CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP026086	Acinetobacter pittii strain WCHAP005069 plasmid pOXA58_005069, complete sequence	0 crisprs	NA	2
NZ_CP026087	Acinetobacter pittii strain WCHAP005069 plasmid p1_005069, complete sequence	0 crisprs	WYL	2
NZ_CP026089	Acinetobacter pittii strain WCHAP005069 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3	14
NZ_CP026088	Acinetobacter pittii strain WCHAP005069 plasmid p2_005069, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5142 : 70629

Escherichia_phage(29.41%)

transposase,integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067858.1\|5142_5847_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_000557454.1\|6653_7514_+	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
WP_000587837.1\|7526_8069_+	AAA family ATPase	NA	NA	NA	NA
WP_000951934.1\|8550_8742_-	hypothetical protein	NA	NA	NA	NA
WP_000248278.1\|8765_8993_+	hypothetical protein	NA	NA	NA	NA
WP_000080860.1\|9043_10180_+	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_014342213.1\|11807_11933_-	hypothetical protein	NA	NA	NA	NA
WP_000992281.1\|14594_15176_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.8e-53	57.5
WP_001051769.1\|15525_15714_+	hypothetical protein	NA	NA	NA	NA
WP_000669794.1\|15703_17329_+	N-6 DNA methylase	A0A1J0F9H0	Only_Syngen_Nebraska_virus	2.1e-13	28.9
WP_046267519.1\|17429_20423_-	Eco57I restriction-modification methylase domain-containing protein	A0A2R2ZGH5	Clostridioides_phage	2.0e-22	25.0
WP_005248666.1\|20620_20878_-	hypothetical protein	NA	NA	NA	NA
WP_079398607.1\|20958_21399_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	2.4e-17	45.7
WP_001067784.1\|21417_22122_-\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8
WP_001445143.1\|23046_23298_+	hypothetical protein	NA	NA	NA	NA
WP_000251875.1\|23191_23494_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_001043260.1\|23580_24396_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
WP_085940648.1\|24485_25575_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_170628443.1\|25772_26132_-	phenol hydroxylase	NA	NA	NA	NA
WP_001138082.1\|26483_29369_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-190	39.9
WP_001082319.1\|30199_31003_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_000480968.1\|31002_31839_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_058199817.1\|32243_33023_+	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	3.1e-31	35.5
WP_000480968.1\|33334_34171_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001067858.1\|36478_37183_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_000934716.1\|39704_40970_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_046267491.1\|40969_41275_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000896237.1\|42194_42452_-	hypothetical protein	NA	NA	NA	NA
WP_046267492.1\|42801_43398_-	putative adenosine monophosphate-protein transferase Fic	NA	NA	NA	NA
WP_000946582.1\|43410_43578_-	DUF2559 family protein	NA	NA	NA	NA
WP_000911011.1\|43851_44316_+	hypothetical protein	NA	NA	NA	NA
WP_046267493.1\|44328_46668_+	hypothetical protein	NA	NA	NA	NA
WP_046267494.1\|46672_49873_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000550047.1\|50200_50419_-	hypothetical protein	NA	NA	NA	NA
WP_001190352.1\|50423_51719_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	5.3e-129	51.5
WP_000038643.1\|51733_52360_-	hypothetical protein	A0A2H4J538	uncultured_Caudovirales_phage	4.1e-26	41.6
WP_000337193.1\|52471_53113_-	SOS response-associated peptidase family protein	A0A218MNF5	uncultured_virus	4.9e-51	52.8
WP_000482095.1\|53352_54459_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	4.1e-29	26.2
WP_103254391.1\|54917_56137_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.7e-76	51.9
WP_103254391.1\|56302_57522_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.7e-76	51.9
WP_000059656.1\|58430_59630_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	4.3e-40	29.3
WP_000009204.1\|61302_61944_-	hypothetical protein	NA	NA	NA	NA
WP_000149838.1\|61955_62402_-	hypothetical protein	NA	NA	NA	NA
WP_000480997.1\|62636_63770_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_000535380.1\|63762_64947_+	hypothetical protein	NA	NA	NA	NA
WP_050551244.1\|64949_65444_+	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_130128032.1\|65491_67234_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_000470738.1\|67550_68036_+	hypothetical protein	NA	NA	NA	NA
WP_130128033.1\|68685_68970_+	hypothetical protein	NA	NA	NA	NA
WP_008942541.1\|69303_70629_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

95124 : 102548

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221358.1\|95124_95418_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	2.6e-15	46.9
WP_000246755.1\|95407_95653_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	1.9e-11	42.0
WP_001060713.1\|95849_97199_-	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.8e-32	68.5
WP_026055779.1\|97195_98122_-	chromate resistance protein	NA	NA	NA	NA
WP_000678311.1\|98236_98803_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.1e-25	50.0
WP_000908082.1\|100276_100564_-	hypothetical protein	NA	NA	NA	NA
WP_000585007.1\|100566_101205_-	AAA family ATPase	Q2A085	Sodalis_phage	9.9e-44	45.5
WP_002046604.1\|101609_102548_+	replication initiation protein	A0A218MNI2	uncultured_virus	1.5e-43	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 76519

Acinetobacter_phage(26.32%)

integrase,transposase,protease

attL 594:613|attR 88342:88361

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
594:613	attL	NA	NA	NA	NA
WP_005804864.1\|1819_4486_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-157	34.7
WP_000276416.1\|5846_6824_-	oxidoreductase	NA	NA	NA	NA
WP_001043693.1\|6960_7893_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	8.4e-60	41.8
WP_000627021.1\|8437_8659_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000937271.1\|8853_9105_+	hypothetical protein	NA	NA	NA	NA
WP_000059636.1\|9636_10836_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	9.6e-40	29.1
WP_000684953.1\|11135_11567_+	hypothetical protein	NA	NA	NA	NA
WP_000631290.1\|11981_12620_-	glutathione S-transferase	NA	NA	NA	NA
WP_000859510.1\|12635_13655_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_000805351.1\|13800_14406_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001088959.1\|14513_14744_+	hypothetical protein	NA	NA	NA	NA
WP_000655283.1\|14827_15955_-	alkene reductase	NA	NA	NA	NA
WP_000697979.1\|16158_16836_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_002120170.1\|16921_18079_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_000920558.1\|18678_18981_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000402510.1\|19315_20146_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000842149.1\|20374_21487_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.2e-31	29.3
WP_001133624.1\|21508_21784_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_000941154.1\|22618_23578_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_001094923.1\|23693_24932_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_000794339.1\|24988_26281_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.5e-56	33.3
WP_000925802.1\|26293_27208_+	aromatic amino acid DMT transporter YddG	NA	NA	NA	NA
WP_001038516.1\|28579_29575_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000009381.1\|29564_30581_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_001180108.1\|30631_31531_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001059480.1\|31666_32407_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.5e-06	27.0
WP_002120211.1\|32480_33479_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000155817.1\|33499_33784_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_008942541.1\|34432_35758_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_000555567.1\|35971_36199_-	hypothetical protein	NA	NA	NA	NA
WP_002120200.1\|37007_37268_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000269908.1\|37260_37617_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_000478902.1\|38174_38858_+	hypothetical protein	NA	NA	NA	NA
WP_001081101.1\|39833_40154_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000593543.1\|40424_42380_-	AAA family ATPase	NA	NA	NA	NA
WP_000653919.1\|43802_48533_-	AAA family ATPase	NA	NA	NA	NA
WP_000443160.1\|48596_50636_-\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_001047021.1\|50665_53290_-	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_001030448.1\|53286_54657_-	hypothetical protein	NA	NA	NA	NA
WP_001098044.1\|54653_58187_-	BREX-1 system adenine-specific DNA-methyltransferase PglX	A0A2R2ZGH5	Clostridioides_phage	4.4e-08	19.2
WP_002120185.1\|58233_61914_-	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_000078544.1\|61954_62530_-	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_000893011.1\|62546_63158_-	DUF1819 family protein	NA	NA	NA	NA
WP_025464207.1\|63168_64035_-	WYL domain-containing protein	NA	NA	NA	NA
WP_000464612.1\|64830_65343_-	Fic family protein	NA	NA	NA	NA
WP_000755724.1\|65345_65531_-	hypothetical protein	NA	NA	NA	NA
WP_000743263.1\|65697_66630_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.9e-57	41.0
WP_025464206.1\|66760_66958_-	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	7.5e-11	57.1
WP_000994925.1\|67050_67269_-	hypothetical protein	A0A0R6PIC9	Moraxella_phage	4.0e-21	77.4
WP_000096286.1\|67325_67928_-	hypothetical protein	A0A0P0J0J1	Acinetobacter_phage	3.2e-36	62.2
WP_000453245.1\|68134_68404_+	transcriptional regulator	NA	NA	NA	NA
WP_000288004.1\|68458_68788_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.9e-23	64.6
WP_001258993.1\|68774_69062_+	helix-turn-helix domain-containing protein	A0A088CD40	Shigella_phage	3.3e-15	48.4
WP_000340067.1\|69098_69287_-	hypothetical protein	NA	NA	NA	NA
WP_002120129.1\|70027_70204_-	hypothetical protein	A0A0R6PIB1	Moraxella_phage	1.1e-08	57.7
WP_005804845.1\|70275_70599_-	hypothetical protein	NA	NA	NA	NA
WP_000372120.1\|72060_72702_-	hypothetical protein	A0A0P0I8J9	Acinetobacter_phage	3.2e-111	85.0
WP_000378528.1\|72670_73132_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.0e-55	73.8
WP_001136766.1\|73192_73648_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	4.7e-80	95.4
WP_004994718.1\|74250_75276_-\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
WP_000152660.1\|75399_75636_-	hypothetical protein	NA	NA	NA	NA
WP_162097055.1\|75829_75976_-	hypothetical protein	NA	NA	NA	NA
WP_000395699.1\|76048_76519_-	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	8.3e-56	66.4
88342:88361	attR	NA	NA	NA	NA

DBSCAN-SWA_2

88373 : 90068

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000254418.1\|88373_89273_-	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	3.0e-14	37.4
WP_000104830.1\|89291_90068_-	AAA family ATPase	Q8JL10	Natrialba_phage	1.8e-18	36.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP026089

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026089_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026089_1

2070154-2070267

Orphan

Consensus_repeat	Method
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026089_1

>merge|NZ_CP026089|1|2070154-2070267|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

>NZ_CP026089|1|1|2070154-2070267|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAAC
CGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026089.2\|WP_002113519.1\|2072811_2074083_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP026089.2\|WP_002113740.1\|2062188_2063475_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182433
NZ_CP026089.2\|WP_000331400.1\|2066187_2067042_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP026089.2\|WP_002113836.1\|2071924_2072620_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP026089.2\|WP_002113553.1\|2075112_2076171_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
NZ_CP026089.2\|WP_002113812.1\|2079963_2080983_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP026089.2\|WP_005076132.1\|2078426_2079962_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP026089.2\|WP_005802236.1\|2057994_2059413_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
NZ_CP026089.2\|WP_002113810.1\|2074152_2075064_+\|bestrophin	unknown	unknown	gnl\|CDD\|376448
NZ_CP026089.2\|WP_001983845.1\|2065795_2066191_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP026089.2\|WP_002113563.1\|2077012_2078416_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP026089.2\|WP_001177517.1\|2080996_2081959_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_CP026089.2\|WP_002113934.1\|2069273_2070065_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP026089.2\|WP_002113669.1\|2065091_2065700_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP026089.2\|WP_005076109.1\|2063658_2065008_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP026089.2\|WP_002113912.1\|2067208_2068126_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP026089.2\|WP_002113744.1\|2076200_2076986_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
NZ_CP026089.2\|WP_002113898.1\|2082321_2083308_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
NZ_CP026089.2\|WP_002113700.1\|2068159_2069164_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|168683
NZ_CP026089.2\|WP_002113754.1\|2059467_2061672_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805

Protein	Function_ID	Function_description	E-value
NZ_CP026089.2\|WP_002113519.1\|2072811_2074083_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.04762e-122
NZ_CP026089.2\|WP_002113740.1\|2062188_2063475_+\|MFS-transporter	gnl\|CDD\|182433	PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional.	6.94672e-167
NZ_CP026089.2\|WP_000331400.1\|2066187_2067042_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
NZ_CP026089.2\|WP_002113836.1\|2071924_2072620_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.56698e-86
NZ_CP026089.2\|WP_002113553.1\|2075112_2076171_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
NZ_CP026089.2\|WP_002113812.1\|2079963_2080983_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	7.15262e-167
NZ_CP026089.2\|WP_005076132.1\|2078426_2079962_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	3.94652e-113
NZ_CP026089.2\|WP_005802236.1\|2057994_2059413_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
NZ_CP026089.2\|WP_002113810.1\|2074152_2075064_+\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	2.35864e-81
NZ_CP026089.2\|WP_001983845.1\|2065795_2066191_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
NZ_CP026089.2\|WP_002113563.1\|2077012_2078416_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP026089.2\|WP_001177517.1\|2080996_2081959_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
NZ_CP026089.2\|WP_002113934.1\|2069273_2070065_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	7.30352e-23
NZ_CP026089.2\|WP_002113669.1\|2065091_2065700_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	1.57248e-84
NZ_CP026089.2\|WP_005076109.1\|2063658_2065008_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	7.57664e-60
NZ_CP026089.2\|WP_002113912.1\|2067208_2068126_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	6.73638e-15
NZ_CP026089.2\|WP_002113744.1\|2076200_2076986_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.5012e-113
NZ_CP026089.2\|WP_002113898.1\|2082321_2083308_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
NZ_CP026089.2\|WP_002113700.1\|2068159_2069164_-\|hypothetical-protein	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	2.12235e-76
NZ_CP026089.2\|WP_002113754.1\|2059467_2061672_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.33284e-104

>NZ_CP026089.2|WP_002113934.1|2069273_2070065_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>NZ_CP026089.2|WP_002113700.1|2068159_2069164_-|hypothetical-protein
MKRVNLAICGFGRIGQQIAELLLNRTTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLEQVQADVIIETGPSDYVTGGKGLFYLDYALTHSMNAIAVSKGALVVDGKKLVNLAPQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIEGVFTGTTNFILNDMLQHECAFAESLEKAQAKGIAEPDSSFEVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTADHIRDWKKENVIPRLVGFIHIKNQQIQTGVELRLVSANHPFAHLQGSNKCIRALTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>NZ_CP026089.2|WP_002113912.1|2067208_2068126_+|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAAILGLIGIVLLFWHDLVNSQFNAQLLMGIGLCAVGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVILSLALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYVWALNAVFGILLILLGNYLMFSKLEIGKKLFNSQKNCEKQA
>NZ_CP026089.2|WP_000331400.1|2066187_2067042_-|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>NZ_CP026089.2|WP_001983845.1|2065795_2066191_+|helix-turn-helix-transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>NZ_CP026089.2|WP_002113669.1|2065091_2065700_-|NAD(P)H-dependent-oxidoreductase
MELLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEIAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>NZ_CP026089.2|WP_005076109.1|2063658_2065008_+|chromate-efflux-transporter
MENEKSPLPESIIQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWFVAIAAFLAIFVLKLPFPLIVLSAGIAGYLTSKKYPELFSSAAGHKSSQKDYGSAFIDDDTPPPEHAKFHWPRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGFEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAAFITVGAFIALFRFNVNVLYVIFASALVGLAVTFFS
>NZ_CP026089.2|WP_002113740.1|2062188_2063475_+|MFS-transporter
MTYTQEEKRSRIRGIVGAASGNLVEWFDFYIYAVFAAYFTQALTAPDMDSTTKSIYVWGVFAASFFMRPIGSWVFGRIADRHGRKKSMVISICLMALSSFLFAALPTYDQVGLFAPFLLLVVRLLQGLSVGGEYGAVATYMSELGLKGQRGFYSSFQYVTLSGGQLLASLLGVILLTFLSEQQLHDGGWRIPFVIGGIAAILSLLARSRLEETLSHQDSERKESGSLRELFKKHWKTFLLVVGYTSAGSLTFYVETVYSKTYLTNLGMDGKTVGYIMTFALFVYMCAQPVFGAISDRIGRRSSMLAFSLLSAIFIYPVMVIGMRAYIDSPIIIALLLIFMMMLLSFYTSISGLVKAEMFPPHVRALGVGFSYAVGNALFGGSAPSVALQFKAAGIENTFFIYVIVMLIICFLCSLALPKKPDYLEHDH
>NZ_CP026089.2|WP_002113754.1|2059467_2061672_-|TonB-dependent-siderophore-receptor
MHGMAGSYSMERRSINLHFMTCSKTALASSIALITSVVYANEAEVSQLPTITVNATQNNDALYTSKKVNLSGFQTDDLKKVPASITTITSERIEDQHAKTLTDVIKNDSSLGDGYAAIGYYPNFVARGFALDLGSSYLINGHTIRGEQNVALENKEQVEILKGISAIQSGMSTPGGVVNYVTKRPADVKNIAVDANSEGGYTLATDVGGFINDSFGYRINLAHESIHPNVHHANGKREFGSVALDWKINERSKLLFDIEAQHQSQRSVPGYQLLDGQEVPTNVDQDRLLGYQSWSKPVVNNSVNASLKYQYAFNDQWNGTLSASQSRVVIDDNSAFPWGCYNDICEYSGLGNTFDKHGNYDIYDFRSPDDTRITNQFAAGLNGQFNTANIQHQIAFELQRTYKTLKHHTPLNVVVGTGNIYEDTIDYSPSSESLGDRYKALESDQTAFTISDRVQFNDQWSTLLGGKLIHLDEQTYNSDGQQSRDTDLNKFLPQLALMYSPTAGTNLYASYAKGLSDGGEAPWFANNALEVLSPKNSEQYEIGIKQQIRNFLVTAAIFDLKQDNQYSKVNAEGTFDFVSQGEQHNQGIELGLTGALTDKLDVSSGITYTKSRLVDIDNDSYKGHQTQNVPKVRATAQLSYKVPSVEGLRLLSGMQYSSSKYANKEGTAKVGGYSVFNIGAAYKTNFAGHDTTFRFNIDNLFNKKYWRDVGAFMGDDYLFLGNPRTAQFSTTFSF
>NZ_CP026089.2|WP_005802236.1|2057994_2059413_+|aspartate-ammonia-lyase
MMNAEITTRIEKDLIGYREINNNDYYGVQTLRALENFNLTQSKVGNFPHLIKALAMVKLACAEANYNLKSLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHAKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFRNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALAKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQSKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQMLDDILSINNMVKPKMSA
>NZ_CP026089.2|WP_002113836.1|2071924_2072620_-|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITHGCMLKVGNLSIEARYTPGHTNACTSYLVENMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHRQLFSLPDDTIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>NZ_CP026089.2|WP_002113519.1|2072811_2074083_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFESEQDFFILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENMAALIQDHHNQYLEINTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIADQGELTEQLEDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLNAEDYVKLPETNTELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>NZ_CP026089.2|WP_002113810.1|2074152_2075064_+|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLTNEQREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKILKDGEISDIIYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>NZ_CP026089.2|WP_002113553.1|2075112_2076171_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGKGVDDIEIGQHVVVEPYIVSDDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHEETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>NZ_CP026089.2|WP_002113744.1|2076200_2076986_-|acetoin-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDQLNDVQQEIQALGVNASIFIANVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASNDSDYITGQSILTDGGIVYR
>NZ_CP026089.2|WP_002113563.1|2077012_2078416_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHSGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNHVTVFNGRAQLTAKEKIEVTDAQGKSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEDLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIVNGQVHCVIETANDVQTIVFDRVLSAIGVQPNATGLGLEHLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAQNLPIRIGKFSLTANGKALAIGDASGFVKTVIHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>NZ_CP026089.2|WP_005076132.1|2078426_2079962_-|2-oxo-acid-dehydrogenase-subunit-E2
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEISDAEIEQFIASLGGSAAKAPETPSEQSKAETFAPVTEKAEQPQPVAASASVPVKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>NZ_CP026089.2|WP_002113812.1|2079963_2080983_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENELEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDAAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>NZ_CP026089.2|WP_001177517.1|2080996_2081959_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>NZ_CP026089.2|WP_002113898.1|2082321_2083308_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEINRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVKNLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLELLKRFKAYCPDIKTKSGLMVGLGEIEAEVLALLNDLKDYQVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTRHGKRLGFKNIWSGPMVRSSYFADRQYFGEEVPKPFSRQDVLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

938015 : 989314

Acinetobacter_phage(94.64%)

plate,capsid,integrase,terminase,protease,tail

attL 933676:933690|attR 982147:982161

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
933676:933690	attL	NA	NA	NA	NA
WP_002120604.1\|938015_938306_+	co-chaperone GroES	A0A221S322	uncultured_virus	9.7e-15	43.5
WP_002120607.1\|938364_939999_+	chaperonin GroEL	A0A219YK78	uncultured_virus	8.1e-175	60.8
WP_068525319.1\|940137_940362_-	hypothetical protein	A0A0P0J067	Acinetobacter_phage	9.8e-07	44.1
WP_068525317.1\|940362_940704_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	5.8e-35	63.3
WP_057067082.1\|940700_941096_-	hypothetical protein	NA	NA	NA	NA
WP_086261742.1\|941088_941499_-	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	6.4e-12	96.9
WP_103254402.1\|941502_941748_-	hypothetical protein	A0A0P0I475	Acinetobacter_phage	5.7e-40	97.5
WP_103254403.1\|941749_942745_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.6e-75	51.2
WP_000206152.1\|942759_943527_-	hypothetical protein	NA	NA	NA	NA
WP_103254404.1\|943538_943862_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.5e-56	97.2
WP_064792734.1\|943864_944305_-	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	2.0e-72	95.9
WP_002044671.1\|944501_944678_+	hypothetical protein	NA	NA	NA	NA
WP_000249253.1\|944672_944945_-	hypothetical protein	NA	NA	NA	NA
WP_004888470.1\|944995_945211_-	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	7.9e-30	97.2
WP_103254405.1\|945225_945990_-	LexA family transcriptional regulator	A0A0P0J076	Acinetobacter_phage	1.1e-142	97.2
WP_000996060.1\|946098_946350_+	hypothetical protein	A0A0N7IRE1	Acinetobacter_phage	2.4e-38	95.2
WP_000049332.1\|946360_946681_+	hypothetical protein	A0A0P0HSE9	Acinetobacter_phage	3.2e-43	88.7
WP_103254406.1\|946736_947015_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	7.3e-36	94.3
WP_068600424.1\|947011_947308_+	hypothetical protein	A0A0D4DCL5	Acinetobacter_phage	1.8e-48	99.0
WP_103254407.1\|947304_947649_+	hypothetical protein	A0A0P0IVS7	Acinetobacter_phage	3.4e-51	96.4
WP_086324195.1\|948604_949375_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	9.2e-145	98.0
WP_086324194.1\|949371_949839_+	adenine methyltransferase	S5MUL8	Brevibacillus_phage	1.1e-47	59.4
WP_103254408.1\|949835_949970_+	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	4.5e-15	88.6
WP_086324193.1\|949956_950280_+	hypothetical protein	A0A0P0I8A5	Acinetobacter_phage	1.2e-29	84.0
WP_171490413.1\|950276_950450_+	hypothetical protein	A0A1X9SFD3	Acinetobacter_phage	4.1e-21	80.8
WP_086324192.1\|950442_950649_+	hypothetical protein	NA	NA	NA	NA
WP_086324191.1\|950638_950962_+	hypothetical protein	NA	NA	NA	NA
WP_086324190.1\|950961_951357_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	4.4e-66	95.4
WP_000783471.1\|951353_951854_+	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	2.9e-91	97.6
WP_000508252.1\|951936_952701_+	hypothetical protein	A0A0P0IKQ5	Acinetobacter_phage	7.3e-86	91.8
WP_000715267.1\|952931_953690_+	hypothetical protein	A0A0P0J0C5	Acinetobacter_phage	5.2e-116	80.2
WP_000787531.1\|953784_954432_+	hypothetical protein	A0A0N7IRF1	Acinetobacter_phage	4.7e-126	97.7
WP_065087255.1\|954479_954995_+	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	2.7e-84	94.2
WP_068525556.1\|954991_956650_+\|terminase	terminase	A0A0P0IVT4	Acinetobacter_phage	0.0e+00	98.7
WP_068525555.1\|956660_958073_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	2.1e-256	97.2
WP_068525553.1\|958143_958731_+\|capsid	minor capsid protein	A0A0P0IKX5	Acinetobacter_phage	8.1e-101	95.3
WP_068525551.1\|958776_960090_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	8.4e-207	97.3
WP_000525986.1\|960093_960570_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	3.0e-85	100.0
WP_068525278.1\|960635_961661_+	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	8.4e-194	99.7
WP_000041170.1\|961670_962102_+	hypothetical protein	A0A0P0IYA6	Acinetobacter_phage	8.1e-58	100.0
WP_068525276.1\|962105_962492_+	DUF4054 domain-containing protein	A0A0P0IKR4	Acinetobacter_phage	3.3e-66	98.4
WP_068525274.1\|962488_963049_+	hypothetical protein	A0A0P0J0D1	Acinetobacter_phage	2.0e-85	88.7
WP_068525272.1\|963035_963404_+	hypothetical protein	A0A0P0HSK8	Acinetobacter_phage	1.9e-63	97.5
WP_068525270.1\|963406_963946_+	hypothetical protein	A0A0P0IVT9	Acinetobacter_phage	7.7e-98	97.2
WP_068525268.1\|963949_965425_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	8.4e-272	98.2
WP_000109248.1\|965440_965884_+	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	3.3e-78	100.0
WP_068525266.1\|965883_966345_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	2.0e-78	99.3
WP_068525264.1\|966540_968565_+	hypothetical protein	A0A0P0IE11	Acinetobacter_phage	0.0e+00	99.1
WP_000821707.1\|968561_968918_-	DUF1311 domain-containing protein	A0A0P0IRF2	Acinetobacter_phage	4.5e-62	100.0
WP_001051325.1\|968917_969145_-	hypothetical protein	A0A0P0I8G2	Acinetobacter_phage	1.5e-31	100.0
WP_103254409.1\|969504_970098_+	hypothetical protein	A0A0P0IKS1	Acinetobacter_phage	1.4e-89	92.4
WP_032025451.1\|970099_970393_+	hypothetical protein	A0A0P0J0D9	Acinetobacter_phage	3.4e-47	94.8
WP_057095618.1\|970393_971353_+	hypothetical protein	A0A0P0HSL6	Acinetobacter_phage	1.5e-173	94.7
WP_057095617.1\|971354_972017_+	hypothetical protein	A0A0N7IRF4	Acinetobacter_phage	2.9e-123	95.5
WP_019767513.1\|972052_972406_+	hypothetical protein	A0A0P0IVU6	Acinetobacter_phage	1.1e-57	90.6
WP_057095616.1\|972408_973593_+\|plate	baseplate J/gp47 family protein	A0A0P0I499	Acinetobacter_phage	2.0e-207	93.1
WP_057095615.1\|973592_974183_+	DUF2612 domain-containing protein	A0A0P0IKZ0	Acinetobacter_phage	2.9e-98	87.8
WP_103254410.1\|974175_974766_+\|tail	tail fiber protein	A0A0P0IE19	Acinetobacter_phage	5.8e-22	96.1
WP_081313060.1\|974975_978002_+	BNR-4 repeat-containing protein	NA	NA	NA	NA
WP_063099377.1\|978060_978450_+	hypothetical protein	A0A0D4DBQ9	Acinetobacter_phage	2.0e-63	93.0
WP_068525568.1\|978492_979038_+	N-acetylmuramidase	A0A0N7IRF5	Acinetobacter_phage	2.8e-95	93.9
WP_068525566.1\|979313_979904_-	hypothetical protein	NA	NA	NA	NA
WP_016803055.1\|979966_980161_+	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	4.1e-25	88.9
WP_057095613.1\|980157_981369_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0P0IRB7	Acinetobacter_phage	1.0e-89	44.1
WP_002118962.1\|981720_982095_-	diacylglycerol kinase	NA	NA	NA	NA
WP_002118551.1\|982201_983164_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
982147:982161	attR	NA	NA	NA	NA
WP_002119000.1\|983210_984353_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_002118960.1\|984616_987712_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_002118395.1\|987784_988360_+	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_002118851.1\|988408_989314_-\|protease	protease HtpX	NA	NA	NA	NA

DBSCAN-SWA_2

1264091 : 1287785

Acinetobacter_phage(75.0%)

portal,head,terminase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103254414.1\|1264091_1266824_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	95.6
WP_002118860.1\|1266902_1269602_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	97.4
WP_002118425.1\|1269698_1270274_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.1e-109	98.4
WP_000529848.1\|1270397_1270667_-	hypothetical protein	A0A0P0J067	Acinetobacter_phage	8.7e-42	100.0
WP_000877062.1\|1270667_1271003_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	3.7e-34	62.4
WP_103254415.1\|1270999_1271395_-	hypothetical protein	NA	NA	NA	NA
WP_103254461.1\|1271391_1271769_-	hypothetical protein	NA	NA	NA	NA
WP_016803399.1\|1271999_1272245_-	hypothetical protein	A0A0P0I475	Acinetobacter_phage	1.1e-40	98.8
WP_103254403.1\|1272246_1273242_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.6e-75	51.2
WP_000206152.1\|1273256_1274024_-	hypothetical protein	NA	NA	NA	NA
WP_103254416.1\|1274035_1274359_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	3.6e-42	78.5
WP_042755503.1\|1274351_1274801_-	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	2.6e-75	98.6
WP_032018627.1\|1275008_1275758_-	helix-turn-helix transcriptional regulator	H1ZZB6	Pseudomonas_virus	6.4e-10	31.4
WP_019767546.1\|1275891_1276155_+	transcriptional regulator	NA	NA	NA	NA
WP_103254417.1\|1276215_1276716_+	hypothetical protein	NA	NA	NA	NA
WP_032050713.1\|1276767_1277094_+	hypothetical protein	NA	NA	NA	NA
WP_044424667.1\|1277090_1278047_+	helix-turn-helix domain-containing protein	A0A1V0E8B1	Vibrio_phage	1.4e-17	41.3
WP_044424666.1\|1278043_1278163_+	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	1.0e-10	91.7
WP_044424664.1\|1278159_1278429_+	hypothetical protein	NA	NA	NA	NA
WP_044424663.1\|1278421_1278790_+	hypothetical protein	NA	NA	NA	NA
WP_044424662.1\|1278782_1279040_+	hypothetical protein	NA	NA	NA	NA
WP_103254418.1\|1279052_1279469_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	3.4e-21	49.1
WP_057095589.1\|1279478_1279763_+	hypothetical protein	NA	NA	NA	NA
WP_068523697.1\|1279785_1280352_+	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	1.4e-46	52.5
WP_032007723.1\|1280735_1280921_+	hypothetical protein	NA	NA	NA	NA
WP_162900619.1\|1281033_1281195_+	hypothetical protein	NA	NA	NA	NA
WP_167370589.1\|1281202_1281373_+	hypothetical protein	NA	NA	NA	NA
WP_032007724.1\|1281365_1281836_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	1.3e-48	63.2
WP_032007725.1\|1281795_1282437_+	hypothetical protein	J7I4N9	Acinetobacter_phage	2.3e-104	82.2
WP_057095591.1\|1282495_1282966_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	7.7e-70	80.1
WP_103254419.1\|1282955_1284449_+\|terminase	phage terminase large subunit	A0A0D4DCE6	Acinetobacter_phage	2.6e-220	78.4
WP_086313155.1\|1284424_1286575_+\|portal	phage portal protein	I3VYW9	Thermoanaerobacterium_phage	3.3e-59	33.8
WP_019767565.1\|1286633_1287785_+\|head,protease	HK97 family phage prohead protease	I3VYW8	Thermoanaerobacterium_phage	1.7e-17	36.1

DBSCAN-SWA_3

1302131 : 1312387

Acinetobacter_phage(83.33%)

integrase

attL 1294559:1294573|attR 1319437:1319451

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1294559:1294573	attL	NA	NA	NA	NA
WP_103254425.1\|1302131_1304621_+	hypothetical protein	A0A1I9L2F3	Xanthomonas_phage	1.1e-05	21.9
WP_002122319.1\|1304684_1305074_+	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	2.6e-63	95.3
WP_103254426.1\|1305116_1305662_+	N-acetylmuramidase	J7I0Y1	Acinetobacter_phage	4.3e-96	93.4
WP_000551485.1\|1305768_1306698_-	FRG domain-containing protein	NA	NA	NA	NA
WP_000947609.1\|1307348_1308545_-\|integrase	tyrosine-type recombinase/integrase	A0A0P0IRB7	Acinetobacter_phage	1.6e-225	99.7
WP_002119079.1\|1309028_1310831_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	0.0e+00	91.7
WP_078210490.1\|1310827_1312387_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	6.6e-259	87.9
1319437:1319451	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1574073 : 1592419

Pseudomonas_phage(37.5%)

capsid,transposase,integrase

attL 1567663:1567677|attR 1587157:1587171

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1567663:1567677	attL	NA	NA	NA	NA
WP_002119394.1\|1574073_1575333_-\|capsid	minor capsid protein	I6PBD2	Pseudomonas_phage	3.3e-75	36.9
WP_002119404.1\|1575332_1576946_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.8e-110	41.7
WP_002119411.1\|1577222_1577954_+	hypothetical protein	NA	NA	NA	NA
WP_002119417.1\|1577954_1579592_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	1.1e-115	45.3
WP_002119422.1\|1579591_1580158_-	DUF3486 family protein	J9SH37	Pseudomonas_phage	1.3e-18	37.9
WP_002119439.1\|1580165_1580459_-	hypothetical protein	J9SNG3	Pseudomonas_phage	2.7e-20	52.6
WP_002119398.1\|1580465_1580747_-	hypothetical protein	NA	NA	NA	NA
WP_016802887.1\|1580739_1581120_-	hypothetical protein	NA	NA	NA	NA
WP_016802888.1\|1581116_1581617_-	glycoside hydrolase family 108 protein	A0A0M3LSH2	Mannheimia_phage	3.0e-56	66.5
WP_016802889.1\|1581695_1582325_-	hypothetical protein	NA	NA	NA	NA
WP_016802890.1\|1582321_1583047_-	hypothetical protein	NA	NA	NA	NA
WP_016802891.1\|1583064_1583541_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016802892.1\|1583633_1583840_+	DNA-binding protein	A0A0S4L0D0	Pseudomonas_phage	9.6e-09	52.7
WP_171252973.1\|1583884_1584046_+	hypothetical protein	NA	NA	NA	NA
WP_016802894.1\|1584045_1584342_+	MarR family transcriptional regulator	Q5ZR02	Pseudomonas_phage	3.8e-14	45.6
WP_057066962.1\|1584354_1585239_+	DUF3102 domain-containing protein	Q6QID9	Burkholderia_phage	1.2e-28	34.5
WP_016803092.1\|1585241_1586993_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q5ZR04	Pseudomonas_phage	3.2e-100	36.5
WP_057066963.1\|1587002_1588280_+	AAA family ATPase	Q6QIE1	Burkholderia_phage	5.1e-92	47.0
1587157:1587171	attR	NA	NA	NA	NA
WP_016803091.1\|1588374_1588593_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_016803090.1\|1588589_1588826_+	hypothetical protein	NA	NA	NA	NA
WP_016803089.1\|1588826_1589498_+	DUF2752 domain-containing protein	A0A2H4JFV8	uncultured_Caudovirales_phage	1.6e-28	47.2
WP_016803088.1\|1589497_1590001_+	host-nuclease inhibitor Gam family protein	A0A2K9VGT9	Faecalibacterium_phage	2.9e-14	32.9
WP_000288872.1\|1590023_1590191_+	hypothetical protein	NA	NA	NA	NA
WP_016803087.1\|1590195_1590468_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.3e-21	62.2
WP_016803086.1\|1590467_1590647_+	hypothetical protein	NA	NA	NA	NA
WP_016803085.1\|1590683_1590968_+	hypothetical protein	NA	NA	NA	NA
WP_016803083.1\|1591556_1591781_+	hypothetical protein	NA	NA	NA	NA
WP_016803082.1\|1591782_1591995_+	hypothetical protein	K4IBU9	Acinetobacter_phage	1.6e-06	59.5
WP_016803081.1\|1591981_1592419_+	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	2.0e-11	32.6

DBSCAN-SWA_5

1598663 : 1651420

Acinetobacter_phage(36.36%)

tRNA,capsid,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002122283.1\|1598663_1599137_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002122200.1\|1599129_1601079_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.7e-83	32.7
WP_002122252.1\|1601085_1602030_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_005803553.1\|1602112_1602637_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_002122237.1\|1602777_1603635_+	DMT family transporter	NA	NA	NA	NA
WP_002122258.1\|1603674_1604328_-	oxygen-insensitive NAD(P)H nitroreductase	NA	NA	NA	NA
WP_005803551.1\|1604463_1604694_+	hypothetical protein	NA	NA	NA	NA
WP_002122216.1\|1604701_1605421_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_002122280.1\|1605436_1605946_-	peptidyl-prolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-13	34.7
WP_002122255.1\|1606113_1607841_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	7.5e-187	57.2
WP_002122166.1\|1608267_1608990_-	glutamine amidotransferase	NA	NA	NA	NA
WP_004994718.1\|1609106_1610132_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002119351.1\|1610246_1611062_-	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_002119346.1\|1611072_1612458_-	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_002119334.1\|1612472_1613909_-	ethanolamine permease	NA	NA	NA	NA
WP_002119354.1\|1614129_1615641_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_002119349.1\|1615783_1616974_+	transcriptional regulator	NA	NA	NA	NA
WP_002119321.1\|1616970_1617939_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002119340.1\|1618134_1619307_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_002119362.1\|1619537_1621250_+	AAA family ATPase	A0A172Q090	Acinetobacter_phage	5.7e-78	40.0
WP_078210520.1\|1621287_1621653_+	5-carboxymethyl-2-hydroxymuconate Delta-isomerase	NA	NA	NA	NA
WP_002119326.1\|1621775_1622603_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_078210521.1\|1622638_1623730_-	hypothetical protein	NA	NA	NA	NA
WP_002119338.1\|1623946_1624204_-	hypothetical protein	NA	NA	NA	NA
WP_002119359.1\|1624522_1627129_+	aminopeptidase N	NA	NA	NA	NA
WP_002119337.1\|1627713_1628244_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_002119329.1\|1628316_1629021_+	molecular chaperone	NA	NA	NA	NA
WP_103254429.1\|1629030_1631490_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_002163143.1\|1631480_1632500_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_002163145.1\|1632726_1633413_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_002163150.1\|1633420_1634182_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_002163146.1\|1634191_1634875_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_078210424.1\|1634991_1635510_+	chorismate mutase	NA	NA	NA	NA
WP_002163148.1\|1635559_1636579_+	hypothetical protein	NA	NA	NA	NA
WP_002163153.1\|1637186_1637738_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010326927.1\|1638642_1639668_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_005803535.1\|1639755_1640478_-	type 1 glutamine amidotransferase	A0A2K9L2L9	Tupanvirus	1.3e-07	22.9
WP_005068685.1\|1640740_1640971_+	hypothetical protein	NA	NA	NA	NA
WP_005803532.1\|1641121_1641496_+	TonB C-terminal domain-containing protein	NA	NA	NA	NA
WP_005803531.1\|1641764_1642034_+	hypothetical protein	NA	NA	NA	NA
WP_005803530.1\|1642339_1642798_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	8.7e-34	49.3
WP_002114613.1\|1642984_1643185_+	hypothetical protein	NA	NA	NA	NA
WP_002114626.1\|1643362_1643935_+	lysozyme	I2GUG4	Acinetobacter_phage	5.2e-52	69.0
WP_103254430.1\|1644018_1644435_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002114620.1\|1644545_1644860_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002114610.1\|1645436_1645679_+	hypothetical protein	NA	NA	NA	NA
WP_002114622.1\|1645862_1646969_+\|capsid	minor capsid protein	A0A0D4DBL9	Acinetobacter_phage	4.4e-148	70.2
WP_002114625.1\|1647131_1647395_+	hypothetical protein	NA	NA	NA	NA
WP_002114611.1\|1647451_1648306_-	DMT family transporter	NA	NA	NA	NA
WP_103254431.1\|1648528_1649398_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002114618.1\|1649587_1649719_+	hypothetical protein	NA	NA	NA	NA
WP_002114606.1\|1649993_1650281_+	hypothetical protein	NA	NA	NA	NA
WP_004994718.1\|1650394_1651420_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4

DBSCAN-SWA_6

2197354 : 2225456

Acinetobacter_phage(41.18%)

transposase,integrase,head,terminase,tail

attL 2210308:2210321|attR 2220731:2220744

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032014797.1\|2197354_2198377_-	phage protein	Q775C7	Bordetella_phage	1.6e-88	50.0
WP_032023956.1\|2198388_2199036_-	hypothetical protein	A0A2I7RHR0	Vibrio_phage	7.0e-13	39.6
WP_032014801.1\|2199004_2199334_-	hypothetical protein	NA	NA	NA	NA
WP_032014803.1\|2199330_2201022_-\|head,tail	head-tail connector protein	G9L6C2	Escherichia_phage	2.4e-68	32.2
WP_032014805.1\|2201023_2201278_-	hypothetical protein	NA	NA	NA	NA
WP_032014807.1\|2201355_2202978_-\|terminase	terminase	Q775B9	Bordetella_phage	1.4e-187	60.7
WP_032014808.1\|2202961_2203234_-	hypothetical protein	NA	NA	NA	NA
WP_004832869.1\|2203337_2204546_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
WP_032014809.1\|2204779_2204989_-	hypothetical protein	NA	NA	NA	NA
WP_032014811.1\|2204981_2205722_-\|terminase	terminase small subunit	A0A1Y0SUQ3	Pseudomonas_phage	3.7e-50	48.6
WP_025466602.1\|2205722_2205932_-	hypothetical protein	NA	NA	NA	NA
WP_031946179.1\|2205943_2206372_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	1.6e-50	73.4
WP_032014813.1\|2206364_2207117_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	2.2e-58	50.8
WP_068525379.1\|2207118_2208000_-	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_032014817.1\|2207996_2208362_-	hypothetical protein	NA	NA	NA	NA
WP_032014819.1\|2208358_2208937_-	hypothetical protein	NA	NA	NA	NA
WP_050676540.1\|2208933_2209791_-	hypothetical protein	NA	NA	NA	NA
WP_031946186.1\|2209787_2210009_-	hypothetical protein	NA	NA	NA	NA
WP_057071016.1\|2210067_2210424_-	hypothetical protein	J7I452	Acinetobacter_phage	4.2e-44	79.7
2210308:2210321	attL	NA	NA	NA	NA
WP_057071015.1\|2210432_2210621_-	hypothetical protein	NA	NA	NA	NA
WP_057071014.1\|2210724_2211450_+	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	4.9e-63	51.3
WP_068525136.1\|2211452_2211758_+	hypothetical protein	NA	NA	NA	NA
WP_068525138.1\|2211920_2212295_+	hypothetical protein	NA	NA	NA	NA
WP_031946191.1\|2212362_2213241_+	DUF2303 family protein	I6NVL7	Burkholderia_virus	1.8e-27	34.2
WP_032014827.1\|2213370_2213943_+	hypothetical protein	NA	NA	NA	NA
WP_057071010.1\|2213944_2214199_+	hypothetical protein	NA	NA	NA	NA
WP_032014831.1\|2214207_2215188_+	YqaJ viral recombinase family protein	A0A0A7RWR9	Clostridium_phage	2.7e-48	36.0
WP_032014833.1\|2215199_2216132_+	hypothetical protein	A0A2H4J6I3	uncultured_Caudovirales_phage	1.3e-52	66.0
WP_068525142.1\|2216204_2217686_+	ATP-dependent helicase	A0A075DXT4	Acinetobacter_phage	6.7e-67	34.9
WP_000214186.1\|2217682_2217916_+	protein ninH	NA	NA	NA	NA
WP_032014837.1\|2217912_2218293_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	1.4e-05	44.9
WP_032014839.1\|2218289_2218637_+	hypothetical protein	NA	NA	NA	NA
WP_032014841.1\|2218633_2218837_+	hypothetical protein	NA	NA	NA	NA
WP_032014843.1\|2218857_2219109_+	hypothetical protein	NA	NA	NA	NA
WP_002117952.1\|2219074_2220034_-\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	6.5e-47	35.3
WP_002117902.1\|2220211_2221354_-	cell division protein ZapE	NA	NA	NA	NA
2220731:2220744	attR	NA	NA	NA	NA
WP_078210401.1\|2221431_2222412_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_078210396.1\|2222575_2224123_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004832869.1\|2224247_2225456_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5

DBSCAN-SWA_7

2582804 : 2657816

Acinetobacter_phage(52.5%)

tRNA,terminase,integrase,coat,head,portal,protease,tail

attL 2619370:2619426|attR 2658857:2658913

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002163230.1\|2582804_2583275_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_002122108.1\|2583813_2584395_-	hypothetical protein	NA	NA	NA	NA
WP_002115795.1\|2585097_2585535_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_002115784.1\|2585621_2586926_-	MFS transporter	NA	NA	NA	NA
WP_002115802.1\|2587266_2587863_-	cytochrome b	NA	NA	NA	NA
WP_080549272.1\|2587875_2588892_-	catalase family peroxidase	NA	NA	NA	NA
WP_005802574.1\|2589176_2589578_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002115828.1\|2589738_2590209_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.2e-24	41.4
WP_002115790.1\|2590409_2590961_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_079377699.1\|2591658_2592252_-	hypothetical protein	NA	NA	NA	NA
WP_016802856.1\|2592467_2593343_-	EamA family transporter	NA	NA	NA	NA
WP_002115807.1\|2593461_2593929_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_002115774.1\|2594017_2595433_-	ethanolamine permease	NA	NA	NA	NA
WP_002115818.1\|2595614_2596616_+	phosphotransferase	NA	NA	NA	NA
WP_002115822.1\|2596690_2598016_+	hypothetical protein	NA	NA	NA	NA
WP_002115832.1\|2598323_2599358_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002115798.1\|2599480_2600821_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_002115830.1\|2601224_2603864_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.9e-33	25.2
WP_002115824.1\|2603925_2604456_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002051033.1\|2604799_2605123_+	ferredoxin family protein	NA	NA	NA	NA
WP_002115771.1\|2605305_2605977_+	peptidase M15	NA	NA	NA	NA
WP_002115787.1\|2606114_2606783_+	O-methyltransferase	W8CYT3	Bacillus_phage	1.2e-26	44.8
WP_002115820.1\|2606899_2607742_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.4e-36	33.9
WP_014206261.1\|2607897_2608494_-	chloramphenicol acetyltransferase CAT	M1HKK6	Paramecium_bursaria_Chlorella_virus	7.1e-12	55.6
WP_002115804.1\|2608501_2609101_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.9e-21	36.6
WP_005802601.1\|2609193_2610390_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005802602.1\|2610386_2612528_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.4e-28	24.9
WP_078210359.1\|2612524_2613748_-	TolC family protein	NA	NA	NA	NA
WP_002122331.1\|2614264_2615008_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-20	28.2
WP_002122334.1\|2615007_2615556_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_002122327.1\|2615539_2616088_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_002122322.1\|2616125_2616665_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_002122342.1\|2616668_2617646_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	7.3e-38	31.7
WP_103254443.1\|2617859_2619281_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-55	30.8
2619370:2619426	attL	NA	NA	NA	NA
WP_001171605.1\|2619634_2620648_+\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	3.8e-66	40.3
WP_000200052.1\|2620676_2620871_-	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	1.7e-23	85.5
WP_016803425.1\|2620933_2621524_+	hypothetical protein	NA	NA	NA	NA
WP_031977124.1\|2621788_2622505_+	hypothetical protein	NA	NA	NA	NA
WP_044431707.1\|2622705_2623248_-	N-acetylmuramidase	A0A0N7IRF5	Acinetobacter_phage	1.6e-95	93.3
WP_000433907.1\|2623290_2623680_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
WP_103254444.1\|2623744_2626234_-	hypothetical protein	A0A1I9L2F3	Xanthomonas_phage	1.0e-06	26.1
WP_103254445.1\|2626234_2626657_-	C40 family peptidase	A0A0B5A615	Paracoccus_phage	4.4e-08	33.3
WP_103254446.1\|2629717_2630575_-	DUF2163 domain-containing protein	A0A2D1GNT2	Pseudomonas_phage	7.4e-10	24.5
WP_044431695.1\|2630571_2631225_-	DUF2460 domain-containing protein	NA	NA	NA	NA
WP_044431692.1\|2631235_2634928_-	transglycosylase SLT domain-containing protein	A0A0U4JEA4	Pseudomonas_phage	3.9e-31	36.2
WP_002115956.1\|2634988_2635915_-	hypothetical protein	NA	NA	NA	NA
WP_052502921.1\|2636000_2636192_-	hypothetical protein	NA	NA	NA	NA
WP_016802932.1\|2636260_2636575_-	hypothetical protein	NA	NA	NA	NA
WP_016802933.1\|2636581_2637349_-	hypothetical protein	NA	NA	NA	NA
WP_016802934.1\|2637404_2637845_-	hypothetical protein	NA	NA	NA	NA
WP_016802935.1\|2637841_2638312_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_019767566.1\|2638308_2638860_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_103254447.1\|2639291_2640824_-	hypothetical protein	NA	NA	NA	NA
WP_023187816.1\|2640889_2642041_-\|head,protease	HK97 family phage prohead protease	I3VYW8	Thermoanaerobacterium_phage	1.7e-17	36.1
WP_023187817.1\|2642099_2644250_-\|portal	phage portal protein	I3VYW9	Thermoanaerobacterium_phage	1.7e-58	33.6
WP_002120468.1\|2644225_2645719_-\|terminase	phage terminase large subunit	A0A0D4DCE6	Acinetobacter_phage	1.1e-218	78.2
WP_002120471.1\|2645708_2646173_-	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	1.1e-57	73.7
WP_032025305.1\|2646231_2646873_-	hypothetical protein	J7I4N9	Acinetobacter_phage	4.0e-109	84.5
WP_032025303.1\|2646841_2647309_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.7e-65	82.2
WP_000134358.1\|2647321_2647513_-	hypothetical protein	J7I0V8	Acinetobacter_phage	2.6e-24	85.7
WP_000528643.1\|2647635_2647932_-	Lar family restriction alleviation protein	J7I457	Acinetobacter_phage	1.0e-56	96.9
WP_000959671.1\|2648054_2648789_-	hypothetical protein	J7HXD9	Acinetobacter_phage	5.1e-137	100.0
WP_002115761.1\|2648851_2649310_-	hypothetical protein	G3EN88	Psychrobacter_phage	2.4e-23	40.5
WP_002115758.1\|2649315_2649633_-	hypothetical protein	NA	NA	NA	NA
WP_001039748.1\|2649622_2649802_-	hypothetical protein	NA	NA	NA	NA
WP_000778996.1\|2649794_2650196_-	HNH endonuclease	K7P7B7	Enterobacteria_phage	7.6e-26	49.2
WP_000017820.1\|2650192_2650600_-	hypothetical protein	NA	NA	NA	NA
WP_002048056.1\|2650596_2650995_-	hypothetical protein	NA	NA	NA	NA
WP_002115752.1\|2650994_2651111_-	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	1.5e-11	94.4
WP_000050658.1\|2651107_2652070_-	helix-turn-helix domain-containing protein	A0A0P0HSN8	Acinetobacter_phage	4.4e-19	54.4
WP_103254464.1\|2652066_2652396_-	hypothetical protein	NA	NA	NA	NA
WP_032046608.1\|2652456_2652813_-	hypothetical protein	A0A0P0IKQ0	Acinetobacter_phage	1.0e-58	94.1
WP_032046606.1\|2652823_2653072_-	hypothetical protein	NA	NA	NA	NA
WP_032046605.1\|2653189_2653888_+	S24 family peptidase	A0A2H4JAJ5	uncultured_Caudovirales_phage	1.9e-32	43.0
WP_032046603.1\|2653904_2654207_+	hypothetical protein	A0A0D4DCL0	Acinetobacter_phage	6.5e-38	86.7
WP_057095661.1\|2654432_2654873_+	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	1.3e-47	67.3
WP_057095662.1\|2654875_2655199_+	hypothetical protein	A0A0P0IRC4	Acinetobacter_phage	3.5e-53	93.5
WP_000206152.1\|2655210_2655978_+	hypothetical protein	NA	NA	NA	NA
WP_032025297.1\|2655992_2656952_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	6.0e-162	91.2
WP_000654847.1\|2656953_2657199_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
WP_016803403.1\|2657202_2657610_+	phage protein	A0A0P0I8H3	Acinetobacter_phage	3.7e-12	94.1
WP_000028957.1\|2657606_2657816_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	6.3e-32	94.2
2658857:2658913	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2678552 : 2687033

Acinetobacter_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002117452.1\|2678552_2678780_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	8.1e-17	61.7
WP_002117455.1\|2679123_2680056_-	hypothetical protein	A0A1W6JP29	Morganella_phage	3.6e-42	34.2
WP_002117445.1\|2680295_2680913_+	LysE family translocator	NA	NA	NA	NA
WP_004994718.1\|2680987_2682013_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002119903.1\|2682099_2682645_-	glycosyl hydrolase 108	A0A0N7IRF5	Acinetobacter_phage	4.3e-72	69.1
WP_002119864.1\|2682675_2683065_-	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	3.0e-51	76.7
WP_002119927.1\|2683274_2683529_-	hypothetical protein	NA	NA	NA	NA
WP_002119885.1\|2684202_2684874_+	LexA family transcriptional regulator	A0A1B1P9J5	Acinetobacter_phage	1.2e-63	55.8
WP_002119938.1\|2685026_2685260_-	hypothetical protein	NA	NA	NA	NA
WP_005802637.1\|2685767_2687033_+	exodeoxyribonuclease VII large subunit	M1NLU2	Moumouvirus	8.1e-13	29.5

DBSCAN-SWA_9

2747750 : 2755962

uncultured_Caudovirales_phage(33.33%)

tRNA,transposase,integrase

attL 2746303:2746316|attR 2752532:2752545

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2746303:2746316	attL	NA	NA	NA	NA
WP_068525240.1\|2747750_2750387_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.7e-76	38.4
WP_002121611.1\|2750673_2751879_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PHZ3	Moraxella_phage	7.2e-104	50.5
WP_001289330.1\|2752040_2752535_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	4.8e-46	61.5
WP_002121526.1\|2752538_2753837_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	1.5e-155	60.8
2752532:2752545	attR	NA	NA	NA	NA
WP_002051611.1\|2753914_2754661_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.8e-12	33.3
WP_002045824.1\|2754798_2755962_-	glutathione-dependent formaldehyde dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	5.5e-08	26.5

DBSCAN-SWA_10

2764302 : 2790361

Acinetobacter_phage(88.89%)

terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002121604.1\|2764302_2764848_-	N-acetylmuramidase	A0A0P0IW03	Acinetobacter_phage	6.6e-97	96.1
WP_000433912.1\|2764890_2765280_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	8.6e-67	99.2
WP_002121538.1\|2765347_2768773_-	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	94.7
WP_000835159.1\|2768765_2769128_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	6.2e-51	79.2
WP_025464104.1\|2769124_2769631_-	DUF1833 family protein	J7HXQ5	Acinetobacter_phage	8.6e-91	97.6
WP_000277438.1\|2769630_2770029_-	hypothetical protein	J7I0X8	Acinetobacter_phage	2.4e-72	98.5
WP_002121607.1\|2770093_2770255_-	hypothetical protein	NA	NA	NA	NA
WP_002121623.1\|2770759_2775094_-	tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	70.2
WP_001275792.1\|2775224_2775488_-	hypothetical protein	NA	NA	NA	NA
WP_000721572.1\|2775489_2776170_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
WP_000966688.1\|2776268_2776673_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
WP_000838146.1\|2776765_2776948_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
WP_025464105.1\|2777273_2777789_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.8e-73	96.4
WP_002121543.1\|2777859_2778777_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.9e-166	97.7
WP_023187966.1\|2778829_2780158_-	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-86	49.1
WP_002121621.1\|2780157_2780511_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	1.5e-57	94.0
WP_002121567.1\|2780579_2780978_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	1.2e-68	94.7
WP_000539743.1\|2780979_2781348_-	hypothetical protein	A0A0P0IDX0	Acinetobacter_phage	1.1e-55	98.1
WP_002121581.1\|2781319_2781724_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.9e-61	88.1
WP_023187965.1\|2782461_2782830_-	hypothetical protein	A0A0P0I456	Acinetobacter_phage	7.2e-63	95.9
WP_002121501.1\|2782829_2783210_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	8.2e-54	84.9
WP_002121513.1\|2783213_2783744_-	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	4.2e-40	91.7
WP_002121495.1\|2783786_2784758_-	hypothetical protein	A0A2H4JIE6	uncultured_Caudovirales_phage	4.4e-136	72.7
WP_005802767.1\|2785672_2786965_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	4.9e-215	86.3
WP_000729387.1\|2786924_2787440_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
WP_002121497.1\|2787498_2788140_-	hypothetical protein	J7I4N9	Acinetobacter_phage	2.2e-123	96.2
WP_002121499.1\|2788108_2788543_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.4e-78	97.9
WP_001136775.1\|2788602_2789058_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
WP_004994718.1\|2789335_2790361_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4

DBSCAN-SWA_11

2794106 : 2803937

Acinetobacter_phage(54.55%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001277128.1\|2794106_2794583_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
WP_002118340.1\|2794579_2794981_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	8.1e-68	98.5
WP_032015116.1\|2795141_2796116_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	4.3e-147	82.1
WP_000654847.1\|2796117_2796363_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
WP_000566258.1\|2796366_2796816_+	DUF551 domain-containing protein	A0A0P0HSE1	Acinetobacter_phage	3.4e-83	97.2
WP_000048743.1\|2796812_2797097_+	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	2.2e-43	94.7
WP_002163156.1\|2797100_2797358_+	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	1.2e-40	88.1
WP_000362184.1\|2797359_2797575_+	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
WP_002115333.1\|2797784_2799065_+	aspartate kinase	NA	NA	NA	NA
WP_000906487.1\|2799311_2799566_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
WP_002163155.1\|2799633_2800200_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.4e-25	43.1
WP_078224857.1\|2800270_2800711_-	hypothetical protein	NA	NA	NA	NA
WP_002163173.1\|2800900_2801458_+	cytochrome b	NA	NA	NA	NA
WP_002163181.1\|2801502_2802501_-	adenosine deaminase	NA	NA	NA	NA
WP_002163170.1\|2802617_2803937_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.1e-60	36.0

DBSCAN-SWA_12

2834326 : 2895137

Faecalibacterium_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004994718.1\|2834326_2835352_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_000693745.1\|2835750_2837706_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	2.1e-129	41.1
WP_010326927.1\|2838063_2839089_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_002120570.1\|2839433_2841005_+	carboxypeptidase regulatory-like domain protein	NA	NA	NA	NA
WP_002120484.1\|2841100_2841559_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002120512.1\|2841628_2842861_-	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_170825830.1\|2843110_2843950_+	p-hydroxycinnamoyl CoA hydratase/lyase	NA	NA	NA	NA
WP_002120481.1\|2843987_2845439_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_170825831.1\|2845520_2847407_+	AMP-binding protein	NA	NA	NA	NA
WP_002120514.1\|2847480_2848620_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_002120553.1\|2848731_2849952_+	OprD family porin	NA	NA	NA	NA
WP_002120536.1\|2850009_2850546_+	DUF3237 domain-containing protein	NA	NA	NA	NA
WP_002120534.1\|2850586_2850976_+	PaaI family thioesterase	NA	NA	NA	NA
WP_002120498.1\|2851009_2852761_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_002120549.1\|2852833_2853547_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_002120529.1\|2853788_2855375_-	aldehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
WP_002120561.1\|2855405_2856317_-	5-dehydro-4-deoxyglucarate dehydratase	NA	NA	NA	NA
WP_002120503.1\|2856583_2857918_-	glucarate dehydratase	NA	NA	NA	NA
WP_002120540.1\|2858203_2859562_+	MFS transporter	NA	NA	NA	NA
WP_002120551.1\|2859632_2861180_+	galactarate dehydratase	NA	NA	NA	NA
WP_001181015.1\|2861305_2862202_+	DMT family transporter	NA	NA	NA	NA
WP_002120545.1\|2862217_2863288_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002120537.1\|2863417_2864878_+	coniferyl aldehyde dehydrogenase	NA	NA	NA	NA
WP_002120579.1\|2865032_2865653_-	hypothetical protein	NA	NA	NA	NA
WP_002120510.1\|2865776_2867183_-	amino acid permease	NA	NA	NA	NA
WP_002120521.1\|2867639_2868734_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_002120524.1\|2868730_2869966_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.9e-23	29.1
WP_002120489.1\|2870101_2870524_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_002120548.1\|2870852_2872283_+	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_002120573.1\|2872311_2873082_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_002120532.1\|2873137_2873857_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_000191916.1\|2873922_2874630_+	cache protein	NA	NA	NA	NA
WP_002120563.1\|2874816_2876148_+	APC family permease	NA	NA	NA	NA
WP_002120500.1\|2876166_2877612_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_005802857.1\|2877760_2879119_+	amino acid permease	NA	NA	NA	NA
WP_002120526.1\|2879496_2879856_+	hypothetical protein	NA	NA	NA	NA
WP_002120567.1\|2880013_2880694_-	DUF799 domain-containing protein	NA	NA	NA	NA
WP_002120559.1\|2880690_2881059_-	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_002120578.1\|2881076_2881748_-	CsgG/HfaB family protein	NA	NA	NA	NA
WP_002120495.1\|2882899_2883409_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_106389263.1\|2883414_2884209_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.4e-62	50.6
WP_079377731.1\|2884183_2884285_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002120508.1\|2884873_2885962_+	DUF898 domain-containing protein	NA	NA	NA	NA
WP_081311557.1\|2886021_2887083_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_014206119.1\|2887094_2887412_-	hypothetical protein	NA	NA	NA	NA
WP_002120519.1\|2887954_2889985_-	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_014206117.1\|2890282_2891641_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	3.5e-54	80.2
WP_004994718.1\|2892449_2893475_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_004832869.1\|2893928_2895137_-\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5

DBSCAN-SWA_13

3036999 : 3072423

Faecalibacterium_phage(50.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002117588.1\|3036999_3039066_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-18	25.7
WP_103254448.1\|3039187_3040810_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	7.1e-22	25.9
WP_014206020.1\|3041062_3041698_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_002117529.1\|3041690_3043163_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_002117700.1\|3043258_3044917_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.1e-57	31.5
WP_002117610.1\|3045427_3047068_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_031975661.1\|3047159_3047630_+	hypothetical protein	NA	NA	NA	NA
WP_002117706.1\|3047846_3048725_+	homocysteine S-methyltransferase family protein	NA	NA	NA	NA
WP_002117544.1\|3048730_3050065_+	amino acid permease	NA	NA	NA	NA
WP_078210502.1\|3050120_3051998_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002117743.1\|3052182_3052890_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_002117599.1\|3053081_3054770_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_002117504.1\|3054783_3055200_-	hypothetical protein	NA	NA	NA	NA
WP_010326927.1\|3055373_3056399_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_017399027.1\|3056491_3056935_-	hypothetical protein	NA	NA	NA	NA
WP_005070783.1\|3056943_3057849_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_032015167.1\|3057849_3060477_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.6e-252	51.9
WP_000061136.1\|3060889_3061165_+	hypothetical protein	NA	NA	NA	NA
WP_032015168.1\|3061178_3062069_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000050879.1\|3062256_3063201_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_032015169.1\|3063373_3064759_+	MFS transporter	NA	NA	NA	NA
WP_032013111.1\|3064837_3066184_+	outer membrane porin, OprD family	NA	NA	NA	NA
WP_004994718.1\|3066855_3067881_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_032013110.1\|3067910_3068195_+	hypothetical protein	NA	NA	NA	NA
WP_032013109.1\|3068467_3068953_-	hypothetical protein	NA	NA	NA	NA
WP_032015170.1\|3069026_3069275_-	hypothetical protein	NA	NA	NA	NA
WP_010326927.1\|3069331_3070357_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_025467525.1\|3070585_3071068_-	hypothetical protein	NA	NA	NA	NA
WP_004994718.1\|3071397_3072423_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4

DBSCAN-SWA_14

3407853 : 3416056

uncultured_Caudovirales_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000394712.1\|3407853_3409077_-	ImmA/IrrE family metallo-endopeptidase	A0A222YXG1	Escherichia_phage	4.1e-22	47.1
WP_000770669.1\|3409066_3409339_-	type II toxin-antitoxin system HigB family toxin	NA	NA	NA	NA
WP_000835370.1\|3409746_3410565_-	hypothetical protein	NA	NA	NA	NA
WP_002132853.1\|3410861_3411929_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	4.6e-94	59.2
WP_001191832.1\|3412033_3412987_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.2e-61	42.8
WP_001052988.1\|3413005_3413710_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-92	72.5
WP_000068658.1\|3413714_3414755_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_000670223.1\|3414762_3415236_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.6e-36	51.3
WP_000373080.1\|3415242_3415566_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.2e-21	61.0
WP_000213577.1\|3415621_3416056_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-41	62.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP026087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP026089

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection