CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP026127	Acinetobacter baumannii strain ABNIH28 plasmid pNDM-0285, complete sequence	0 crisprs	NA	0	4
NZ_CP026125	Acinetobacter baumannii strain ABNIH28 chromosome, complete genome	4 crisprs	DEDDh,RT,csa3,cas3,WYL,TnsE_C	1	11
NZ_CP026128	Acinetobacter baumannii strain ABNIH28 plasmid pABA-1fe1, complete sequence	0 crisprs	DEDDh	0	2
NZ_CP026126	Acinetobacter baumannii strain ABNIH28 plasmid pABA-6973, complete sequence	0 crisprs	NA	0	0
NZ_CP026129	Acinetobacter baumannii strain ABNIH28 plasmid pABA-2f10, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3425

Geobacillus_virus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015060710.1\|933_2451_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004999346.1\|2469_2670_+	hypothetical protein	NA	NA	NA	NA
WP_017480462.1\|2714_3425_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	6.9e-30	50.8

DBSCAN-SWA_2

7813 : 14880

Moraxella_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015060706.1\|7813_8296_+	thermonuclease family protein	A0A0R6PHV6	Moraxella_phage	3.6e-22	38.0
WP_015060705.1\|8292_10005_-	zeta toxin family protein	NA	NA	NA	NA
WP_015056389.1\|10188_10413_-	hypothetical protein	NA	NA	NA	NA
WP_004993315.1\|10564_11212_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	2.6e-15	31.4
WP_004201167.1\|11641_12007_-	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
WP_004201164.1\|12010_12823_-	subclass B1 metallo-beta-lactamase NDM-1	NA	NA	NA	NA
WP_004994718.1\|12923_13949_-\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
WP_014386410.1\|14100_14880_-	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	6.9e-31	34.7

DBSCAN-SWA_3

18446 : 24576

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017480453.1\|18446_21359_-	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	4.4e-06	23.9
WP_015060720.1\|21890_22427_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_017480467.1\|22650_22881_-	hypothetical protein	NA	NA	NA	NA
WP_015060719.1\|22867_23290_-	hypothetical protein	NA	NA	NA	NA
WP_015060718.1\|23450_23687_-	hypothetical protein	NA	NA	NA	NA
WP_015060717.1\|23748_24576_-	DUF3560 domain-containing protein	H7BV66	unidentified_phage	2.5e-15	32.8

DBSCAN-SWA_4

29801 : 30491

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005000446.1\|29801_30491_-	AAA family ATPase	W0LIU2	Mycobacterium_phage	8.0e-15	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026125_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026125_1

637872-638002

Orphan

Consensus_repeat	Method
CGGTTATCATTTTGCTGTTGTTG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP026125_1

>merge|NZ_CP026125|1|637872-638002|CRISPRCasFinder
TGGTTGTTATTTGAGTTTTGTTGGCCAGAATCTTTTTGATTAGATCCTTGTTGTTGGCCGCGGTTATCATTTTGCTGTTGTTGCTGGTTATTTTGTTGCTGTTGATTACGGTTGTCATTTTGCTGTTGTTG

>NZ_CP026125|1|1|637872-638002|CRISPRCasFinder
TGGTTGTTATTTGAGTTTTGTTG	GCCAGAATCTTTTTGATTAGATCCTTGTTGTTGGCCG
CGGTTATCATTTTGCTGTTGTTG	CTGGTTATTTTGTTGCTGTTGATTA
CGGTTGTCATTTTGCTGTTGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026125.1\|WP_000119781.1\|634038_634944_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP026125.1\|WP_086384385.1\|631358_632642_+\|DcaP-like-protein	unknown	unknown	gnl\|CDD\|371763
NZ_CP026125.1\|WP_000024203.1\|644711_645875_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP026125.1\|WP_086384414.1\|640593_642738_+\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP026125.1\|WP_000781134.1\|632688_633927_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238868
NZ_CP026125.1\|WP_000482091.1\|638334_638814_-\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP026125.1\|WP_001124835.1\|646454_647066_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP026125.1\|WP_000983632.1\|643813_644227_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_001984002.1\|634945_635236_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_001145697.1\|639129_640539_+\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP026125.1\|WP_000376213.1\|647904_648360_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP026125.1\|WP_001136759.1\|636617_637046_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000432332.1\|642793_643672_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP026125.1\|WP_000251687.1\|636204_636348_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_017898004.1\|647136_647748_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP026125.1\|WP_001029912.1\|630443_631115_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP026125.1\|WP_000498471.1\|637132_637354_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000795915.1\|645935_646172_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_001183736.1\|628678_630373_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP026125.1\|WP_000132045.1\|637438_637756_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026125.1\|WP_000119781.1\|634038_634944_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.04997e-72
NZ_CP026125.1\|WP_086384414.1\|640593_642738_+\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP026125.1\|WP_000781134.1\|632688_633927_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	1.02037e-93
NZ_CP026125.1\|WP_086384385.1\|631358_632642_+\|DcaP-like-protein	gnl\|CDD\|371763	pfam11854, MtrB_PioB, Putative outer membrane beta-barrel porin, MtrB/PioB. MtrB-PioB is a family of bacterial putative outer membrane porins. This family, is secreted as part of the pio (phototrophic iron oxidation) operon that has been found to couple the oxidation of ferrous iron [Fe(II)] to reductive CO2 fixation using light energy. PioABC is found in Rhodopseudomonas palustris and MtrB-PioB is likely to be a beta-barrel porin. Similar to other outer membrane porins, PioB and MtrB are predicted to have long loops protruding into the extracellular space and short turns on the periplasmic side.	0.000156486
NZ_CP026125.1\|WP_001124835.1\|646454_647066_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	6.13605e-39
NZ_CP026125.1\|WP_001145697.1\|639129_640539_+\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.44375e-18
NZ_CP026125.1\|WP_000376213.1\|647904_648360_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	7.21166e-40
NZ_CP026125.1\|WP_000432332.1\|642793_643672_-\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.42708e-161
NZ_CP026125.1\|WP_000482091.1\|638334_638814_-\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP026125.1\|WP_001029912.1\|630443_631115_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.203e-18
NZ_CP026125.1\|WP_001183736.1\|628678_630373_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP026125.1\|WP_000024203.1\|644711_645875_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	2.24329e-19
NZ_CP026125.1\|WP_017898004.1\|647136_647748_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.14546e-23

>NZ_CP026125.1|WP_000132045.1|637438_637756_-|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDM
>NZ_CP026125.1|WP_000498471.1|637132_637354_+|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATAPSVQFKKEVFDDPNSANQYLSHNFNMPPFF
>NZ_CP026125.1|WP_001136759.1|636617_637046_+|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP026125.1|WP_000251687.1|636204_636348_+|hypothetical-protein
MVRIVCAVSMVLAIAMGMSACQDRNSKNDGMHEASDPATSHDMNKNS
>NZ_CP026125.1|WP_001984002.1|634945_635236_-|hypothetical-protein
MFFLYRFVLVSLLTIGVLNLMGCRPMSKNEFNTRCVWAGHDLSACNCIYNSLEQHYSPQFVESLPKLSLQNIDAKMNFVETMNQTMQQCQLSASKH
>NZ_CP026125.1|WP_000119781.1|634038_634944_+|LysR-family-transcriptional-regulator
MSYFDINRSGELAIFIRVVELGSFSAVARACNMTPSAVSKLISRLEKRLGVRLLNRSTRQFQLTSEGCQFYEQGIQILNDLDELEQSVTANHIPKGRIRIHTSFSYWIHFLLPCISLFNQRYPEIELEAHLSDEVINLVEQRIDVAIRTGPLKSSNLVARSLGSTHKVYVCSSAYIEQHGCPEHPDELHEHQLLDVSYKRQNKTWLFKKATQEISLNPSKVLKVNHGEAILQLALAGAGIAQLNEFQIRNALQQKQLVKILEDWNIHASEEFHAVWIGHDKYVPNRVRKFLDFLVEHASIN
>NZ_CP026125.1|WP_000781134.1|632688_633927_-|SGNH/GDSL-hydrolase-family-protein
MKLYQATLFSLVLITSFAQADVENSQWITTWSASPQKVWNKDFVFPTLIPEQVSNQTIRQMSKISLGGEAVRLVFTNQYGKQPLYIDQTTIGLANAVTLKSKSTYPVYFSGQLKARILPGKQLISDPIQLPVPDHAQLVVNSFIQKPTTFKTFHWDAKQTSWLIRGNQTTNLTTPIDAKTTTARLLLSAIEVKPKQKAHVVAVVGDSITDGATATLDANSRWTDFLAKRLSAHHVAVINSGISGNRLLTDGMGDSVLKRLNSEIFQYSGVKTLIVLVGINDISWPGTAFAPKQQIPSFEALTQGYQRVVSEAHKHNIQVIGATLLPFSGALPNTPLDNYYQPNKDQLRQRINHWMRTSHTFDGVLDLDEGLKDPKHPNRLNPIYDSGDHLHPNDRGNQHMAELVDLDQIIKN
>NZ_CP026125.1|WP_086384385.1|631358_632642_+|DcaP-like-protein
MKILNTTVQKSLLAVSVTLLMSSAFADQVNPEIEQLRQEIKELRAMLQINMEAQKSLAQKRVEQAAPVVTQAPQPIQQTLTKSGAEFNLYGYIRADASYQIKGASTMYNNISGVPLENTPEESAQKDQLHSTVYVTRFGLNFKTPTAVGDVGGKLEMDFFGAATRDQFRIRHAYLTFDKWLIGQTWSTFIAPEYYPETIDAGTFVGSALLRSPLVRYSDNLTANTSFAVSVEDPKYTAATDPDNKMRLPALVGRLNHKFANGSMLSGRSFVAEKRTNNDSEWAWGVGLGGKYQITPDTLLKADYYHVKGDGRFLLWSNSGYAIDDQNNMHSNEFDTVSLGITHQFTPQIRSTLGYGYMKAKDDNRFAELQRTSTTQNKQLWQGWVNALYNPYKPITLGIEYVYGERETFDNRNGIDNRFNMIASYDF
>NZ_CP026125.1|WP_001029912.1|630443_631115_+|class-I-SAM-dependent-methyltransferase
MAKDFNSPKVVEGYDVHIRKLIPGYEVIHQQVDAILQSVLPPDAHILIVGCGTGYELDYLLKRHPNWQFTAVDPSLTMLQKAQEQVEILGKSTQVTFVHGETSALPLESCFDAALSILVAHFIADDIKPAFFKDIYKRLKEKAPLLTYDLMTCVNPQQLQALRYLCLAQGLTEEQCQKMLERMAEDFFSLTTEGYIKLLEETGFDSVQPYTQILTYQGFIAKK
>NZ_CP026125.1|WP_001183736.1|628678_630373_+|AMP-binding-protein
MQQERLSYASGPSTQPLLGMTIGEQFDQACQQYAEKEAIVSFHQNRRLTYKALQDEVNAFACSLLKLGLKKGDRLAIWSPNCVEWTITQFAAFKAGIILVNLNTAYKSHELEYVLNKVSCKGLIIASQFKTTDYQELLTKIAPELTTCTDKVLSSERLPHLKFVIKIDDQQHTGIYRFSDLLTTPTSEQLEQLKQLARQLQFDETINIQFTSGTTGNPKGTMLTHHNILNNGYFVGEGIRLTLQDKVCISVPLFHCFGMVMGNLACVTHGSTMVYPSAVFNPLETLKAIHQERCTAAYGVPTMFIATLEHEQFNDFDLSSLRTGIMAGSPCPREIMQRVIDRMHMSEITICYGMTETSPVSVQSSVNDSIDKRVSTVGHVHPHVEIKIVDLEGQIVPQGTLGELCVRGYSVMAGYWGEEEKTREVIDAAGWMHTGDIAEMDQDGFIKIKGRIKDVVIRGGENLFPKEIEDFLYTHPDVSDVQVIGLPDAKYGEELCACIILHEHHQVDEDSIRQFCKEHISHNKVPRYVRFFNEFPMTASGKAQKFKLQEIMRAELNLTGNVFD
>NZ_CP026125.1|WP_000482091.1|638334_638814_-|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP026125.1|WP_001145697.1|639129_640539_+|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKERKARDFLVKEIDKLEMKEIDFPSDINSIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNKYRDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTEHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSNFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSSDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP026125.1|WP_086384414.1|640593_642738_+|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEHGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFFDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKYIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP026125.1|WP_000432332.1|642793_643672_-|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPYQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLEEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFAMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP026125.1|WP_000983632.1|643813_644227_-|hypothetical-protein
MMQPTHTHSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKLLDNIVVKNNKNKDDLKNIVEAETVIKEILNLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP026125.1|WP_000024203.1|644711_645875_+|hypothetical-protein
MANTRYEDDNNSSGTSNRGFASMDPERVREIASKGGRAAHASGNAHEFTSEEAREAGRAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRDDDDEDDDRGRSGGRGRSRSRRDDDDEDDDRGRSGGRSRGRSRDDDDEDDDRGRSGGRGRGRSRRDEDDEDDDRGRSGGRGRGRSRRDEDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSSGRGRGRSRRDDDDDDDDRRGRSDGRGQNSRNQKRDAYGRFTS
>NZ_CP026125.1|WP_000795915.1|645935_646172_-|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP026125.1|WP_001124835.1|646454_647066_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTDHQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFQPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP026125.1|WP_017898004.1|647136_647748_-|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLLTPPTPNQSGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIRQI
>NZ_CP026125.1|WP_000376213.1|647904_648360_+|Lrp/AsnC-family-transcriptional-regulator
MDRTDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNLVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVAKDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026125_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026125_2

644859-644944

Orphan

Consensus_repeat	Method
TCAGAAGAAGCTCGTGAAGCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026125_2

>merge|NZ_CP026125|2|644859-644944|CRISPRCasFinder
TCAGAAGAAGCTCGTGAAGCTGGCCGTGCTGCACATGCCAGTGGTAACGCACATGAATTTACCTCAGAAGAGGCTCGTGAAGCTGG

>NZ_CP026125|2|2|644859-644944|CRISPRCasFinder
TCAGAAGAAGCTCGTGAAGCTGG	CCGTGCTGCACATGCCAGTGGTAACGCACATGAATTTACC
TCAGAAGAGGCTCGTGAAGCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026125.1\|WP_000795915.1\|645935_646172_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_086384414.1\|640593_642738_+\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP026125.1\|WP_000482091.1\|638334_638814_-\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP026125.1\|WP_001124835.1\|646454_647066_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP026125.1\|WP_000983632.1\|643813_644227_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000937468.1\|655386_656022_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP026125.1\|WP_002033208.1\|650229_653694_+\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP026125.1\|WP_000108366.1\|637861_638050_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP026125.1\|WP_001136759.1\|636617_637046_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000432332.1\|642793_643672_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP026125.1\|WP_000251687.1\|636204_636348_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_017898004.1\|647136_647748_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP026125.1\|WP_086384426.1\|648417_650064_-\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374
NZ_CP026125.1\|WP_086267267.1\|655184_655298_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_001025680.1\|654793_655078_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642
NZ_CP026125.1\|WP_000498471.1\|637132_637354_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000107135.1\|653690_654650_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381147
NZ_CP026125.1\|WP_001145697.1\|639129_640539_+\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP026125.1\|WP_000376213.1\|647904_648360_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP026125.1\|WP_000132045.1\|637438_637756_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026125.1\|WP_001124835.1\|646454_647066_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	6.13605e-39
NZ_CP026125.1\|WP_086384414.1\|640593_642738_+\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP026125.1\|WP_000482091.1\|638334_638814_-\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP026125.1\|WP_002033208.1\|650229_653694_+\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	7.45629e-59
NZ_CP026125.1\|WP_000108366.1\|637861_638050_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	1.9596e-05
NZ_CP026125.1\|WP_000432332.1\|642793_643672_-\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.42708e-161
NZ_CP026125.1\|WP_086384426.1\|648417_650064_-\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	6.18919e-23
NZ_CP026125.1\|WP_000937468.1\|655386_656022_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.89841e-64
NZ_CP026125.1\|WP_001025680.1\|654793_655078_+\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	1.0722e-24
NZ_CP026125.1\|WP_000107135.1\|653690_654650_+\|response-regulator-transcription-factor	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	5.42907e-55
NZ_CP026125.1\|WP_001145697.1\|639129_640539_+\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.44375e-18
NZ_CP026125.1\|WP_000376213.1\|647904_648360_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	7.21166e-40
NZ_CP026125.1\|WP_017898004.1\|647136_647748_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.14546e-23

>NZ_CP026125.1|WP_000983632.1|643813_644227_-|hypothetical-protein
MMQPTHTHSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKLLDNIVVKNNKNKDDLKNIVEAETVIKEILNLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP026125.1|WP_000432332.1|642793_643672_-|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPYQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLEEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFAMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP026125.1|WP_086384414.1|640593_642738_+|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEHGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFFDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKYIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP026125.1|WP_001145697.1|639129_640539_+|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKERKARDFLVKEIDKLEMKEIDFPSDINSIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNKYRDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTEHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSNFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSSDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP026125.1|WP_000482091.1|638334_638814_-|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP026125.1|WP_000108366.1|637861_638050_-|hypothetical-protein
MSTTNNQANQRNNQQQQQQQNDNRNQQQQNNQQQQQNDNRGQQQGSNQKDSGQQNSNNNQQR
>NZ_CP026125.1|WP_000132045.1|637438_637756_-|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDM
>NZ_CP026125.1|WP_000498471.1|637132_637354_+|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATAPSVQFKKEVFDDPNSANQYLSHNFNMPPFF
>NZ_CP026125.1|WP_001136759.1|636617_637046_+|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP026125.1|WP_000251687.1|636204_636348_+|hypothetical-protein
MVRIVCAVSMVLAIAMGMSACQDRNSKNDGMHEASDPATSHDMNKNS
>NZ_CP026125.1|WP_000795915.1|645935_646172_-|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP026125.1|WP_001124835.1|646454_647066_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTDHQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFQPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP026125.1|WP_017898004.1|647136_647748_-|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLLTPPTPNQSGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIRQI
>NZ_CP026125.1|WP_000376213.1|647904_648360_+|Lrp/AsnC-family-transcriptional-regulator
MDRTDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNLVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVAKDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG
>NZ_CP026125.1|WP_086384426.1|648417_650064_-|allantoin-permease
MTKNDWEIDVMSVSEHPNLDTVQGTDSQKAVNETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGASIGMSYGTTNAVFSILFAAIIIFLTGIPLAYYAARYNIDLDLITRGAGFGYIGSVLTSIIFASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLISTVMVIPLVIYGMKALSKLQVWTTPLWLVLMIGPVAYLIYQEPTLVSQFATFTGHEGFAPVDMAAIMLGAGICLSLIMQIGEQIDYLRFMPAKTKENSKAWWAAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPGVNSTEPVQQFNAAFHDMLPGWAALTLAVILVVISQIKINVTNAYSGSLAWTSAYTRISKHYPGRIVFVMVNLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDISINKYVLKLSPKEPEYRRDMLYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPIIALVLAFVLTPIMGLLTKGKYYIKSHDDGVKEPRYDAEGTPVATVYHCRVCEQGYERPDIMFSHKHNGTICSLCKTLDA
>NZ_CP026125.1|WP_002033208.1|650229_653694_+|response-regulator
MSVMPDSSRPQQAPQRVIKTRREYNIWVADESIEDYALRYAPTSVRKWSPWTVTNTAISTVSFLAMEAIGATMLWQYGFSNAVWAAIVVCTIIFLTSWPISYYAAKYNVDVDLLTRGAGFGYIGSTITSLIYASFTFILLAFEAAIMAMALELALGIPQVIGYLISALVILPLVVKGIGFINKVQAITQPIWLLLLLLPWFFVLWKQPQILSSSLHFVGAVSNSTDFNLYYFGAACTLIFSFVIQIGEQADYLRFLPQKEKNRTAWRFAVFLGGPSWIIFGFLKVLMGMLLMVLAFQLFIPVSELDNPTYLYWVAYQQFIPNPQLALILTLALVCLAQIKINMTNAYAGSLAWSNFFARLTHSHPGRIVWLLFNVFIAIVLMEMGISHAVERILGLYSNIALAWIGAVVADLIICKPLGLSPKGIEFRRAYLYDINPVGVGALLIASVLSMLSYLGFFGLMAKGLASFIALGSAVLCVPIIAYLTKGKYYIARQPEKIQATSVANCVVCERDYELADMAGCPAYNGTICSLCCSLEARCHDLCKPDARWSVQLKKAIWHYLPERWASRLNSRVSLYLLLTLGLSIVLAVSLSLVYIQEKTYLETINAAAVPQLFTLFVKIYTILFLLMSVAAWWLVLNDESRRNAEIETHQQTALLIDEIAAHEVTSKDLQDARIAAERANDAKSRYVIGISHELRTPLNSILGYSQLLQKQEQLSEQGKMALGVISRSGQHLTSLIDGLLDLARIETGKISLNVVDVHFPNFIEQIIQMFQPQFEQKNLQFVYEIGENLPHYIRTDKKRLEQVLINLLGNALKFTTSGTITLKVEYRFQTAYFEIRDTGCGIAEADLERIFNPFERGSNVVQGGFTGTGLGLPIVKLLVDLLGGQLSVTSQLNQGSQFKIKFYLPSKEVVHPISNVYSNQITGYQGERKRILVVDNEAVDRGLVANFLKPLGFMIEEAESGIDCLRRVPIFQPNLILMDLNMPLMGGWETARLLRQNNITNVPILIISANAGEREVNPQDAVLSEDFMLKPIDLNLLLSKIGDKLGLVWIDSKSDALLENNEVQALDVKVFKQEQPTVHTSITQPENNDLLDLPQSLQHLNDLIGQGYIRGIQQTLMQCRQNFPEHDELWEQLEQAIQKFDLKHAQRLIQDKS
>NZ_CP026125.1|WP_000107135.1|653690_654650_+|response-regulator-transcription-factor
MSTQHVSFQQASPNEQAVILIVDDVPENLGLLHESLDQAGYRVLVTTDGLSAIEIAHRCLPDMILLDGNMPHMDGFESCIQLKASPITQFIPVIFMTGLSETEHIVRGFQVGGVDYVTKPLNIEEVLARVKTHLAHAKLLQQQKQVIDATETAILALDVHGKIVWKTQKASDLLNQYLPELEGFEAGLKAWFSDLEHEKDSKKLTSCSYSTPSQQLQLLLLTPWETEPSVAKNYLIQIKTTTPALEMADILKYCPQLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAHINSLVQEFH
>NZ_CP026125.1|WP_001025680.1|654793_655078_+|N-acetyltransferase
MNIQQKDDTKHGSFSLLDGETVAGEMTYTWAGESMLIIDATDVNENYRGQGVGRQLLDALVAFVREKDVKVIPLCPYAKSVFDKDPSIGDVLRK
>NZ_CP026125.1|WP_086267267.1|655184_655298_-|hypothetical-protein
MCKEFIFFPIGLKLFLLDKLFYKFDKFDLAIEKLQIS
>NZ_CP026125.1|WP_000937468.1|655386_656022_+|amino-acid-ABC-transporter-permease
MLPQFFSATLTTLKISIISIILAIIVGLICSILITYRVRVLNRIAQFYIELSRNTPLLIQLFFLYYGLPKLGIKIDGFTCGVIGLTFLGGSYMAEAFRAGLQSVAKGQIDSAKSIGLQPTQIFRYVIFPQALAISIPAIGANCLFLIKESSVVSAIAVVELLFVTKDLIGMDYKTTEALFLLIMAYLIILLPVSILTSYLEHRSRKVSHGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026125_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026125_3

976469-976580

Orphan

Consensus_repeat	Method
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026125_3

>merge|NZ_CP026125|3|976469-976580|CRISPRCasFinder
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGAGCTGTGCTCGAGTGGAAGAGGATAAACAAAGCAACGCTTTGCCGTGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA

>NZ_CP026125|3|3|976469-976580|CRISPRCasFinder
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA	GCTGTGCTCGAGTGGAAGAGGATAAACAAAGCAACGCTTTGCCG
TGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026125.1\|WP_017725771.1\|985297_986230_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP026125.1\|WP_000642315.1\|970479_971538_+\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
NZ_CP026125.1\|WP_001023748.1\|978580_979498_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP026125.1\|WP_000238437.1\|969664_970450_+\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
NZ_CP026125.1\|WP_001186386.1\|981698_983048_-\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP026125.1\|WP_001177517.1\|964700_965663_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_CP026125.1\|WP_000331400.1\|979664_980519_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP026125.1\|WP_001133053.1\|965676_966696_+\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP026125.1\|WP_001287537.1\|968234_969638_+\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP026125.1\|WP_001983845.1\|980515_980911_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP026125.1\|WP_001289743.1\|966697_968224_+\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP026125.1\|WP_000080816.1\|983289_984033_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP026125.1\|WP_031985033.1\|972566_973838_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP026125.1\|WP_000771649.1\|981006_981615_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP026125.1\|WP_000421181.1\|974734_976390_+\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|350353
NZ_CP026125.1\|WP_000925647.1\|976643_977435_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP026125.1\|WP_000822380.1\|977543_978548_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|168683
NZ_CP026125.1\|WP_079281543.1\|986237_987686_-\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
NZ_CP026125.1\|WP_000465436.1\|974029_974725_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP026125.1\|WP_000637003.1\|971585_972497_-\|bestrophin	unknown	unknown	gnl\|CDD\|376448

Protein	Function_ID	Function_description	E-value
NZ_CP026125.1\|WP_017725771.1\|985297_986230_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	2.14462e-50
NZ_CP026125.1\|WP_000642315.1\|970479_971538_+\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
NZ_CP026125.1\|WP_001023748.1\|978580_979498_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.91074e-15
NZ_CP026125.1\|WP_000238437.1\|969664_970450_+\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.17932e-115
NZ_CP026125.1\|WP_001186386.1\|981698_983048_-\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	2.04051e-60
NZ_CP026125.1\|WP_001177517.1\|964700_965663_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
NZ_CP026125.1\|WP_000331400.1\|979664_980519_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
NZ_CP026125.1\|WP_001133053.1\|965676_966696_+\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	3.26675e-168
NZ_CP026125.1\|WP_001287537.1\|968234_969638_+\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP026125.1\|WP_001983845.1\|980515_980911_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
NZ_CP026125.1\|WP_001289743.1\|966697_968224_+\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	5.34065e-113
NZ_CP026125.1\|WP_000080816.1\|983289_984033_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.95412e-75
NZ_CP026125.1\|WP_031985033.1\|972566_973838_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	8.09636e-122
NZ_CP026125.1\|WP_000771649.1\|981006_981615_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	5.30462e-86
NZ_CP026125.1\|WP_000421181.1\|974734_976390_+\|TIGR01244-family-phosphatase	gnl\|CDD\|350353	cd14503, PTP-bact, bacterial tyrosine-protein phosphataseS similar to Neisseria NMA1982. This subfamily is composed of bacterial tyrosine-protein phosphatases similar to Neisseria meningitidis NMA1982, which displays phosphatase activity but whose biological function is still unknown.	1.86933e-37
NZ_CP026125.1\|WP_000925647.1\|976643_977435_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.21456e-23
NZ_CP026125.1\|WP_000822380.1\|977543_978548_+\|hypothetical-protein	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	9.58995e-79
NZ_CP026125.1\|WP_079281543.1\|986237_987686_-\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
NZ_CP026125.1\|WP_000465436.1\|974029_974725_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	5.85405e-90
NZ_CP026125.1\|WP_000637003.1\|971585_972497_-\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	8.96989e-82

>NZ_CP026125.1|WP_000421181.1|974734_976390_+|TIGR01244-family-phosphatase
MELKRVNQDFYVAGQITANDIVKIADQGIKTLICNRPDGEGADQPNVIEIEEAAQRHGLNVIYQPVISGKVTDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPSDAALLVESGNKLGFNLKGLVPRILKRDHEPATIPCYSVVIVGAGAAGISVASSLLCREPHLDIVIIDPADTHYYQPGWTMVGGGIFKPQVTARSMASVIPSKVKWMKAAVAGFDPEHNQVILEGCQPIQYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNGGKAIFTQPPMPIKCAGAPQKAMYLSADYWLKQGKLKDISIHFYNTGAVLFGVKEYVPALMQYVEKYGSELHFNHQLVKVDGPAKKAWFKVVNDENAALVETDFDMLHVVPPQQAPDFIRASTLTDEAGWVSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARAQAPIVAVNVLAQLNGEQNFCEYNGYGSCPLTVERGKIVLAEFGYGGKLLPSFPKWIIDGQKPSRLAWLLKEQILPPIYWQGMLKGREWMVKPERG
>NZ_CP026125.1|WP_000465436.1|974029_974725_+|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETREAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAANLLRERFHCKSVLHRNSEVSCGDILITDGCMIKVGNLSIEARYTPGHTNACTSYLVGNMIFTGDALLIDGCGRTDFQQGNAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSSTIGYERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>NZ_CP026125.1|WP_031985033.1|972566_973838_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFESEQDFFILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENMAALTQDHHNQYLEVNTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIVDEVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAWRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEIEDLPNELLNAEDYVKLPETNAELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>NZ_CP026125.1|WP_000637003.1|971585_972497_-|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEQREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYGTLTRHIVELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>NZ_CP026125.1|WP_000642315.1|970479_971538_+|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGEGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>NZ_CP026125.1|WP_000238437.1|969664_970450_+|acetoin-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>NZ_CP026125.1|WP_001287537.1|968234_969638_+|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFSGRAQLTAKEKIEVTDAQGNSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVKNVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDTSGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>NZ_CP026125.1|WP_001289743.1|966697_968224_+|2-oxo-acid-dehydrogenase-subunit-E2
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIERFIASLGGSAAQAPSEQSKAETSAPVAEKAEQPQTVAVSASAPVKVAKDDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTPVNEQPLQCATQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEDLQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>NZ_CP026125.1|WP_001133053.1|965676_966696_+|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENQLEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>NZ_CP026125.1|WP_001177517.1|964700_965663_+|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>NZ_CP026125.1|WP_000925647.1|976643_977435_+|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYIVIKIVNLTNI
>NZ_CP026125.1|WP_000822380.1|977543_978548_+|hypothetical-protein
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTKYQVGLTEQKFLEQVQAEVIIETGPSDYMTGGKGLFYLNYALTHSMNAIAVSKGALVVDGKKLINLAHQQNKKLFFSGATAAALPTVDLFEYNLAGCQILEVEGVFTGTTNFILNDMLQHECAFTESLEKAQAKGIAEPDSSFDVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTTEHIRDWKKENVIPRLVGFIHIKNLQIQTGVELRLVPANHPFAHLQGSNKCIRVLTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>NZ_CP026125.1|WP_001023748.1|978580_979498_-|DMT-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCVIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKNCEKQA
>NZ_CP026125.1|WP_000331400.1|979664_980519_+|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>NZ_CP026125.1|WP_001983845.1|980515_980911_-|helix-turn-helix-transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>NZ_CP026125.1|WP_000771649.1|981006_981615_+|NAD(P)H-dependent-oxidoreductase
MKLLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNETAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>NZ_CP026125.1|WP_001186386.1|981698_983048_-|chromate-efflux-transporter
MQQKQLNTPDDSVEQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWVVAIAAFFAIFVLKLPFPLIVLSAGIAGYLTSKKYPELFSSAAGHKASQKDYGPAYIDDDTPTPEHAKFHWSRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFIFIFAGAPIIESTHNEIKFTAPLTAITSAVVGVILNLALFFSYHVLWPQGFSGHFDIVAALITVAAFIALFRFNINVLYVIFASALVGLAVTFF
>NZ_CP026125.1|WP_000080816.1|983289_984033_+|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQIPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLPEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>NZ_CP026125.1|WP_017725771.1|985297_986230_-|IS5-family-transposase
MNKPASKIYRTTNWSSYNRALINRGNISIWLDPKTQWYAQSQGKQGRNQTYSDTAIQCCLMIKLLFRLSLRMVTGFVQSLIKLSGLDWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLVDSTGLKFLGEGEWKRKKHGAEYRRQWRKLHIAIDAKTLQIRAVQLTTNNVSDSQVIEDLLAQIPLDEPIDSVYTDGAYDTKHCRQVILDRDAHAIIPPRKNAKPWKDQQARSIERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIKLLGDKLTARSFPSQVNEIHARMAVLNKFTELGRPHTQVVS
>NZ_CP026125.1|WP_079281543.1|986237_987686_-|aspartate-ammonia-lyase
MMNADITTRIEKDLIGHREINNDHYYGVQTLRALENFNLTNSKVGNFPNLIKALAMVKLACAEANYNLKNLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHSKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFLNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALGKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQTKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQVLDDILSINNMVKRLCCTNLASKAYSAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026125_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026125_4

1256917-1257058

Orphan

Consensus_repeat	Method
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026125_4

>merge|NZ_CP026125|4|1256917-1257058|CRISPRCasFinder
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACTATGTTCATCTTGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACT

>NZ_CP026125|4|4|1256917-1257058|CRISPRCasFinder
TTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAACT	ATGTTCATCTTGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGT
TTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026125.1\|WP_001187345.1\|1254445_1255552_-\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP026125.1\|WP_000102943.1\|1253660_1254257_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP026125.1\|WP_000575149.1\|1250593_1251739_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
NZ_CP026125.1\|WP_017897636.1\|1258327_1259536_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056
NZ_CP026125.1\|WP_000954518.1\|1260718_1261621_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
NZ_CP026125.1\|WP_001202776.1\|1261672_1262467_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP026125.1\|WP_001186685.1\|1262819_1264121_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331
NZ_CP026125.1\|WP_077163451.1\|1257371_1257704_+\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
NZ_CP026125.1\|WP_000270276.1\|1251752_1251854_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
NZ_CP026125.1\|WP_017897428.1\|1252763_1253435_-\|DUF2057-domain-containing-protein	unknown	unknown	gnl\|CDD\|378258
NZ_CP026125.1\|WP_085916945.1\|1251854_1252154_+\|cyd-operon-YbgE-family-protein	unknown	unknown	gnl\|CDD\|370577
NZ_CP026125.1\|WP_000838063.1\|1264312_1264732_+\|heme-binding-protein	unknown	unknown	gnl\|CDD\|225734
NZ_CP026125.1\|WP_000138830.1\|1259763_1260105_+\|Grx4-family-monothiol-glutaredoxin	unknown	unknown	gnl\|CDD\|188046
NZ_CP026125.1\|WP_000121844.1\|1260151_1260475_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000949688.1\|1264991_1265237_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000955083.1\|1255659_1255986_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_017897429.1\|1252166_1252691_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP026125.1\|WP_000616034.1\|1256661_1256895_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000185571.1\|1256086_1256446_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026125.1\|WP_000156920.1\|1257844_1258276_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391

Protein	Function_ID	Function_description	E-value
NZ_CP026125.1\|WP_001187345.1\|1254445_1255552_-\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	4.65167e-180
NZ_CP026125.1\|WP_000102943.1\|1253660_1254257_-\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
NZ_CP026125.1\|WP_017897429.1\|1252166_1252691_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.5551e-05
NZ_CP026125.1\|WP_001202776.1\|1261672_1262467_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	7.03372e-151
NZ_CP026125.1\|WP_001186685.1\|1262819_1264121_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	7.47656e-171
NZ_CP026125.1\|WP_017897636.1\|1258327_1259536_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0
NZ_CP026125.1\|WP_000270276.1\|1251752_1251854_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06
NZ_CP026125.1\|WP_000954518.1\|1260718_1261621_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.95489e-97
NZ_CP026125.1\|WP_085916945.1\|1251854_1252154_+\|cyd-operon-YbgE-family-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
NZ_CP026125.1\|WP_000838063.1\|1264312_1264732_+\|heme-binding-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	5.66012e-31
NZ_CP026125.1\|WP_000138830.1\|1259763_1260105_+\|Grx4-family-monothiol-glutaredoxin	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
NZ_CP026125.1\|WP_077163451.1\|1257371_1257704_+\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	1.42209e-20
NZ_CP026125.1\|WP_000575149.1\|1250593_1251739_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	5.17683e-149
NZ_CP026125.1\|WP_017897428.1\|1252763_1253435_-\|DUF2057-domain-containing-protein	gnl\|CDD\|378258	pfam09829, DUF2057, Uncharacterized protein conserved in bacteria (DUF2057). This domain, found in various prokaryotic proteins, has no known function.	7.85362e-29
NZ_CP026125.1\|WP_000156920.1\|1257844_1258276_+\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56

>NZ_CP026125.1|WP_000616034.1|1256661_1256895_+|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>NZ_CP026125.1|WP_000185571.1|1256086_1256446_-|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>NZ_CP026125.1|WP_000955083.1|1255659_1255986_-|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLRPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHNHIKQYPALAQEDTQ
>NZ_CP026125.1|WP_001187345.1|1254445_1255552_-|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEASPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETEK
>NZ_CP026125.1|WP_000102943.1|1253660_1254257_-|nitroreductase-family-protein
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>NZ_CP026125.1|WP_017897428.1|1252763_1253435_-|DUF2057-domain-containing-protein
MTLRLSVAAMGLLLSGSVFSAVTITVPEEIVILAVNGQEVNSGLFRSSKNNYKVDAGETSLSVRYQEYFEHLSGEHDIVKSGVVTIQTPALKDGQTYKLAMVDAPKQFEQAKKYAEQPTVALYNSNNELIVQQTGANNEARPWFASGLLGKVTDFTTKSSKQQPDAVYAAAKPTTTQANAPVATTMPATGVAQTNDQRLAEIWKKSSKAERQKFMAWLAEQSN
>NZ_CP026125.1|WP_017897429.1|1252166_1252691_-|GNAT-family-N-acetyltransferase
MIKLNFRLAEFSDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRSVLEYAEQFALYKLPELDSAIMYVLNVRSELIAYYERRGYIKTGNHEPYPLDANVGLPLIPIKLIEMKKDLK
>NZ_CP026125.1|WP_085916945.1|1251854_1252154_+|cyd-operon-YbgE-family-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>NZ_CP026125.1|WP_000270276.1|1251752_1251854_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>NZ_CP026125.1|WP_000575149.1|1250593_1251739_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYSVAFSGMYWALLLVLFALFLRPVGFDYRSKLENAQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFLALLNPFALVCGIVSLSMLCAHGGAWLMLRTDGDLKQRSAKATQIMAAIFLVCFLVIGVWLYFGQVPGYSYAAAVDSNAALNPLAKEVVTNNNPGWMNNYSSYPITKVAPVLAILGAIIAFFTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>NZ_CP026125.1|WP_077163451.1|1257371_1257704_+|DUF2750-domain-containing-protein
MIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>NZ_CP026125.1|WP_000156920.1|1257844_1258276_+|CBS-domain-containing-protein
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>NZ_CP026125.1|WP_017897636.1|1258327_1259536_-|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYTQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTQQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEGFVRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQICNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENSAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGIQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>NZ_CP026125.1|WP_000138830.1|1259763_1260105_+|Grx4-family-monothiol-glutaredoxin
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>NZ_CP026125.1|WP_000121844.1|1260151_1260475_-|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEEVMNQNVDELHEDPNINIFDAITTTPYKNLTILKADLGVDGLFRYVGISDC
>NZ_CP026125.1|WP_000954518.1|1260718_1261621_+|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVCLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>NZ_CP026125.1|WP_001202776.1|1261672_1262467_-|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHAVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>NZ_CP026125.1|WP_001186685.1|1262819_1264121_+|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFMTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPAPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACMVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>NZ_CP026125.1|WP_000838063.1|1264312_1264732_+|heme-binding-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQSS
>NZ_CP026125.1|WP_000949688.1|1264991_1265237_+|hypothetical-protein
MLSLHFNKQVFINTLNSKDSVVYGVTTLALMLTLLFQGMIKGNLKPEYFMYAMVVSFVFCVWAFVDHKMRKLAKRRLSQQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	AP013861	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15H-MedDCM-OCT-S40-C106, * SEQUENCING IN PROGRESS *	15391-15415	3	0.88
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	NC_010630	Nostoc punctiforme PCC 73102 plasmid pNPUN03, complete sequence	18448-18472	3	0.88
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	MN856032	Bacteriophage sp. isolate 242, complete genome	4970-4994	4	0.84
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	NC_015937	Thermus phage TMA, complete genome	130919-130943	4	0.84
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	MN693192	Marine virus AFVG_25M42, complete genome	30603-30627	4	0.84
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	GU071095	Synechococcus phage S-SM2, complete genome	177140-177164	4	0.84
NZ_CP026125_1	1.2\|637955\|25\|NZ_CP026125\|CRISPRCasFinder	637955-637979	25	AP011617	Thermus phage TMA DNA, complete genome	130919-130943	4	0.84

1. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to AP013861 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15H-MedDCM-OCT-S40-C106, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.88

ctggttattttgttgctgttgatta	CRISPR spacer
ctggtaattttgttactgttgattt	Protospacer
***** ********.*********

2. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to NC_010630 (Nostoc punctiforme PCC 73102 plasmid pNPUN03, complete sequence) position: , mismatch: 3, identity: 0.88

ctggttattttgttgctgttgatta	CRISPR spacer
caggctattttgttgctgctgatta	Protospacer
* **.*************.******

3. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to MN856032 (Bacteriophage sp. isolate 242, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
tggtttattttgttgctgttgaata	Protospacer
. * ****************** **

4. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to NC_015937 (Thermus phage TMA, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caaattattttgttgcttttgatta	Protospacer
* ..************* *******

5. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to MN693192 (Marine virus AFVG_25M42, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
gtggttcttttgttgcttttgattc	Protospacer
 ***** ********** ******

6. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to GU071095 (Synechococcus phage S-SM2, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caccttattttgttgctattgatta	Protospacer
*   *************.*******

7. spacer 1.2|637955|25|NZ_CP026125|CRISPRCasFinder matches to AP011617 (Thermus phage TMA DNA, complete genome) position: , mismatch: 4, identity: 0.84

ctggttattttgttgctgttgatta	CRISPR spacer
caaattattttgttgcttttgatta	Protospacer
* ..************* *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

53144 : 63289

Acinetobacter_phage(57.14%)

integrase

attL 50960:50974|attR 64940:64954

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
50960:50974	attL	NA	NA	NA	NA
WP_000947475.1\|53144_54302_+\|integrase	site-specific integrase	A0A2H4J339	uncultured_Caudovirales_phage	4.9e-134	63.0
WP_001076477.1\|54298_55183_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_000549863.1\|55173_55629_+	hypothetical protein	NA	NA	NA	NA
WP_000527288.1\|55743_56736_+	FRG domain-containing protein	NA	NA	NA	NA
WP_168732385.1\|56742_56913_-	hypothetical protein	A0A2H4JBW6	uncultured_Caudovirales_phage	2.4e-13	69.2
WP_001292077.1\|56913_57129_-	hypothetical protein	I2GUB6	Acinetobacter_phage	8.5e-32	92.9
WP_046660032.1\|57125_57482_-	hypothetical protein	J7HXR6	Acinetobacter_phage	3.6e-27	55.4
WP_000978815.1\|57478_57772_-	hypothetical protein	NA	NA	NA	NA
WP_046660034.1\|57910_58939_-	ead/Ea22-like family protein	A0A2I7QY11	Vibrio_phage	3.8e-13	29.0
WP_023060560.1\|58951_59632_-	DNA polymerase III subunit epsilon	NA	NA	NA	NA
WP_001260065.1\|59802_60174_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.4e-10	40.6
WP_001072368.1\|60170_60500_-	hypothetical protein	NA	NA	NA	NA
WP_000350171.1\|60558_60819_-	hypothetical protein	NA	NA	NA	NA
WP_103270742.1\|60904_61708_-	DUF2303 family protein	NA	NA	NA	NA
WP_000105905.1\|61748_62081_-	hypothetical protein	NA	NA	NA	NA
WP_000440996.1\|62292_62580_-	hypothetical protein	NA	NA	NA	NA
WP_000660939.1\|62590_63289_-	LexA family transcriptional regulator	A0A0P0IYD9	Acinetobacter_phage	7.8e-26	35.8
64940:64954	attR	NA	NA	NA	NA

DBSCAN-SWA_2

89879 : 150067

Escherichia_phage(21.05%)

transposase,terminase,tail,integrase

attL 118659:118677|attR 143710:143728

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103270747.1\|89879_91871_+\|terminase	terminase	A0A077SK57	Escherichia_phage	3.6e-07	54.9
WP_103270748.1\|91943_93545_+\|tail	phage tail protein	NA	NA	NA	NA
WP_001243269.1\|93559_93838_+	hypothetical protein	NA	NA	NA	NA
WP_001272161.1\|93839_94970_+	hypothetical protein	A0A222YXT1	Escherichia_phage	1.3e-22	35.2
WP_000934750.1\|94959_95508_+	hypothetical protein	NA	NA	NA	NA
WP_000120881.1\|95504_95807_+	hypothetical protein	NA	NA	NA	NA
WP_000217480.1\|95961_97740_+	hypothetical protein	NA	NA	NA	NA
WP_000718477.1\|97803_98430_+	hypothetical protein	NA	NA	NA	NA
WP_000151778.1\|98434_98722_+	hypothetical protein	NA	NA	NA	NA
WP_001022847.1\|98840_100136_+	hypothetical protein	NA	NA	NA	NA
WP_001067778.1\|100157_100925_+	hypothetical protein	NA	NA	NA	NA
WP_001098598.1\|100986_101265_+	hypothetical protein	NA	NA	NA	NA
WP_005120136.1\|101350_102247_-	hypothetical protein	A5VW58	Enterobacteria_phage	7.4e-45	42.0
WP_000229653.1\|102453_102705_+	hypothetical protein	NA	NA	NA	NA
WP_001015563.1\|103250_103526_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000119670.1\|103488_103755_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	5.2e-15	51.2
WP_001187723.1\|103881_104526_+	hypothetical protein	NA	NA	NA	NA
WP_001240941.1\|104525_104975_+	hypothetical protein	NA	NA	NA	NA
WP_001167468.1\|104974_105868_+	hypothetical protein	NA	NA	NA	NA
WP_103270749.1\|105877_115456_+	DUF1983 domain-containing protein	A0A126DKX0	Acinetobacter_phage	1.0e-128	31.3
WP_000190166.1\|115456_115855_+	hypothetical protein	G4WT78	Acinetobacter_phage	7.8e-47	69.7
WP_046660180.1\|115854_116625_+	hypothetical protein	G4WT79	Acinetobacter_phage	3.2e-81	79.5
WP_103270750.1\|116652_116847_-	hypothetical protein	NA	NA	NA	NA
WP_000098520.1\|117006_118542_+	hypothetical protein	A0A222YXQ7	Escherichia_phage	1.2e-31	26.2
WP_000863713.1\|118541_119195_+	hypothetical protein	NA	NA	NA	NA
118659:118677	attL	NA	NA	NA	NA
WP_103270751.1\|119268_121221_+	hypothetical protein	NA	NA	NA	NA
WP_103270752.1\|121220_122732_+	hypothetical protein	A0A222YY44	Escherichia_phage	6.8e-83	42.8
WP_103270753.1\|122807_126638_+	DEAD/DEAH box helicase family protein	A0A1Y0T2N3	Pseudomonas_phage	1.4e-198	43.0
WP_004743497.1\|126763_127213_+	hypothetical protein	NA	NA	NA	NA
WP_004743499.1\|127287_128100_+	hypothetical protein	NA	NA	NA	NA
WP_004743501.1\|128099_128795_+	hypothetical protein	NA	NA	NA	NA
WP_000894311.1\|128787_129006_+	hypothetical protein	NA	NA	NA	NA
WP_001279704.1\|129127_129415_+	hypothetical protein	NA	NA	NA	NA
WP_000766533.1\|129411_130182_+	TIGR02594 family protein	A0A0B5L5G5	Acinetobacter_phage	1.7e-151	98.4
WP_000602528.1\|130307_130667_-	hypothetical protein	NA	NA	NA	NA
WP_001072150.1\|131050_131749_-	hypothetical protein	NA	NA	NA	NA
WP_001215499.1\|131902_133201_-	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	2.3e-156	62.4
WP_000022554.1\|133197_133698_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	6.3e-46	57.8
WP_000332614.1\|133839_134475_-	SOS response-associated peptidase family protein	A0A218MNF5	uncultured_virus	3.0e-69	57.4
WP_001050367.1\|134623_135289_+	hypothetical protein	NA	NA	NA	NA
WP_002047807.1\|135666_137019_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAT5	uncultured_Caudovirales_phage	5.7e-73	39.0
WP_004738162.1\|137194_138418_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.2e-43	44.3
WP_002047760.1\|138552_139917_-	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_002047799.1\|139918_140113_-	hypothetical protein	NA	NA	NA	NA
WP_086384349.1\|140231_141128_-	hypothetical protein	NA	NA	NA	NA
WP_086384348.1\|141235_141748_-	hypothetical protein	NA	NA	NA	NA
WP_017897367.1\|141829_144709_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
143710:143728	attR	NA	NA	NA	NA
WP_050680866.1\|145559_145913_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_017897789.1\|146025_146421_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_050680865.1\|146853_147636_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	5.5e-20	32.4
WP_017897680.1\|147635_149204_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.4e-162	56.4
WP_002122556.1\|149320_150067_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9

DBSCAN-SWA_3

288164 : 359971

Enterobacteria_phage(23.08%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076611894.1\|288164_288987_-\|transposase	IS5-like element ISAba27 family transposase	NA	NA	NA	NA
WP_103270756.1\|289249_290182_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.7e-60	42.0
WP_031997976.1\|292061_293270_-\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	6.9e-46	46.5
WP_016654309.1\|296811_297591_+	OmpA family protein	NA	NA	NA	NA
WP_086238066.1\|297701_298268_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_031985039.1\|298527_298869_+	hypothetical protein	NA	NA	NA	NA
WP_001166305.1\|298976_299090_+	hypothetical protein	NA	NA	NA	NA
WP_000669365.1\|299168_299486_+	hypothetical protein	NA	NA	NA	NA
WP_000003719.1\|299898_300183_-	cell division protein ZapA	NA	NA	NA	NA
WP_002057436.1\|300179_300740_-	hypothetical protein	NA	NA	NA	NA
WP_002057431.1\|300804_301437_+	UPF0149 family protein	NA	NA	NA	NA
WP_005139846.1\|301504_302827_+	Xaa-Pro aminopeptidase	NA	NA	NA	NA
WP_001187366.1\|302858_304067_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_002057424.1\|304063_305296_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_000129799.1\|305505_305757_+	hypothetical protein	NA	NA	NA	NA
WP_000058923.1\|305811_306213_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000896576.1\|306278_306920_+	cation transporter	NA	NA	NA	NA
WP_000950251.1\|306977_307580_-	amino acid transporter	NA	NA	NA	NA
WP_002057442.1\|307686_308577_+	LysR family transcriptional regulator ArgP	NA	NA	NA	NA
WP_002057439.1\|308579_308966_-	hypothetical protein	NA	NA	NA	NA
WP_001275992.1\|309060_309897_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.3e-45	39.9
WP_000959396.1\|310090_310492_+	YraN family protein	NA	NA	NA	NA
WP_002057438.1\|310572_311280_+	BON domain-containing protein	NA	NA	NA	NA
WP_001048904.1\|311283_312147_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_002057427.1\|312169_312913_-	NAD(+) diphosphatase	NA	NA	NA	NA
WP_001289227.1\|312912_314556_-	hypothetical protein	NA	NA	NA	NA
WP_001984886.1\|314689_316069_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	7.9e-38	39.6
WP_000277832.1\|316301_319517_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	2.8e-25	37.7
WP_086238067.1\|319655_321368_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002059666.1\|321397_322450_+	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_000008524.1\|322449_323460_+	ABC transporter permease	NA	NA	NA	NA
WP_002059659.1\|323437_325027_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-19	33.0
WP_002122556.1\|325135_325882_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
WP_002059665.1\|326072_327317_+	NADH:flavin oxidoreductase/NADH oxidase family protein	NA	NA	NA	NA
WP_002059667.1\|327375_329490_-	TonB-dependent receptor	NA	NA	NA	NA
WP_001982681.1\|329767_330430_-	ribonuclease T	L0N5X9	Acaryochloris_phage	2.0e-07	35.4
WP_001084867.1\|330414_331449_-	dihydroorotase	NA	NA	NA	NA
WP_000013375.1\|331598_332861_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.9e-18	40.6
WP_001986427.1\|332920_334279_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	2.0e-54	81.0
WP_002059658.1\|334544_336575_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_086222338.1\|336913_337966_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_001153947.1\|338025_339114_-	DUF898 domain-containing protein	NA	NA	NA	NA
WP_001043692.1\|339217_340150_-\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6
WP_000732870.1\|341003_341882_+	hypothetical protein	NA	NA	NA	NA
WP_079269062.1\|344043_344691_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_031985153.1\|344822_345293_-	hypothetical protein	NA	NA	NA	NA
WP_002059267.1\|345592_346264_+	CsgG/HfaB family protein	NA	NA	NA	NA
WP_002059262.1\|346281_346650_+	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_000592254.1\|346646_347324_+	DUF799 domain-containing protein	NA	NA	NA	NA
WP_000416092.1\|347467_347827_-	hypothetical protein	NA	NA	NA	NA
WP_074163676.1\|348208_349567_-	amino acid permease	NA	NA	NA	NA
WP_002059257.1\|349712_351158_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_002059261.1\|351177_352509_-	APC family permease	NA	NA	NA	NA
WP_000191922.1\|352704_353412_-	cache protein	NA	NA	NA	NA
WP_001277431.1\|353477_354197_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002059260.1\|354256_355027_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_002059266.1\|355055_356486_-	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_002001056.1\|356804_357227_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_017725625.1\|357362_358598_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.2e-23	28.4
WP_001043692.1\|359038_359971_+\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6

DBSCAN-SWA_4

366807 : 454572

100

Acinetobacter_phage(59.38%)

transposase,integrase,tRNA,tail,lysis,terminase,capsid

attL 371920:371940|attR 421626:421646

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088360641.1\|366807_368186_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-74	51.5
WP_002059726.1\|368268_368826_-	cytochrome b	NA	NA	NA	NA
WP_000735756.1\|369066_369456_+	hypothetical protein	NA	NA	NA	NA
WP_000495834.1\|369521_370088_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.4e-25	42.4
WP_000906487.1\|370157_370412_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
WP_001185176.1\|370658_371939_-	aspartate kinase	NA	NA	NA	NA
371920:371940	attL	NA	NA	NA	NA
WP_000362184.1\|372148_372364_-	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
WP_000015928.1\|372365_372623_-	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	2.2e-42	90.5
WP_103270757.1\|372626_372911_-	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	7.5e-44	95.7
WP_000453808.1\|372907_373117_-	hypothetical protein	A0A0P0IVS1	Acinetobacter_phage	6.3e-32	98.6
WP_000654849.1\|373119_373365_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	3.3e-40	98.8
WP_103270758.1\|373366_374368_-	hypothetical protein	A0A0P0IKV7	Acinetobacter_phage	6.5e-175	92.2
WP_103270759.1\|374364_375486_-	ATP-binding protein	A0A0N7IRE0	Acinetobacter_phage	5.7e-212	99.7
WP_049069022.1\|375497_375821_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	2.1e-42	77.6
WP_000656410.1\|375813_376104_-	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	1.6e-49	99.0
WP_001101440.1\|376103_376544_-	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	2.3e-76	100.0
WP_000187985.1\|376771_377563_-	helix-turn-helix domain-containing protein	A0A0R6PH50	Moraxella_phage	1.4e-10	52.1
WP_000210973.1\|377565_377814_+	helix-turn-helix domain-containing protein	A0A0R6PH31	Moraxella_phage	8.0e-18	58.6
WP_001289843.1\|377868_378369_+	hypothetical protein	NA	NA	NA	NA
WP_103270936.1\|378418_378691_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	1.7e-37	95.5
WP_001084133.1\|378687_378984_+	hypothetical protein	A0A0D4DCL5	Acinetobacter_phage	4.0e-48	98.0
WP_103270760.1\|378980_379343_+	hypothetical protein	A0A0D4DBI9	Acinetobacter_phage	9.2e-55	98.3
WP_103270761.1\|379335_380265_+	YdaU family protein	A0A0P0I481	Acinetobacter_phage	3.7e-172	99.4
WP_000544506.1\|380257_381007_+	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	1.2e-136	98.4
WP_001031745.1\|381003_381129_+	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	4.8e-11	89.5
WP_000778991.1\|381125_381533_+	HNH endonuclease	K7P7B7	Enterobacteria_phage	2.3e-25	48.8
WP_029749821.1\|381628_381847_+	hypothetical protein	A0A0P0IY41	Acinetobacter_phage	1.7e-19	90.7
WP_057691425.1\|381843_382248_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.6e-21	50.0
WP_000992314.1\|382250_382664_+	antitermination protein	NA	NA	NA	NA
WP_002011142.1\|382961_383498_+	hypothetical protein	NA	NA	NA	NA
WP_085940844.1\|383608_384774_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.6e-164	99.6
WP_000372130.1\|384976_385618_+	hypothetical protein	J7I4N9	Acinetobacter_phage	1.3e-123	97.7
WP_000212566.1\|385676_386147_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	3.0e-82	100.0
WP_103270762.1\|386136_387564_+\|terminase	phage terminase large subunit	A0A0D4DCE6	Acinetobacter_phage	3.6e-259	90.5
WP_103270763.1\|387560_389006_+	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	2.2e-256	89.8
WP_057691261.1\|389012_390116_+\|capsid	minor capsid protein	A0A0D4DBL9	Acinetobacter_phage	1.3e-205	99.5
WP_004743774.1\|390124_390553_+	hypothetical protein	J7I4P3	Acinetobacter_phage	3.4e-72	99.3
WP_000004361.1\|390651_390894_+	hypothetical protein	A0A0P0IY55	Acinetobacter_phage	2.1e-39	100.0
WP_001139861.1\|391111_391303_+	hypothetical protein	A0A0P0IKM2	Acinetobacter_phage	1.7e-28	100.0
WP_103270764.1\|391416_392184_+	hypothetical protein	J7I0W4	Acinetobacter_phage	2.1e-117	89.8
WP_000214194.1\|392211_393165_+	Ig domain-containing protein	A0A0D4DBM4	Acinetobacter_phage	1.2e-167	94.0
WP_023188266.1\|393229_393895_+	stress-responsive nuclear envelope protein	J7I4P7	Acinetobacter_phage	5.2e-80	72.4
WP_049065468.1\|393899_394289_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	6.2e-65	96.9
WP_081408048.1\|394245_394659_+	glutamate 5-kinase	J7I467	Acinetobacter_phage	1.5e-53	73.0
WP_103270765.1\|394667_395042_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.2e-57	88.6
WP_049065464.1\|395236_395605_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	3.3e-52	81.1
WP_049065463.1\|395606_396005_+	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	1.1e-48	65.9
WP_103270767.1\|396122_397058_+	hypothetical protein	A0A059VG08	Pseudomonas_phage	9.1e-54	38.8
WP_086223776.1\|397107_397641_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	4.0e-46	61.9
WP_023188274.1\|397969_398152_+	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	1.8e-27	95.0
WP_023188275.1\|398216_398621_+	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	1.3e-62	89.6
WP_031959349.1\|398703_399051_+	hypothetical protein	NA	NA	NA	NA
WP_031959380.1\|399491_399680_+	hypothetical protein	NA	NA	NA	NA
WP_103270769.1\|399843_403917_+	tape measure protein	A0A0D4DC37	Acinetobacter_phage	2.5e-249	47.9
WP_103270770.1\|403919_404183_+	hypothetical protein	NA	NA	NA	NA
WP_171266193.1\|404263_404407_+	hypothetical protein	NA	NA	NA	NA
WP_103270771.1\|404403_404745_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	2.6e-11	39.4
WP_103270772.1\|404798_405971_+	hypothetical protein	G3ENB2	Psychrobacter_phage	3.4e-50	41.7
WP_103270773.1\|405957_406764_+\|tail	phage minor tail protein L	A0A0R6PGU8	Moraxella_phage	1.2e-91	62.7
WP_103270774.1\|406770_407520_+	C40 family peptidase	A0A0R6PIM4	Moraxella_phage	4.8e-82	55.3
WP_103270775.1\|407525_407864_+	hypothetical protein	NA	NA	NA	NA
WP_103270776.1\|407933_408599_+\|tail	tail assembly protein	A0A0R6PIW1	Moraxella_phage	1.3e-43	48.6
WP_103270777.1\|408655_413101_+\|tail	phage tail protein	A0A0R6PIC9	Moraxella_phage	0.0e+00	65.5
WP_049065885.1\|413113_413473_+	hypothetical protein	NA	NA	NA	NA
WP_103270778.1\|413453_414305_+	hypothetical protein	NA	NA	NA	NA
WP_103270779.1\|414393_414687_+\|lysis	lysis protein	NA	NA	NA	NA
WP_103270780.1\|414667_414892_+	hypothetical protein	NA	NA	NA	NA
WP_103270781.1\|414949_415495_+	N-acetylmuramidase	A0A0N7IRE7	Acinetobacter_phage	1.9e-96	93.4
WP_103270782.1\|416240_416462_-	hypothetical protein	NA	NA	NA	NA
WP_103270783.1\|416544_417843_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	1.4e-153	60.5
WP_103270784.1\|417846_418341_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	6.9e-45	60.3
WP_103270785.1\|418455_419100_-	SOS response-associated peptidase family protein	A0A218MNF5	uncultured_virus	1.6e-57	49.3
WP_103270786.1\|419140_420139_-	hypothetical protein	NA	NA	NA	NA
WP_103270787.1\|420212_421424_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PDI8	Moraxella_phage	8.6e-105	51.0
WP_000199457.1\|421710_424347_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.8e-75	38.6
421626:421646	attR	NA	NA	NA	NA
WP_001188823.1\|424616_425642_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_000155680.1\|425917_427084_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_000517792.1\|427148_428468_+	adenylosuccinate synthase	A0A2P1EKE7	Megavirus	4.8e-69	36.0
WP_000776215.1\|428589_428907_+	hypothetical protein	NA	NA	NA	NA
WP_001034598.1\|429023_429803_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_002059731.1\|429860_430910_-	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_000203217.1\|431070_431778_-	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_001195082.1\|432216_432639_+	OsmC family protein	NA	NA	NA	NA
WP_002059735.1\|432733_433159_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001237336.1\|433155_433962_-	peptidoglycan DD-metalloendopeptidase family protein	G9BW84	Planktothrix_phage	9.0e-18	35.9
WP_001210050.1\|434262_436842_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.3e-123	32.4
WP_000941316.1\|436899_437388_-	CinA family protein	A0A218MNG4	uncultured_virus	4.0e-29	43.3
WP_001060738.1\|437656_438073_+	hypothetical protein	NA	NA	NA	NA
WP_086238301.1\|438098_440324_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_000655897.1\|440542_440887_+	hypothetical protein	NA	NA	NA	NA
WP_002059721.1\|441010_442027_+	aspartate carbamoyltransferase catalytic subunit	NA	NA	NA	NA
WP_086267205.1\|442030_443275_+	aspartate carbamoyltransferase	NA	NA	NA	NA
WP_000026486.1\|443488_444904_+	OmpA family protein	NA	NA	NA	NA
WP_002059729.1\|444990_445770_+	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_000912925.1\|445780_446407_-	glutathione S-transferase	NA	NA	NA	NA
WP_002059736.1\|446622_447198_+	hypothetical protein	NA	NA	NA	NA
WP_001043692.1\|447204_448137_-\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6
WP_002059733.1\|450110_450851_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_002059722.1\|450972_453411_+	ExeM/NucH family extracellular endonuclease	NA	NA	NA	NA
WP_078207669.1\|453639_454572_+\|transposase	IS5-like element IS17 family transposase	Q1MVF0	Enterobacteria_phage	9.3e-59	41.2

DBSCAN-SWA_5

501536 : 510520

Staphylococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001183458.1\|501536_502283_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-20	25.9
WP_002122556.1\|502364_503111_+\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
WP_162897177.1\|503678_504902_+	TolC family protein	NA	NA	NA	NA
WP_000988402.1\|504898_507040_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-29	24.7
WP_031985054.1\|507036_508227_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000885988.1\|508318_508918_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.0e-21	36.6
WP_000132362.1\|508910_509522_+	chloramphenicol acetyltransferase CAT	M1HKK6	Paramecium_bursaria_Chlorella_virus	3.6e-11	54.0
WP_001082436.1\|509677_510520_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	2.6e-36	33.9

DBSCAN-SWA_6

1697629 : 1711803

Acinetobacter_phage(72.73%)

transposase,integrase

attL 1696563:1696578|attR 1720885:1720900

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1696563:1696578	attL	NA	NA	NA	NA
WP_085942227.1\|1697629_1698795_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.1e-165	100.0
WP_000872622.1\|1699075_1700617_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.9e-288	100.0
WP_000999161.1\|1700613_1702416_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	0.0e+00	97.7
WP_023188291.1\|1702904_1704101_+\|integrase	tyrosine-type recombinase/integrase	A0A0D4DBR3	Acinetobacter_phage	5.5e-221	97.7
WP_023188290.1\|1704237_1704732_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	1.2e-44	58.3
WP_103270811.1\|1704735_1706034_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	1.7e-159	61.9
WP_103270938.1\|1706133_1706733_+	hypothetical protein	NA	NA	NA	NA
WP_103270812.1\|1706969_1707512_-	N-acetylmuramidase	A0A0N7IRE7	Acinetobacter_phage	2.5e-96	95.5
WP_001100986.1\|1707573_1707753_-	hypothetical protein	A0A0D4DCA7	Acinetobacter_phage	9.2e-24	100.0
WP_001021568.1\|1707778_1708321_-	hypothetical protein	A0A0D4DBW7	Acinetobacter_phage	5.7e-101	100.0
WP_103270813.1\|1708432_1708822_-	hypothetical protein	J7I481	Acinetobacter_phage	7.3e-66	98.4
WP_103270814.1\|1708885_1711375_-	hypothetical protein	NA	NA	NA	NA
WP_103270815.1\|1711374_1711803_-	C40 family peptidase	A0A0B5A615	Paracoccus_phage	4.5e-08	34.6
1720885:1720900	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1724006 : 1760858

Acinetobacter_phage(73.53%)

terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000039808.1\|1724006_1724981_-	DUF2184 domain-containing protein	M4SQD1	Psychrobacter_phage	2.0e-51	37.5
WP_000240727.1\|1724986_1725457_-	hypothetical protein	NA	NA	NA	NA
WP_005068141.1\|1725470_1726667_-	DUF2213 domain-containing protein	H9C194	Pectobacterium_phage	2.5e-24	33.9
WP_000823405.1\|1726720_1727020_-	hypothetical protein	NA	NA	NA	NA
WP_153309870.1\|1727135_1727366_+	hypothetical protein	NA	NA	NA	NA
WP_000207479.1\|1727354_1728167_-\|capsid	minor capsid protein	M4T3R2	Psychrobacter_phage	1.3e-51	41.8
WP_103270823.1\|1728111_1729446_-	DUF1073 domain-containing protein	M4SN90	Psychrobacter_phage	2.2e-85	38.9
WP_103270824.1\|1729454_1730981_-\|terminase	phage terminase large subunit	I3PGT7	Xanthomonas_phage	1.6e-92	42.0
WP_103270825.1\|1730958_1731435_-	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	8.5e-32	47.7
WP_033855583.1\|1731480_1732113_-	hypothetical protein	A0A1B1P9K3	Acinetobacter_phage	7.5e-60	55.5
WP_033855584.1\|1732109_1732301_-	hypothetical protein	J7I0V8	Acinetobacter_phage	4.0e-25	87.3
WP_000898317.1\|1732357_1732603_-	hypothetical protein	NA	NA	NA	NA
WP_002120865.1\|1732861_1733014_-	hypothetical protein	NA	NA	NA	NA
WP_033855586.1\|1733279_1734032_-	hypothetical protein	A0A0P0J081	Acinetobacter_phage	1.1e-129	92.8
WP_103270826.1\|1734045_1734444_-	DUF559 domain-containing protein	A0A0P0IKL1	Acinetobacter_phage	6.3e-65	92.4
WP_004834289.1\|1734443_1734767_-	hypothetical protein	NA	NA	NA	NA
WP_000030899.1\|1734756_1734963_-	hypothetical protein	NA	NA	NA	NA
WP_004834288.1\|1734955_1735234_-	DUF3850 domain-containing protein	A0A059T7N3	Listeria_phage	2.2e-11	46.5
WP_103270827.1\|1735226_1735598_-	hypothetical protein	A0A0P0IKW4	Acinetobacter_phage	5.0e-32	60.6
WP_002069861.1\|1735614_1735758_-	hypothetical protein	NA	NA	NA	NA
WP_000017854.1\|1735754_1736162_-	hypothetical protein	NA	NA	NA	NA
WP_078177514.1\|1736158_1736908_-	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	9.9e-136	97.6
WP_064713902.1\|1736900_1737851_-	YdaU family protein	A0A0P0I481	Acinetobacter_phage	1.5e-99	63.9
WP_078177518.1\|1737847_1739401_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	3.2e-136	41.3
WP_044696544.1\|1739397_1739718_-	hypothetical protein	NA	NA	NA	NA
WP_057048486.1\|1739767_1740268_-	hypothetical protein	NA	NA	NA	NA
WP_019767546.1\|1740328_1740592_-	transcriptional regulator	NA	NA	NA	NA
WP_032018627.1\|1740725_1741475_+	helix-turn-helix transcriptional regulator	H1ZZB6	Pseudomonas_virus	6.4e-10	31.4
WP_103270828.1\|1741679_1742129_+	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	1.9e-73	95.9
WP_000064469.1\|1742121_1742445_+	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	1.5e-43	79.4
WP_001207477.1\|1742455_1743577_+	ATP-binding protein	A0A0D4DBX7	Acinetobacter_phage	2.6e-212	100.0
WP_002126580.1\|1743573_1744533_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	5.1e-161	91.2
WP_000654850.1\|1744534_1744786_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	3.2e-38	98.7
WP_004834275.1\|1744786_1745176_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	5.7e-10	53.0
WP_000783308.1\|1745172_1745475_+	hypothetical protein	A0A2I7QNA8	Vibrio_phage	7.8e-07	35.7
WP_103270829.1\|1745471_1745666_+	hypothetical protein	NA	NA	NA	NA
WP_000529848.1\|1745666_1745936_+	hypothetical protein	A0A0P0J067	Acinetobacter_phage	8.7e-42	100.0
WP_171057037.1\|1746059_1746635_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	3.9e-108	98.4
WP_086384350.1\|1746731_1749503_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	97.9
WP_000281138.1\|1749510_1752243_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.2
WP_001982145.1\|1752599_1753649_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
WP_000608309.1\|1753658_1754465_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.9e-145	98.9
WP_000066126.1\|1754474_1755170_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_001164231.1\|1755180_1756164_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.1e-182	96.0
WP_017897159.1\|1756170_1758546_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	98.6
WP_000893699.1\|1758547_1760047_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.2e-275	95.4
WP_001187844.1\|1760309_1760858_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	1.7e-97	100.0

DBSCAN-SWA_8

2020648 : 2078095

Enterobacteria_phage(16.67%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002059245.1\|2020648_2021044_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_103270854.1\|2021117_2021489_+	AAA family ATPase	NA	NA	NA	NA
WP_001040033.1\|2021641_2022574_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.7e-60	41.6
WP_103270855.1\|2022728_2023403_+	hypothetical protein	NA	NA	NA	NA
WP_103270856.1\|2023645_2027644_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	6.6e-69	33.3
WP_103270857.1\|2028250_2028781_+	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_000841361.1\|2029039_2029534_-	transcription elongation factor GreB	NA	NA	NA	NA
WP_001984613.1\|2029906_2031019_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_001110719.1\|2031110_2031494_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_000271251.1\|2031700_2032606_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.4e-91	64.2
WP_002010827.1\|2033196_2033973_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	2.4e-36	53.6
WP_103270858.1\|2034230_2035136_+\|protease	protease HtpX	NA	NA	NA	NA
WP_001135457.1\|2035185_2035761_-	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_103270859.1\|2035833_2038929_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_000488520.1\|2039192_2040335_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_002122556.1\|2041179_2041926_-\|transposase	IS5-like element ISAba31 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.3e-14	35.9
WP_000379022.1\|2042306_2042681_+	diacylglycerol kinase	NA	NA	NA	NA
WP_001274623.1\|2042855_2044490_-	chaperonin GroEL	A0A219YK78	uncultured_virus	8.1e-175	60.9
WP_000065579.1\|2044548_2044839_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	2.3e-16	51.1
WP_000924308.1\|2045024_2045783_-	metallophosphoesterase	NA	NA	NA	NA
WP_001247651.1\|2045763_2046702_-	NAD(+)/NADH kinase	NA	NA	NA	NA
WP_000214355.1\|2047093_2048926_+	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
WP_000868068.1\|2048967_2050485_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_000063783.1\|2050639_2052148_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_017898102.1\|2052825_2053335_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001043188.1\|2055438_2055861_+	hypothetical protein	NA	NA	NA	NA
WP_001278002.1\|2055880_2056549_-	methyltransferase	NA	NA	NA	NA
WP_001229849.1\|2056789_2057638_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	6.1e-25	34.4
WP_002123675.1\|2058062_2059826_-	alkaline phosphatase D family protein	NA	NA	NA	NA
WP_002017041.1\|2060529_2060820_-	hypothetical protein	NA	NA	NA	NA
WP_161325550.1\|2060978_2061821_-	dihydropteroate synthase	NA	NA	NA	NA
WP_001286662.1\|2061961_2063857_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-106	46.4
WP_000235573.1\|2063991_2064642_-	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	A0A140HEP8	Marsac_virus	4.1e-05	25.1
WP_000729551.1\|2064841_2065165_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_000179359.1\|2065179_2065716_+	DOMON-like domain-containing protein	NA	NA	NA	NA
WP_001282885.1\|2065774_2066362_-	hypothetical protein	NA	NA	NA	NA
WP_000106446.1\|2066675_2067815_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
WP_001126293.1\|2067829_2071060_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_001190203.1\|2071147_2071624_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_000116197.1\|2071704_2072292_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001258301.1\|2072432_2072825_+	RidA family protein	NA	NA	NA	NA
WP_000818514.1\|2072937_2073570_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	3.5e-17	35.5
WP_000966786.1\|2073691_2074129_+	universal stress protein	NA	NA	NA	NA
WP_000377323.1\|2074184_2074514_-	MGMT family protein	NA	NA	NA	NA
WP_000722324.1\|2074595_2075312_+\|protease	metalloprotease	NA	NA	NA	NA
WP_001043692.1\|2077162_2078095_+\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	9.7e-56	39.6

DBSCAN-SWA_9

2272949 : 2334263

Enterobacteria_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103270875.1\|2272949_2273700_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.5e-24	44.9
WP_002046710.1\|2274095_2275166_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_017725450.1\|2275156_2276443_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_001071168.1\|2276439_2277336_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_017725449.1\|2277332_2278136_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_103270876.1\|2278565_2279498_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	7.6e-61	42.3
WP_000364279.1\|2280099_2281095_-	DUF2804 domain-containing protein	NA	NA	NA	NA
WP_017725381.1\|2281132_2281645_-	DUF1543 domain-containing protein	NA	NA	NA	NA
WP_000372734.1\|2281654_2282884_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_000083555.1\|2282867_2283527_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_086249945.1\|2283883_2285734_+	TonB-dependent receptor	NA	NA	NA	NA
WP_004745935.1\|2285831_2286410_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_017725384.1\|2286482_2287196_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_000701693.1\|2287224_2287755_-	META domain-containing protein	NA	NA	NA	NA
WP_000199593.1\|2287963_2289136_+	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	2.5e-32	32.3
WP_001160208.1\|2289249_2290692_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.6e-44	31.9
WP_000680577.1\|2290755_2291442_-	response regulator	W8CYM9	Bacillus_phage	2.5e-29	33.8
WP_103270939.1\|2291461_2293120_-	sensor histidine kinase efflux regulator BaeS	NA	NA	NA	NA
WP_002056344.1\|2293214_2294147_+\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	1.3e-55	39.6
WP_005134747.1\|2294299_2294680_+	hypothetical protein	NA	NA	NA	NA
WP_001136744.1\|2294969_2296772_+	acyl-CoA dehydrogenase C-terminal domain-containing protein	NA	NA	NA	NA
WP_001123422.1\|2296939_2298721_+	acyl-CoA dehydrogenase C-terminal domain-containing protein	NA	NA	NA	NA
WP_001113294.1\|2298840_2299323_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_017725386.1\|2299360_2299744_-	RcnB family protein	NA	NA	NA	NA
WP_017725387.1\|2299908_2300355_+	hypothetical protein	NA	NA	NA	NA
WP_017725388.1\|2300669_2302133_-	phospholipase D	NA	NA	NA	NA
WP_049594531.1\|2302208_2304290_-	TonB-dependent receptor	NA	NA	NA	NA
WP_001116941.1\|2304425_2305190_+	DUF4184 family protein	NA	NA	NA	NA
WP_017725390.1\|2305360_2307139_+\|tRNA	aspartate--tRNA ligase	A0A2K9KZX5	Tupanvirus	1.4e-18	21.7
WP_001251491.1\|2307280_2307499_+	hypothetical protein	NA	NA	NA	NA
WP_001170031.1\|2307498_2308437_+	glycosyltransferase	NA	NA	NA	NA
WP_000498151.1\|2308474_2309494_+	glycosyltransferase	A0A1V0SAH6	Catovirus	7.9e-11	33.9
WP_001195721.1\|2309521_2310073_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.7e-47	52.4
WP_000054001.1\|2310062_2310953_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.0e-110	66.6
WP_000698332.1\|2310949_2311843_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_000670932.1\|2311845_2312913_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.2e-99	52.1
WP_000193718.1\|2313048_2314092_-	mitochondrial fission ELM1 family protein	NA	NA	NA	NA
WP_000705219.1\|2314104_2315088_-	glycosyltransferase	NA	NA	NA	NA
WP_000499405.1\|2315090_2315900_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000548418.1\|2315913_2316801_-	mitochondrial fission ELM1 family protein	NA	NA	NA	NA
WP_001046506.1\|2316868_2317795_-	branched-chain amino acid transaminase	NA	NA	NA	NA
WP_000990825.1\|2317819_2320570_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_000194108.1\|2320638_2321907_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_001177143.1\|2322709_2323747_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_001121100.1\|2323900_2324929_+	hypothetical protein	NA	NA	NA	NA
WP_016653537.1\|2325013_2325583_+	LemA family protein	NA	NA	NA	NA
WP_002057951.1\|2325826_2326960_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-94	48.2
WP_000051669.1\|2327058_2327388_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_001270222.1\|2327439_2329341_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_001984787.1\|2329349_2330315_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-31	33.1
WP_103270877.1\|2330405_2331735_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.5e-70	50.8
WP_087486619.1\|2331783_2333002_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_100223103.1\|2333124_2334263_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.9e-84	59.0

DBSCAN-SWA_10

2852569 : 2886888

uncultured_virus(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005137264.1\|2852569_2853532_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.9e-07	34.1
WP_005137263.1\|2853528_2854833_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_001097630.1\|2854875_2855019_-	methionine/alanine import family NSS transporter small subunit	NA	NA	NA	NA
WP_004833442.1\|2855031_2856510_-	sodium-dependent transporter	NA	NA	NA	NA
WP_001256688.1\|2857105_2857831_+	TIGR04219 family outer membrane beta-barrel protein	NA	NA	NA	NA
WP_000587887.1\|2857888_2858488_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_014538288.1\|2864356_2864842_-	peptidyl-prolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.3e-15	37.7
WP_002124507.1\|2865057_2866128_-	alpha/beta hydrolase	A0A2K9L3Q5	Tupanvirus	9.8e-12	27.3
WP_001274778.1\|2866338_2866665_+	hypothetical protein	NA	NA	NA	NA
WP_000733015.1\|2866838_2867069_-	hypothetical protein	NA	NA	NA	NA
WP_000122230.1\|2867805_2868111_+\|transposase	transposase	A0A218MNC9	uncultured_virus	3.4e-18	52.5
WP_106631126.1\|2868149_2868653_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_002124530.1\|2868919_2869216_-	hypothetical protein	NA	NA	NA	NA
WP_001262789.1\|2870380_2870935_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_002124501.1\|2871088_2873017_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-147	48.3
WP_002124526.1\|2873348_2874266_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_004836538.1\|2874452_2875358_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_001985173.1\|2875459_2875846_+	hypothetical protein	NA	NA	NA	NA
WP_088753077.1\|2875894_2877103_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_004836541.1\|2877870_2878992_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_000994663.1\|2879001_2879514_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.0e-19	40.9
WP_085943970.1\|2879697_2880060_-	DMT family protein	NA	NA	NA	NA
WP_000550095.1\|2880301_2881675_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_001265996.1\|2881744_2882995_-	low temperature requirement protein A	NA	NA	NA	NA
WP_000051336.1\|2883130_2883727_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_005137745.1\|2884044_2885001_+	TerC family protein	A0A1D7XFL1	Escherichia_phage	2.2e-31	32.5
WP_005137747.1\|2885196_2885562_+	hypothetical protein	NA	NA	NA	NA
WP_106631126.1\|2886040_2886544_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_000122230.1\|2886582_2886888_-\|transposase	transposase	A0A218MNC9	uncultured_virus	3.4e-18	52.5

DBSCAN-SWA_11

3133447 : 3162907

uncultured_Caudovirales_phage(22.22%)

transposase,integrase

attL 3136478:3136493|attR 3167379:3167394

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000122230.1\|3133447_3133753_+\|transposase	transposase	A0A218MNC9	uncultured_virus	3.4e-18	52.5
WP_106631126.1\|3133791_3134295_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_000994592.1\|3134313_3135705_-	multidrug transporter subunit MdtD	NA	NA	NA	NA
WP_001986939.1\|3135902_3136508_-	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	2.5e-12	27.8
3136478:3136493	attL	NA	NA	NA	NA
WP_000575778.1\|3136852_3138445_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.8e-41	43.1
WP_000194006.1\|3138516_3138984_+	YchJ family protein	NA	NA	NA	NA
WP_000927792.1\|3139029_3139674_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_000366687.1\|3139756_3141076_+	MFS transporter	NA	NA	NA	NA
WP_000202262.1\|3141229_3143449_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.2e-81	33.9
WP_000411996.1\|3143746_3145426_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	27.1
WP_017897392.1\|3145465_3145849_-	hypothetical protein	NA	NA	NA	NA
WP_001985514.1\|3145943_3146354_+	MAPEG family protein	A0A2H4J146	uncultured_Caudovirales_phage	2.4e-14	43.8
WP_000122443.1\|3146481_3147009_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.6e-61	62.2
WP_000910009.1\|3147115_3148432_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_001985635.1\|3149341_3150169_+	hypothetical protein	NA	NA	NA	NA
WP_000772980.1\|3150211_3151090_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_000845026.1\|3151105_3151882_-	aldolase	NA	NA	NA	NA
WP_031984972.1\|3151993_3153406_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_079254824.1\|3153442_3154069_-	ATP-binding protein	NA	NA	NA	NA
WP_017897426.1\|3154207_3154906_+\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_017897425.1\|3154898_3156788_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_085942227.1\|3157224_3158390_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.1e-165	100.0
WP_031985165.1\|3158929_3160021_+	TniQ family protein	NA	NA	NA	NA
WP_031985164.1\|3160035_3161478_+	hypothetical protein	NA	NA	NA	NA
WP_087486619.1\|3161687_3162907_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
3167379:3167394	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP026128

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 80790

Salmonella_phage(31.58%)

transposase,tail,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000959558.1\|8922_9501_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	2.5e-25	35.6
WP_000567460.1\|9494_10244_-	C40 family peptidase	J9Q7R4	Salmonella_phage	7.8e-48	40.5
WP_103270948.1\|10240_10936_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	2.8e-60	47.3
WP_000394499.1\|10935_11262_-\|tail	phage tail protein	D6PGG4	uncultured_phage	9.0e-09	31.1
WP_103270949.1\|11334_16923_-\|tail	tail length tape measure protein	NA	NA	NA	NA
WP_000119495.1\|16925_17222_-	hypothetical protein	NA	NA	NA	NA
WP_000771531.1\|17278_17632_-	hypothetical protein	NA	NA	NA	NA
WP_000002670.1\|17726_18272_-	hypothetical protein	A0A2H4P707	Pseudomonas_phage	6.3e-39	52.2
WP_042053029.1\|18356_18854_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_001068664.1\|18853_19240_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.6e-12	32.8
WP_005113849.1\|19236_19587_-	hypothetical protein	J9Q7F6	Salmonella_phage	4.3e-09	35.1
WP_171068479.1\|19573_20269_-	hypothetical protein	NA	NA	NA	NA
WP_001110364.1\|20270_21041_-	hypothetical protein	NA	NA	NA	NA
WP_000769019.1\|21047_21542_-	hypothetical protein	L7TKJ9	Rhizobium_phage	6.8e-08	28.7
WP_001130341.1\|21680_22583_-	hypothetical protein	A0A2H4P701	Pseudomonas_phage	6.9e-91	58.3
WP_001131896.1\|22718_23597_-	hypothetical protein	A0A2H4P6Z8	Pseudomonas_phage	7.3e-13	29.4
WP_000206081.1\|23640_25311_-\|portal	phage portal protein	J9Q7R1	Salmonella_phage	8.1e-146	51.9
WP_000764108.1\|25356_26601_-\|terminase	terminase	A0A2H4P6Z9	Pseudomonas_phage	1.3e-151	62.4
WP_000134192.1\|26610_27216_-	hypothetical protein	J9Q6D4	Salmonella_phage	4.0e-18	34.3
WP_000084570.1\|27368_27770_-	hypothetical protein	NA	NA	NA	NA
WP_005113862.1\|27881_28376_-	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	7.0e-05	33.0
WP_001175928.1\|28344_28668_-	hypothetical protein	NA	NA	NA	NA
WP_000416809.1\|28658_29612_-	hypothetical protein	A0A2H4P6X5	Pseudomonas_phage	4.6e-61	42.1
WP_000184979.1\|29650_30073_-	thioredoxin family protein	NA	NA	NA	NA
WP_000312034.1\|30069_30726_-	ATP-binding cassette domain-containing protein	L7TNS9	Rhizobium_phage	5.9e-60	54.8
WP_001292430.1\|30725_31376_-	ParB N-terminal domain-containing protein	L7TMF9	Rhizobium_phage	3.8e-35	41.9
WP_103270950.1\|31372_31975_-	hypothetical protein	NA	NA	NA	NA
WP_103270951.1\|32003_32642_-	ParB N-terminal domain-containing protein	L7TL04	Rhizobium_phage	1.0e-48	46.1
WP_103270952.1\|32720_34430_+	DEAD/DEAH box helicase	L7TNS5	Rhizobium_phage	9.8e-131	46.2
WP_000741665.1\|34555_34849_+	hypothetical protein	NA	NA	NA	NA
WP_000146944.1\|34912_35191_-	hypothetical protein	NA	NA	NA	NA
WP_086249593.1\|35225_35795_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_103270953.1\|36188_36989_-	hypothetical protein	NA	NA	NA	NA
WP_000960558.1\|37428_37854_-	hypothetical protein	NA	NA	NA	NA
WP_005113872.1\|38492_38858_-	hypothetical protein	NA	NA	NA	NA
WP_072618697.1\|40178_40514_+	hypothetical protein	NA	NA	NA	NA
WP_000906141.1\|40577_40796_+	hypothetical protein	NA	NA	NA	NA
WP_023897590.1\|41305_41554_+	hypothetical protein	A0A0M3LSW2	Mannheimia_phage	1.3e-07	44.8
WP_005113876.1\|41591_42107_-	hypothetical protein	NA	NA	NA	NA
WP_002009082.1\|42093_42267_-	hypothetical protein	NA	NA	NA	NA
WP_103270954.1\|42631_42883_-	hypothetical protein	NA	NA	NA	NA
WP_158650814.1\|43020_43191_-	hypothetical protein	NA	NA	NA	NA
WP_103270956.1\|43646_45215_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.1e-163	56.5
WP_103270957.1\|45214_46462_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_001177806.1\|46471_47383_+	hypothetical protein	NA	NA	NA	NA
WP_103270958.1\|47411_50291_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_029423630.1\|51523_52384_-	hypothetical protein	A0A2H4P788	Pseudomonas_phage	8.7e-11	28.1
WP_000135194.1\|52517_53030_-	hypothetical protein	NA	NA	NA	NA
WP_042757975.1\|53029_53314_-	hypothetical protein	NA	NA	NA	NA
WP_000582283.1\|53306_53729_-	hypothetical protein	NA	NA	NA	NA
WP_000698342.1\|53782_54559_-	hypothetical protein	NA	NA	NA	NA
WP_005113777.1\|54845_55325_-	hypothetical protein	NA	NA	NA	NA
WP_029423633.1\|55299_55620_-	hypothetical protein	NA	NA	NA	NA
WP_000613548.1\|55855_56395_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	8.9e-38	48.9
WP_029574691.1\|56964_58941_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	3.8e-126	40.1
WP_078207669.1\|59381_60314_-\|transposase	IS5-like element IS17 family transposase	A0A1V0E8E1	Vibrio_phage	6.9e-62	42.6
WP_000047654.1\|60376_60604_-	hypothetical protein	NA	NA	NA	NA
WP_001019929.1\|60603_60888_-	hypothetical protein	NA	NA	NA	NA
WP_001167539.1\|60891_61803_-	hypothetical protein	A0A0K2FHE7	Achromobacter_phage	3.5e-66	44.8
WP_023897602.1\|61815_62805_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	2.5e-54	38.4
WP_029423593.1\|62902_65275_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	3.1e-207	50.7
WP_000030999.1\|65296_65677_-	hypothetical protein	NA	NA	NA	NA
WP_029423595.1\|65750_66353_-	hypothetical protein	J9Q7Z7	Salmonella_phage	2.4e-31	42.2
WP_000192217.1\|66484_67321_-	hypothetical protein	NA	NA	NA	NA
WP_005113798.1\|67412_69353_-	AAA family ATPase	L7TNH6	Rhizobium_phage	4.1e-117	42.5
WP_005113801.1\|69352_70468_-	metallophosphoesterase	A0A2H4P756	Pseudomonas_phage	8.6e-59	38.1
WP_000095727.1\|71191_71653_-	hypothetical protein	NA	NA	NA	NA
WP_000680035.1\|71649_72009_-	hypothetical protein	NA	NA	NA	NA
WP_005113804.1\|72096_74295_-	hypothetical protein	J9Q736	Salmonella_phage	3.6e-53	50.7
WP_000429228.1\|74297_75335_-	hypothetical protein	J9Q7S6	Salmonella_phage	2.3e-50	36.9
WP_001099771.1\|75397_76258_-	hypothetical protein	A0A2H4P7I7	Pseudomonas_phage	1.9e-29	31.5
WP_000034357.1\|76400_77489_-	hypothetical protein	A0A2H4P749	Pseudomonas_phage	5.0e-11	35.3
WP_000695254.1\|77578_78844_-	hypothetical protein	A0A2H4P750	Pseudomonas_phage	5.9e-72	38.1
WP_000432852.1\|78840_79416_-	HNH endonuclease	A0A0K0N6H6	Gordonia_phage	1.6e-24	51.3
WP_114205116.1\|79464_80790_-	hypothetical protein	J9Q7Z2	Salmonella_phage	5.0e-114	51.5

DBSCAN-SWA_2

84574 : 105698

Rhizobium_phage(25.0%)

integrase,transposase

attL 76368:76384|attR 99700:99716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
76368:76384	attL	NA	NA	NA	NA
WP_000063931.1\|84574_85819_-	AAA family ATPase	L7TKP0	Rhizobium_phage	1.6e-85	41.5
WP_001005718.1\|85963_87886_-	hypothetical protein	A0A2H4P735	Pseudomonas_phage	1.5e-74	43.0
WP_000047261.1\|88126_88321_-	hypothetical protein	NA	NA	NA	NA
WP_000833466.1\|88742_89162_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000124734.1\|89501_90086_+\|integrase	site-specific integrase	A0A0A8WF93	Clostridium_phage	8.9e-07	29.3
WP_029574900.1\|90082_90499_-	hypothetical protein	NA	NA	NA	NA
WP_002125263.1\|90701_91379_+	AAA family ATPase	E5FFJ3	Burkholderia_phage	2.8e-12	26.4
WP_000016663.1\|91375_91804_+	hypothetical protein	NA	NA	NA	NA
WP_029574901.1\|91791_92412_-	hypothetical protein	NA	NA	NA	NA
WP_000497827.1\|92484_93057_-	guanylate kinase	A0A218KC48	Bacillus_phage	9.3e-09	28.5
WP_000343018.1\|93533_94742_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
WP_058061515.1\|94901_96317_-	DNA ligase	A0A2H4P729	Pseudomonas_phage	4.2e-87	40.0
WP_103270960.1\|96329_96839_-	hypothetical protein	NA	NA	NA	NA
WP_103270961.1\|96835_97444_-	hypothetical protein	NA	NA	NA	NA
WP_001082443.1\|97437_97929_-	hypothetical protein	NA	NA	NA	NA
WP_004832940.1\|97928_98483_-	hypothetical protein	NA	NA	NA	NA
WP_001283392.1\|98546_99641_-	DNA primase	A0A2H4P738	Pseudomonas_phage	1.1e-87	43.7
WP_000102026.1\|99728_101132_-	DNA helicase	L7TS87	Rhizobium_phage	1.5e-84	39.0
99700:99716	attR	NA	NA	NA	NA
WP_103270962.1\|101168_101600_-	hypothetical protein	NA	NA	NA	NA
WP_103270963.1\|101687_102419_-	hypothetical protein	L7TM14	Rhizobium_phage	2.9e-15	26.6
WP_000818856.1\|102535_103657_-	replication initiation protein	NA	NA	NA	NA
WP_103270964.1\|104667_105306_-	lysozyme	A0A075DXC6	Acinetobacter_phage	2.2e-67	63.1
WP_000138815.1\|105305_105698_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	1.1e-32	55.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP026129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13020 : 70783

Acinetobacter_phage(23.53%)

transposase,integrase

attL 12972:13031|attR 74994:76501

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
12972:13031	attL	NA	NA	NA	NA
WP_001280604.1\|13020_14346_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_001089571.1\|14519_15032_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_000447197.1\|15710_16229_+	sel1 repeat family protein	NA	NA	NA	NA
WP_000269901.1\|16787_17144_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_001140619.1\|17136_17439_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_103270968.1\|17431_17617_+	hypothetical protein	NA	NA	NA	NA
WP_103270969.1\|17653_18873_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	4.8e-79	53.2
WP_000286812.1\|19060_19288_-	hypothetical protein	NA	NA	NA	NA
WP_002072923.1\|20519_20909_-	AAA family ATPase	NA	NA	NA	NA
WP_000088946.1\|21096_21417_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000033474.1\|21693_21882_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	4.1e-14	69.6
WP_001258992.1\|21868_22156_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	7.4e-15	48.4
WP_000236586.1\|22234_22489_-	hypothetical protein	NA	NA	NA	NA
WP_004882762.1\|22439_22664_-	hypothetical protein	A0A0P0IYG9	Acinetobacter_phage	2.9e-06	46.6
WP_000568530.1\|22684_23116_-	hypothetical protein	A0A0P0IDW1	Acinetobacter_phage	2.1e-66	90.6
WP_000378524.1\|25791_26259_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	5.3e-55	70.3
WP_004882767.1\|26320_26776_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	5.5e-81	96.0
WP_000152662.1\|27437_27674_-	hypothetical protein	NA	NA	NA	NA
WP_000245257.1\|27866_28049_-	hypothetical protein	NA	NA	NA	NA
WP_004882768.1\|28115_28568_-	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	3.7e-53	66.4
WP_001169440.1\|28751_31952_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_004882769.1\|31956_34293_-	hypothetical protein	NA	NA	NA	NA
WP_004882771.1\|34279_34729_-	hypothetical protein	NA	NA	NA	NA
WP_004882773.1\|35346_35820_+	Fic family protein	NA	NA	NA	NA
WP_079281550.1\|35874_36075_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_004882775.1\|37923_38472_-	lipocalin family protein	A0A2K9L662	Tupanvirus	2.2e-23	38.9
WP_004882777.1\|38641_39415_-	NAD(+) diphosphatase	NA	NA	NA	NA
WP_004882778.1\|39799_41323_+	cryptochrome/photolyase family protein	A0A1V0S9A0	Catovirus	6.0e-47	27.8
WP_079281548.1\|41326_41470_+	DUF2256 domain-containing protein	NA	NA	NA	NA
WP_004882779.1\|41475_41730_-	TIGR03643 family protein	NA	NA	NA	NA
WP_004882780.1\|41910_43404_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_025465674.1\|45726_46899_-	replication initiation protein	NA	NA	NA	NA
WP_004882790.1\|47753_48527_+	AAA family ATPase	Q8JL10	Natrialba_phage	4.4e-14	33.3
WP_004882792.1\|48540_49452_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	2.0e-13	42.9
WP_004882794.1\|49557_49836_+	hypothetical protein	NA	NA	NA	NA
WP_004882796.1\|50189_50948_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.5e-46	42.9
WP_004882800.1\|50988_51285_+	hypothetical protein	NA	NA	NA	NA
WP_004882807.1\|53564_54635_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_004882808.1\|54652_55144_-	hypothetical protein	NA	NA	NA	NA
WP_004882810.1\|55443_56634_+	MFS transporter	NA	NA	NA	NA
WP_001067783.1\|57090_57795_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-118	84.5
WP_006582499.1\|58272_58791_+	hypothetical protein	NA	NA	NA	NA
WP_006581696.1\|58916_59633_+	molecular chaperone	NA	NA	NA	NA
WP_006581695.1\|59636_61934_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_006582498.1\|61946_62354_+	hypothetical protein	NA	NA	NA	NA
WP_004741406.1\|63860_64565_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	4.2e-120	85.3
WP_004642278.1\|65782_65944_+	hypothetical protein	NA	NA	NA	NA
WP_004882738.1\|65996_68846_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	1.2e-128	41.1
WP_099143681.1\|69393_69702_+	hypothetical protein	NA	NA	NA	NA
WP_004882735.1\|69850_70783_-\|transposase	IS5-like element ISAba13 family transposase	A0A1V0E8E1	Vibrio_phage	7.6e-61	42.5
74994:76501	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP026125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP026128

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP026129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection