308328_+	hemagglutinin	NA	NA	NA	NA
WP_028861309.1\|308648_308852_+	hypothetical protein	NA	NA	NA	NA
WP_011003435.1\|308936_309320_+	hypothetical protein	NA	NA	NA	NA
WP_071507368.1\|309448_310639_-	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_058907711.1\|310635_313233_-	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_011003438.1\|313320_314484_-	2-methylcitrate synthase	NA	NA	NA	NA
WP_038962849.1\|314535_315432_-	methylisocitrate lyase	NA	NA	NA	NA
WP_058907710.1\|315624_317574_+	propionate catabolism operon regulatory protein PrpR	NA	NA	NA	NA
WP_103025913.1\|317624_317969_+	toxin	NA	NA	NA	NA
WP_020425351.1\|317965_318277_+	transcriptional regulator	NA	NA	NA	NA
WP_043885575.1\|318416_319226_-	DUF2242 domain-containing protein	NA	NA	NA	NA
WP_071615383.1\|320470_322309_+	AAA family ATPase	NA	NA	NA	NA
WP_103025505.1\|324064_324529_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|324528_324879_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|324910_326482_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025914.1\|326577_327708_+	ATP-binding protein	NA	NA	NA	NA
WP_063612211.1\|329732_330671_+	DMT family transporter	NA	NA	NA	NA
WP_019719061.1\|330750_331836_-	FUSC family protein	NA	NA	NA	NA
WP_043897990.1\|332070_333120_-	lyase	NA	NA	NA	NA
WP_058908670.1\|333315_334551_-	NADH:flavin oxidoreductase/NADH oxidase family protein	NA	NA	NA	NA
WP_058908671.1\|334626_335085_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_086005422.1\|335461_336611_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_058908802.1\|336940_337756_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011004883.1\|337853_338747_+	DMT family transporter	NA	NA	NA	NA
WP_016726476.1\|338847_339888_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_020830597.1\|339931_340849_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011004880.1\|340976_342173_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_019719806.1\|342178_343723_-	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.5e-13	28.8
WP_011004877.1\|344854_346225_-	porin	NA	NA	NA	NA
WP_038938784.1\|347435_348449_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

443610 : 481768

uncultured_Mediterranean_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019719842.1\|443610_445083_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.6e-25	29.3
WP_011004797.1\|445272_445635_+	hypothetical protein	NA	NA	NA	NA
WP_058908007.1\|445733_446255_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_058908008.1\|446419_446749_+	hypothetical protein	NA	NA	NA	NA
WP_028854674.1\|446906_447419_-	DUF1993 family protein	NA	NA	NA	NA
WP_016725060.1\|447645_447861_-	hypothetical protein	NA	NA	NA	NA
WP_087451503.1\|456998_457803_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_139274350.1\|457835_458186_+	hypothetical protein	NA	NA	NA	NA
WP_058908830.1\|458175_458418_+	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|458593_459559_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_158655411.1\|459557_460082_+	hypothetical protein	NA	NA	NA	NA
WP_020829879.1\|460396_461398_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025478.1\|461531_462334_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_058908828.1\|462411_462930_+	DUF2247 family protein	NA	NA	NA	NA
WP_071615620.1\|462978_463185_+	hypothetical protein	NA	NA	NA	NA
WP_071615618.1\|463349_463703_+	hypothetical protein	NA	NA	NA	NA
WP_103025920.1\|464537_464906_+	hypothetical protein	NA	NA	NA	NA
WP_103025921.1\|464955_467496_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.8e-16	30.8
WP_103026038.1\|467593_468208_+	hypothetical protein	NA	NA	NA	NA
WP_103025922.1\|468212_469982_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_103025923.1\|469999_470839_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_028854671.1\|471081_471468_+	hypothetical protein	NA	NA	NA	NA
WP_071092600.1\|471467_471935_+	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_103025924.1\|472549_474697_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_016723605.1\|474811_475849_-	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_103026039.1\|476198_476720_+	hypothetical protein	NA	NA	NA	NA
WP_103025925.1\|476882_478133_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_058907850.1\|478158_479484_-	DUF3500 domain-containing protein	Q7Y402	Yersinia_phage	4.5e-06	45.5
WP_058907849.1\|480058_481768_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_4

780826 : 847095

Ralstonia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723619.1\|780826_781792_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_103025937.1\|781875_782409_-	hypothetical protein	NA	NA	NA	NA
WP_058907943.1\|782405_784112_-	hypothetical protein	NA	NA	NA	NA
WP_019719249.1\|784120_786859_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.0e-84	32.4
WP_019719248.1\|787300_788344_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.4e-16	33.3
WP_020831502.1\|788552_789881_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_019719247.1\|790059_791388_-	divalent metal cation transporter	NA	NA	NA	NA
WP_103025938.1\|791553_793335_+	molecular chaperone HscC	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.5e-86	38.3
WP_058908667.1\|793345_795199_+	J domain-containing protein	NA	NA	NA	NA
WP_011003826.1\|795333_795999_+	response regulator	NA	NA	NA	NA
WP_019719244.1\|795995_797474_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.3e-18	26.5
WP_019719243.1\|797603_798215_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011003829.1\|798317_798749_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_058908668.1\|798919_799429_+	hypothetical protein	NA	NA	NA	NA
WP_011003831.1\|799537_800893_+	TolC family protein	NA	NA	NA	NA
WP_043885717.1\|800934_802107_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_058908666.1\|802103_805253_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.8e-66	24.9
WP_011003834.1\|805249_805573_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_020829729.1\|805664_807911_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.6e-54	27.3
WP_028861513.1\|808573_809014_-	hypothetical protein	A4PE55	Ralstonia_virus	6.4e-34	55.2
WP_028861514.1\|809515_810295_+	phosphohydrolase	NA	NA	NA	NA
WP_020829725.1\|810447_811359_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.3e-75	47.3
WP_011003839.1\|811523_812849_+	MFS transporter	Q6JIH2	Burkholderia_virus	6.1e-104	50.0
WP_058908665.1\|813180_813582_+	hypothetical protein	NA	NA	NA	NA
WP_011003842.1\|813846_814989_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_103025859.1\|818175_819627_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_058908860.1\|827485_827986_+	hypothetical protein	NA	NA	NA	NA
WP_081050002.1\|828256_828565_+	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|828870_829836_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_071615653.1\|831222_831744_+	hypothetical protein	NA	NA	NA	NA
WP_058908692.1\|831786_833556_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_058908691.1\|834223_835591_+	amidohydrolase family protein	NA	NA	NA	NA
WP_058908690.1\|835883_837017_-	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
WP_011003854.1\|837118_837391_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_058908689.1\|837523_838495_+	hypothetical protein	NA	NA	NA	NA
WP_011003856.1\|838513_839719_+	chromate transporter	NA	NA	NA	NA
WP_016725380.1\|839772_840279_+	chromate resistance protein	NA	NA	NA	NA
WP_155739017.1\|840825_840969_+	hypothetical protein	NA	NA	NA	NA
WP_089191131.1\|841210_841531_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011003864.1\|841897_842455_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_058908418.1\|842444_843488_-	transporter	NA	NA	NA	NA
WP_058908419.1\|843578_843956_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_103025859.1\|844228_845680_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_103025940.1\|845897_847095_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.3e-92	61.8

DBSCAN-SWA_5

1264993 : 1385556

Hokovirus(12.5%)

transposase,protease,integrase

attL 1273857:1273874|attR 1381416:1381432

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058907312.1\|1264993_1266382_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_103025978.1\|1266516_1268784_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_016722003.1\|1268783_1269338_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_103025979.1\|1269348_1270419_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_011001364.1\|1270415_1270910_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_011001365.1\|1270906_1271722_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_011001366.1\|1271718_1272891_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_011001367.1\|1272895_1273606_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.4e-25	39.6
WP_011001368.1\|1273625_1274405_+	RNA methyltransferase	NA	NA	NA	NA
1273857:1273874	attL	NA	NA	NA	NA
WP_011001369.1\|1274718_1275558_-	kinase/pyrophosphorylase	NA	NA	NA	NA
1273857:1273874	attL	NA	NA	NA	NA
WP_011001370.1\|1275761_1278149_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	7.0e-167	36.2
WP_011001371.1\|1278295_1278724_+	NfeD family protein	NA	NA	NA	NA
WP_011001372.1\|1278748_1279675_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_011001373.1\|1279701_1280148_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.1e-25	41.8
WP_011001374.1\|1280269_1280707_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_103025980.1\|1280693_1281050_+	RnfH family protein	NA	NA	NA	NA
WP_028853038.1\|1281060_1281582_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_058907310.1\|1281736_1282678_-	DMT family transporter	NA	NA	NA	NA
WP_011001378.1\|1282819_1284283_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	8.8e-96	39.7
WP_020749223.1\|1284408_1284984_+	hypothetical protein	NA	NA	NA	NA
WP_058907309.1\|1284958_1286578_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	4.6e-13	27.5
WP_103025981.1\|1286878_1288135_+\|integrase	site-specific integrase	A0A1X9TCT6	Enterobacter_phage	3.9e-116	52.5
WP_103025982.1\|1288195_1288471_+	hypothetical protein	NA	NA	NA	NA
WP_103025983.1\|1288475_1289000_+	DNA-binding protein	J9Q7G7	Salmonella_phage	9.1e-11	35.3
WP_103025505.1\|1294564_1295029_+\|transposase	transposase	NA	NA	NA	NA
WP_103025506.1\|1295028_1295379_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_071624213.1\|1295410_1296982_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_038938784.1\|1298982_1299996_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025549.1\|1301714_1302797_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_086706442.1\|1302953_1304663_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_103025875.1\|1304668_1307653_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_103025984.1\|1307658_1308507_+	SDR family oxidoreductase	NA	NA	NA	NA
1308466:1308483	attR	NA	NA	NA	NA
WP_081365374.1\|1308571_1312744_-	type III effector protein	NA	NA	NA	NA
1308466:1308483	attR	NA	NA	NA	NA
WP_081049917.1\|1313041_1316611_-	hypothetical protein	NA	NA	NA	NA
WP_071507263.1\|1316930_1320920_-	hypothetical protein	NA	NA	NA	NA
WP_011004146.1\|1321082_1321460_-	hypothetical protein	NA	NA	NA	NA
WP_011004147.1\|1321780_1322290_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_058907531.1\|1322286_1323237_+	FecR family protein	NA	NA	NA	NA
WP_011004149.1\|1323423_1323948_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_020831502.1\|1324016_1325345_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_103025546.1\|1325497_1326484_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_016723157.1\|1326727_1327468_-	response regulator transcription factor	NA	NA	NA	NA
WP_103025985.1\|1327670_1328126_-	molecular chaperone Tir	NA	NA	NA	NA
WP_016723156.1\|1328166_1328394_-	hypothetical protein	NA	NA	NA	NA
WP_016723155.1\|1328583_1328832_-	hypothetical protein	NA	NA	NA	NA
WP_011004154.1\|1328956_1329202_-	hypothetical protein	NA	NA	NA	NA
WP_023470397.1\|1329235_1330207_-	hypothetical protein	NA	NA	NA	NA
WP_103025986.1\|1330212_1331205_-	type III secretion protein HrpV	NA	NA	NA	NA
WP_003263753.1\|1331214_1331475_-	EscS/YscS/HrcS family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_011004157.1\|1331482_1332136_-	EscR/YscR/HrcR family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_058907532.1\|1332122_1333187_-	YscQ/HrcQ family type III secretion apparatus protein	NA	NA	NA	NA
WP_058907533.1\|1333204_1333798_-	type III secretion protein HpaP	NA	NA	NA	NA
WP_011004160.1\|1333808_1335881_-	EscV/YscV/HrcV family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_019719521.1\|1335899_1336973_-	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_011004162.1\|1337254_1337731_+	HrpB1 family type III secretion system apparatus protein	NA	NA	NA	NA
WP_058907543.1\|1337751_1338138_+	type III secretion protein HrpB2	NA	NA	NA	NA
WP_020830094.1\|1338134_1338944_+	EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein	NA	NA	NA	NA
WP_028861692.1\|1338940_1339570_+	type III secretion protein HrpB4	NA	NA	NA	NA
WP_020830092.1\|1339554_1340466_+	HrpE/YscL family type III secretion apparatus protein	NA	NA	NA	NA
WP_011004167.1\|1340462_1341782_+	EscN/YscN/HrcN family type III secretion system ATPase	NA	NA	NA	NA
WP_019719525.1\|1341778_1342279_+	type III secretion protein HrpB7	NA	NA	NA	NA
WP_011004169.1\|1342290_1343139_+	EscT/YscT/HrcT family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_011004170.1\|1343271_1344705_+	transcriptional regulator HrpB	NA	NA	NA	NA
WP_020830091.1\|1344851_1346558_+	EscC/YscC/HrcC family type III secretion system outer membrane ring protein	NA	NA	NA	NA
WP_029240527.1\|1346686_1349761_-	protein popC	NA	NA	NA	NA
WP_016727614.1\|1349769_1350294_-	hypothetical protein	NA	NA	NA	NA
WP_019719527.1\|1350366_1351383_-	hypersensitive response elicitor PopA1	NA	NA	NA	NA
WP_058907536.1\|1351806_1354119_-	TonB-dependent receptor	NA	NA	NA	NA
WP_058907537.1\|1354409_1355855_+	hypothetical protein	NA	NA	NA	NA
WP_081049919.1\|1355877_1357467_-	glycoside hydrolase family 28 protein	NA	NA	NA	NA
WP_058907539.1\|1357699_1360003_-	hypothetical protein	NA	NA	NA	NA
WP_011004179.1\|1360296_1361196_+	hypothetical protein	NA	NA	NA	NA
WP_038938578.1\|1361200_1361497_-	hypothetical protein	NA	NA	NA	NA
WP_103025987.1\|1361871_1364712_+	cell division protein FtsK	S5VNE3	Mycobacterium_phage	6.7e-84	47.6
WP_081049918.1\|1364754_1366866_+	type III effector protein	NA	NA	NA	NA
WP_071653928.1\|1366906_1367731_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103026046.1\|1367774_1369250_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_103026047.1\|1370515_1371577_+	peptidase C55	NA	NA	NA	NA
WP_103025988.1\|1371666_1374630_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.6
WP_103025989.1\|1374786_1375344_+	recombinase family protein	A0A0C4UR34	Shigella_phage	2.4e-54	62.4
WP_072633711.1\|1376119_1376305_-	hypothetical protein	NA	NA	NA	NA
WP_058908707.1\|1376303_1378004_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011004204.1\|1378466_1378850_-	DUF4437 domain-containing protein	NA	NA	NA	NA
WP_086005422.1\|1380359_1381510_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_103025508.1\|1382066_1383300_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_016723619.1\|1384590_1385556_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0

DBSCAN-SWA_6

1516587 : 1562889

Klosneuvirus(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058907497.1\|1516587_1518540_-\|tRNA	class I tRNA ligase family protein	A0A1V0SK04	Klosneuvirus	1.5e-42	24.7
WP_071507247.1\|1518526_1520068_-	PLP-dependent transferase	NA	NA	NA	NA
WP_071507246.1\|1520290_1522300_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_028854274.1\|1522441_1522996_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016723217.1\|1523207_1523924_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_016723220.1\|1525689_1525971_-	hypothetical protein	NA	NA	NA	NA
WP_158655416.1\|1526088_1527048_-	hypothetical protein	NA	NA	NA	NA
WP_103025546.1\|1527171_1528158_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_011003443.1\|1528582_1529914_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_071653928.1\|1530012_1530837_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011004250.1\|1531261_1531933_-	iron-sulfur cluster repair protein YtfE	NA	NA	NA	NA
WP_058908455.1\|1532098_1533631_+	nitric oxide reductase transcriptional regulator NorR	NA	NA	NA	NA
WP_011004252.1\|1533729_1534686_-	L-threonine 3-dehydrogenase	NA	NA	NA	NA
WP_016723017.1\|1534685_1535885_-	glycine C-acetyltransferase	G9E4Q1	Emiliania_huxleyi_virus	2.4e-38	30.0
WP_028854372.1\|1535999_1536605_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058908459.1\|1536996_1539042_+	ribonucleoside triphosphate reductase	D9ZNH0	Clostridium_phage	9.6e-141	45.4
WP_011004256.1\|1539038_1539215_+	hypothetical protein	NA	NA	NA	NA
WP_103026000.1\|1539177_1539897_+	anaerobic ribonucleoside-triphosphate reductase activating protein	NA	NA	NA	NA
WP_011004258.1\|1539901_1540579_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_058908454.1\|1540612_1541032_-	zinc-binding protein	NA	NA	NA	NA
WP_011004260.1\|1541046_1541478_-	SCP2 domain-containing protein	NA	NA	NA	NA
WP_058908453.1\|1541474_1542359_-	U32 family peptidase	NA	NA	NA	NA
WP_011004262.1\|1542378_1543398_-	U32 family peptidase	NA	NA	NA	NA
WP_058908452.1\|1543442_1544717_-	hypothetical protein	NA	NA	NA	NA
WP_058908451.1\|1544971_1546285_+	NarK/NasA family nitrate transporter	NA	NA	NA	NA
WP_058908458.1\|1546337_1547723_+	NarK family nitrate/nitrite MFS transporter	NA	NA	NA	NA
WP_058908450.1\|1547891_1551629_+	nitrate reductase subunit alpha	NA	NA	NA	NA
WP_016727493.1\|1551625_1553173_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	3.4e-21	43.1
WP_011004268.1\|1553190_1553871_+	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_019719643.1\|1553878_1554562_+	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_011004270.1\|1554563_1555085_+	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
WP_029240555.1\|1555146_1557102_+	nitrate/nitrite sensor histidine kinase	NA	NA	NA	NA
WP_016727496.1\|1557137_1557806_+	response regulator transcription factor	NA	NA	NA	NA
WP_016723001.1\|1558272_1558776_+	hypothetical protein	NA	NA	NA	NA
WP_016723000.1\|1558978_1559263_-	hypothetical protein	NA	NA	NA	NA
WP_011003443.1\|1559796_1561128_-\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_071653928.1\|1561236_1562061_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103025478.1\|1562086_1562889_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1579052 : 1649836

Burkholderia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103025546.1\|1579052_1580039_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_103026002.1\|1580108_1580282_+	MbtH family NRPS accessory protein	NA	NA	NA	NA
WP_058908631.1\|1580509_1582123_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_058908630.1\|1582232_1583900_+	cyclic peptide export ABC transporter	G3M9Y6	Bacillus_virus	4.3e-06	24.7
WP_011003935.1\|1584267_1584699_+	YciI family protein	NA	NA	NA	NA
WP_058908629.1\|1584729_1586004_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_058908628.1\|1586093_1587272_+	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	6.1e-23	30.4
WP_016723619.1\|1587421_1588387_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_016723619.1\|1588713_1589679_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_158655415.1\|1589845_1594321_-	hypothetical protein	NA	NA	NA	NA
WP_103025546.1\|1594374_1595361_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_103025565.1\|1595425_1596676_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	41.2
WP_058908769.1\|1596974_1598210_-	glycosyltransferase	NA	NA	NA	NA
WP_058908765.1\|1599042_1600041_-	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
WP_019719314.1\|1600551_1601202_-	hypothetical protein	NA	NA	NA	NA
WP_071615603.1\|1601295_1601589_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_103025859.1\|1602147_1603599_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_058908766.1\|1604569_1606561_-	phospholipase	NA	NA	NA	NA
WP_058908771.1\|1606590_1607829_-	sel1 repeat family protein	NA	NA	NA	NA
WP_103026003.1\|1607901_1609911_-	phospholipase	NA	NA	NA	NA
WP_071507931.1\|1613411_1614485_+	HoxN/HupN/NixA family nickel/cobalt transporter	NA	NA	NA	NA
WP_016723929.1\|1614481_1614811_+	ferredoxin protein	NA	NA	NA	NA
WP_103026004.1\|1614807_1618935_+	cobaltochelatase subunit CobN	NA	NA	NA	NA
WP_058908661.1\|1618931_1620848_+	putative cobaltochelatase	NA	NA	NA	NA
WP_086005422.1\|1621348_1622498_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_011003922.1\|1622765_1623473_+	cobalt-precorrin-7 (C(5))-methyltransferase	NA	NA	NA	NA
WP_058908660.1\|1623469_1625074_+	hypothetical protein	NA	NA	NA	NA
WP_021155658.1\|1625076_1626228_+	cobalamin biosynthesis protein CbiD	NA	NA	NA	NA
WP_011003919.1\|1626224_1626956_+	precorrin-2 C(20)-methyltransferase	NA	NA	NA	NA
WP_019719324.1\|1626952_1627768_+	precorrin-4 C(11)-methyltransferase	NA	NA	NA	NA
WP_058908659.1\|1627764_1628529_+	cobalamin biosynthesis protein CbiG	NA	NA	NA	NA
WP_058908658.1\|1628525_1630085_+	precorrin-3B C(17)-methyltransferase	NA	NA	NA	NA
WP_058908657.1\|1630089_1631193_+	GTP-binding protein	NA	NA	NA	NA
WP_011003914.1\|1631224_1631827_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_103026005.1\|1631823_1633146_+	cobyrinate a,c-diamide synthase	NA	NA	NA	NA
WP_011003912.1\|1633142_1633793_+	5,6-dimethylbenzimidazole synthase	NA	NA	NA	NA
WP_058908664.1\|1634013_1634631_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_135006099.1\|1634634_1635006_+	hypothetical protein	NA	NA	NA	NA
WP_058908655.1\|1635033_1635402_+	DUF2784 domain-containing protein	NA	NA	NA	NA
WP_028854186.1\|1635718_1637026_+	MFS transporter	NA	NA	NA	NA
WP_058908654.1\|1637083_1637686_-	hypothetical protein	NA	NA	NA	NA
WP_016723918.1\|1637798_1638131_-	DUF2322 family protein	NA	NA	NA	NA
WP_058908653.1\|1638383_1638890_-	sel1 repeat family protein	NA	NA	NA	NA
WP_087451503.1\|1638919_1639724_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_058908822.1\|1639769_1640105_-	hypothetical protein	NA	NA	NA	NA
WP_081049997.1\|1640467_1640989_+	hypothetical protein	NA	NA	NA	NA
WP_058908821.1\|1641143_1641524_+	hypothetical protein	NA	NA	NA	NA
WP_016727726.1\|1641545_1642637_-	phenylacetate-CoA oxygenase/reductase subunit PaaK	E3SNZ1	Prochlorococcus_phage	1.1e-07	37.7
WP_058908820.1\|1642669_1643224_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_011003904.1\|1643217_1644024_-	phenylacetate-CoA oxygenase subunit PaaC	NA	NA	NA	NA
WP_011003903.1\|1644033_1644321_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
WP_019719336.1\|1644332_1645361_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_058908819.1\|1645925_1647917_+	S8 family serine peptidase	NA	NA	NA	NA
WP_103026006.1\|1648491_1648881_+	hypothetical protein	NA	NA	NA	NA
WP_087451503.1\|1649030_1649836_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1765305 : 1902476

107

Tupanvirus(17.65%)

transposase,integrase

attL 1778792:1778851|attR 1846613:1847716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103025546.1\|1765305_1766292_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_103025549.1\|1766455_1767538_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_058908115.1\|1768068_1768812_+	acetoacetate decarboxylase	NA	NA	NA	NA
WP_016724741.1\|1768856_1769642_+	3-hydroxybutyrate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.8e-05	28.1
WP_058908116.1\|1769673_1770942_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_058908117.1\|1770958_1772056_-	oxidoreductase	NA	NA	NA	NA
WP_029240547.1\|1772321_1774454_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_038938784.1\|1775665_1776679_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_103025546.1\|1777673_1778660_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
1778792:1778851	attL	NA	NA	NA	NA
WP_011004363.1\|1786316_1786877_-	toxin-activating lysine-acyltransferase	NA	NA	NA	NA
WP_058908461.1\|1786885_1788622_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_058908462.1\|1789152_1790307_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_011004366.1\|1790359_1790656_-	hypothetical protein	NA	NA	NA	NA
WP_049832947.1\|1790917_1791703_-	DUF2968 domain-containing protein	NA	NA	NA	NA
WP_103026014.1\|1793223_1794885_-	hypothetical protein	NA	NA	NA	NA
WP_011004370.1\|1794931_1795261_-	DUF3613 domain-containing protein	NA	NA	NA	NA
WP_058908475.1\|1795257_1796169_-	hypothetical protein	NA	NA	NA	NA
WP_021155625.1\|1797158_1798085_-	type II secretion system F family protein	NA	NA	NA	NA
WP_103026015.1\|1798077_1799430_-	CpaF family protein	NA	NA	NA	NA
WP_011004375.1\|1799426_1800746_-	pilus assembly protein	NA	NA	NA	NA
WP_021155626.1\|1800764_1802129_-	type II and III secretion system protein family protein	NA	NA	NA	NA
WP_058908463.1\|1802121_1803063_-	Flp pilus assembly protein CpaB	NA	NA	NA	NA
WP_011004379.1\|1803114_1803606_-	pilus assembly protein	NA	NA	NA	NA
WP_038962604.1\|1803683_1804235_-	prepilin peptidase	NA	NA	NA	NA
WP_011004381.1\|1804244_1804421_-	Flp family type IVb pilin	NA	NA	NA	NA
WP_058908464.1\|1804996_1806058_-	collagen-like triple helix repeat-containing protein	NA	NA	NA	NA
WP_058908465.1\|1806532_1807912_+	hemagglutinin	NA	NA	NA	NA
WP_019719717.1\|1808209_1809883_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_021155630.1\|1810005_1811298_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058908466.1\|1811537_1813625_+	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	7.5e-08	25.4
WP_011004387.1\|1814013_1814322_+	H-NS histone family protein	NA	NA	NA	NA
WP_028854447.1\|1814427_1815969_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-10	62.3
WP_058908467.1\|1816105_1817542_-	PAS domain-containing protein	NA	NA	NA	NA
WP_011004390.1\|1817592_1818618_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.4e-79	45.4
WP_058908468.1\|1818777_1819749_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011004393.1\|1820536_1821325_+	trehalose-phosphatase	NA	NA	NA	NA
WP_011004394.1\|1821321_1822719_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_011004395.1\|1822783_1823245_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011004396.1\|1823391_1823817_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_058908469.1\|1823863_1824883_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	3.8e-53	38.3
WP_020829910.1\|1824973_1825747_-	hypothetical protein	NA	NA	NA	NA
WP_019719712.1\|1825851_1826799_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058908470.1\|1827080_1828154_+	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.1e-15	25.1
WP_058908472.1\|1829801_1833011_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-68	22.1
WP_028854458.1\|1833030_1834557_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_058908473.1\|1834734_1835550_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_103026016.1\|1835763_1836861_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_103025859.1\|1837160_1838612_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_038938784.1\|1839836_1840850_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_071624213.1\|1842073_1843645_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-73	36.2
WP_103025506.1\|1843676_1844027_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	7.1e-20	44.3
WP_103025505.1\|1844026_1844491_-\|transposase	transposase	NA	NA	NA	NA
WP_011004407.1\|1844634_1845042_-	DUF2000 family protein	NA	NA	NA	NA
WP_011004408.1\|1845119_1845608_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058908878.1\|1845674_1846172_+	MaoC family dehydratase	NA	NA	NA	NA
WP_011003443.1\|1846306_1847638_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_020371865.1\|1849112_1849817_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	6.1e-10	31.8
1846613:1847716	attR	NA	NA	NA	NA
WP_020829900.1\|1849819_1850752_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_016726919.1\|1850772_1851141_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_028861799.1\|1851288_1852293_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058907295.1\|1852530_1852830_+	hypothetical protein	NA	NA	NA	NA
WP_028861801.1\|1852853_1853918_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.2e-79	41.9
WP_103026017.1\|1853914_1854604_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_016726916.1\|1854605_1855586_+	amidohydrolase	NA	NA	NA	NA
WP_016726915.1\|1855702_1856080_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_058907293.1\|1856760_1857498_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_058907292.1\|1858309_1858903_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058907291.1\|1859114_1860203_+	hydrolase	NA	NA	NA	NA
WP_058907290.1\|1860284_1861205_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011004413.1\|1861228_1862296_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.2e-87	47.2
WP_058907289.1\|1862644_1863616_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016726143.1\|1863788_1864454_-	aquaporin family protein	NA	NA	NA	NA
WP_103026018.1\|1864459_1864954_-	arsenate reductase ArsC	NA	NA	NA	NA
WP_011004418.1\|1865051_1865375_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058907288.1\|1865697_1867122_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_058907287.1\|1867319_1867787_-	hypothetical protein	NA	NA	NA	NA
WP_016724496.1\|1867910_1868312_-	hypothetical protein	NA	NA	NA	NA
WP_058907286.1\|1868441_1868870_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_103026019.1\|1869109_1869688_-	suppressor of fused domain protein	NA	NA	NA	NA
WP_103026020.1\|1869689_1869893_-	type IV secretion protein Rhs	NA	NA	NA	NA
WP_016723619.1\|1870050_1871016_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_020829882.1\|1875446_1875869_-	DcrB-related protein	NA	NA	NA	NA
WP_058907283.1\|1875920_1878203_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_016724492.1\|1878681_1879578_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011004430.1\|1879853_1880387_-	response regulator transcription factor	NA	NA	NA	NA
WP_011004432.1\|1881764_1882679_+	glutaminase	NA	NA	NA	NA
WP_019719674.1\|1882935_1883622_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_016726158.1\|1883618_1884356_+	sulfate/molybdate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-19	32.8
WP_058907282.1\|1884399_1885296_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011004436.1\|1885399_1886026_+	NADPH-dependent F420 reductase	NA	NA	NA	NA
WP_072633714.1\|1886057_1887779_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011004439.1\|1887890_1888088_+	tautomerase	NA	NA	NA	NA
WP_019719669.1\|1888176_1888986_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058907281.1\|1889074_1889569_-	hypothetical protein	NA	NA	NA	NA
WP_011004442.1\|1889673_1892421_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	8.1e-10	31.0
WP_016726161.1\|1893118_1893424_+	hypothetical protein	NA	NA	NA	NA
WP_011004443.1\|1893420_1893852_+	hypothetical protein	NA	NA	NA	NA
WP_058907279.1\|1893902_1894877_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011004445.1\|1894851_1895100_+	DUF1272 domain-containing protein	NA	NA	NA	NA
WP_011004446.1\|1895331_1895772_+	universal stress protein	NA	NA	NA	NA
WP_011004447.1\|1895845_1896373_-	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_011004448.1\|1896508_1897168_-	response regulator	NA	NA	NA	NA
WP_058907278.1\|1897151_1898690_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_058907277.1\|1898743_1899007_-	hypothetical protein	NA	NA	NA	NA
WP_038937866.1\|1899139_1899841_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011003443.1\|1900194_1901526_+\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_071653928.1\|1901651_1902476_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2087075 : 2144887

Burkholderia_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087451503.1\|2087075_2087881_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_139180419.1\|2088201_2088588_+	hypothetical protein	NA	NA	NA	NA
WP_074960931.1\|2088751_2090050_+	hypothetical protein	NA	NA	NA	NA
WP_103025508.1\|2090233_2091467_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-127	79.5
WP_016725410.1\|2091564_2092023_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_089190850.1\|2092499_2093865_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.2e-76	53.8
WP_058908294.1\|2093939_2094413_-	hypothetical protein	NA	NA	NA	NA
WP_058908295.1\|2094676_2096056_+	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.6e-61	32.1
WP_011004631.1\|2096138_2096480_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_016724601.1\|2096579_2097137_-	hypothetical protein	NA	NA	NA	NA
WP_011004633.1\|2097444_2098449_+	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_058908296.1\|2098472_2101106_-	hypothetical protein	NA	NA	NA	NA
WP_016723494.1\|2101415_2101967_+	YggT family protein	NA	NA	NA	NA
WP_058908297.1\|2102088_2102271_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_016723495.1\|2102280_2102517_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_058908298.1\|2103254_2104394_+	hypothetical protein	NA	NA	NA	NA
WP_058908299.1\|2104533_2105622_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011004640.1\|2105652_2106414_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_011004641.1\|2106423_2107191_-	hypothetical protein	NA	NA	NA	NA
WP_058908300.1\|2107206_2109066_-	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_011004643.1\|2109062_2111153_-	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_011004644.1\|2111359_2112523_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_016723501.1\|2112763_2113438_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_103026031.1\|2113460_2114786_-	MFS transporter	NA	NA	NA	NA
WP_011004647.1\|2114862_2115327_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_058908302.1\|2115470_2116418_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_071507757.1\|2116535_2117579_+	porin	NA	NA	NA	NA
WP_071507747.1\|2117591_2119472_+	TIM barrel protein	NA	NA	NA	NA
WP_011004651.1\|2119547_2120210_-	protein phosphatase CheZ	NA	NA	NA	NA
WP_011004652.1\|2120209_2120611_-	chemotaxis protein CheY	Q8QKV4	Ectocarpus_siliculosus_virus	8.8e-06	46.2
WP_019719938.1\|2120785_2121925_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_011004654.1\|2121945_2122647_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_011004655.1\|2122643_2123522_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_058908304.1\|2124137_2125961_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.8e-09	36.2
WP_011004657.1\|2126128_2126620_-	hypothetical protein	NA	NA	NA	NA
WP_058908305.1\|2126689_2128864_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_103026032.1\|2128882_2129296_-	response regulator	NA	NA	NA	NA
WP_011004660.1\|2129340_2130285_-	flagellar motor protein MotB	NA	NA	NA	NA
WP_003263511.1\|2130369_2131230_-	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_011004661.1\|2131681_2132242_-	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_003263508.1\|2132316_2132634_-	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_081049967.1\|2133386_2133746_-	hypothetical protein	NA	NA	NA	NA
WP_011004663.1\|2133802_2134249_+	hypothetical protein	NA	NA	NA	NA
WP_103026033.1\|2134334_2135948_+	hypothetical protein	NA	NA	NA	NA
WP_058908307.1\|2136162_2137566_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011004666.1\|2137640_2138480_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_058908308.1\|2138497_2141311_-	non-ribosomal peptide synthetase	NA	NA	NA	NA
WP_103025546.1\|2141445_2142432_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.2e-151	82.3
WP_011003443.1\|2142649_2143981_-\|transposase	IS701-like element ISRso17 family transposase	NA	NA	NA	NA
WP_071653928.1\|2144062_2144887_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP025986.1|WP_058907287.1|1867319_1867787_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP025986.1|WP_016726161.1|1893118_1893424_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP025986.1|WP_011004443.1|1893420_1893852_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP025986.1|WP_058907287.1|1867319_1867787_-|hypothetical-protein

1867319_1867787_-

155 aa aa

HTH_20,HTH_1

Identity	Hit_domain_coverage
0.4666666666666667	0.9508196721311475

1765305-1902476

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP025986_2	Orphan	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	1805704-1805686	1

1. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 position: 1805704-1805686, mismatch: 1

aacccgaatccgatcggca	CRISPR spacer
aacgcgaatccgatcggca	Protospacer
*** ***************

NZ_CP025986.1|WP_016726161.1|1893118_1893424_+|hypothetical-protein

1893118_1893424_+

101 aa aa

HTH_ARAC

Identity	Hit_domain_coverage
0.4049586776859504	1.0

1765305-1902476

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP025986_2	Orphan	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	1805704-1805686	1

1. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 position: 1805704-1805686, mismatch: 1

aacccgaatccgatcggca	CRISPR spacer
aacgcgaatccgatcggca	Protospacer
*** ***************

NZ_CP025986.1|WP_011004443.1|1893420_1893852_+|hypothetical-protein

1893420_1893852_+

143 aa aa

HTH_ARAC

Identity	Hit_domain_coverage
0.4049586776859504	1.0

1765305-1902476

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP025986_2	Orphan	2.1\|307561\|19\|NZ_CP025986\|CRISPRCasFinder	307561-307579	19	1805704-1805686	1

1. spacer 2.1|307561|19|NZ_CP025986|CRISPRCasFinder matches to NZ_CP025986 position: 1805704-1805686, mismatch: 1

aacccgaatccgatcggca	CRISPR spacer
aacgcgaatccgatcggca	Protospacer
*** ***************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025985

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025986

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information