CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP026281	Klebsiella oxytoca strain KONIH2 plasmid pKOR-01e8, complete sequence	0 crisprs	RT,csa3	0	11
NZ_CP026285	Klebsiella oxytoca strain KONIH2 chromosome, complete genome	4 crisprs	RT,csa3,DEDDh,DinG,cas3,cas14j,WYL	1	14
NZ_CP026283	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence	1 crisprs	RT,csa3	0	1
NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	2 crisprs	NA	3	0
NZ_CP026278	Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence	1 crisprs	DEDDh	1	2
NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	0 crisprs	WYL,csa3	0	7
NZ_CP026284	Klebsiella oxytoca strain KONIH2 plasmid pKOR-5873, complete sequence	0 crisprs	NA	0	1
NZ_CP026280	Klebsiella oxytoca strain KONIH2 plasmid pKPC-55bf, complete sequence	0 crisprs	RT	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5701

unidentified_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000375812.1\|1153_1720_+	hypothetical protein	NA	NA	NA	NA
WP_000127321.1\|1724_2012_+	hypothetical protein	NA	NA	NA	NA
WP_000350011.1\|1996_3097_+	plasmid replication protein	NA	NA	NA	NA
WP_000883925.1\|4133_4568_-	hypothetical protein	NA	NA	NA	NA
WP_000946102.1\|4585_5701_-	phosphoadenosine phosphosulfate reductase family protein	H7BVI4	unidentified_phage	6.4e-46	29.1

DBSCAN-SWA_2

9342 : 15197

Wolbachia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001326179.1\|9342_10320_+	S49 family peptidase	Q9JMP1	Wolbachia_phage	7.1e-17	31.5
WP_000139698.1\|10335_11196_+	DsbA family protein	NA	NA	NA	NA
WP_000591074.1\|11229_11658_+	hypothetical protein	NA	NA	NA	NA
WP_000422768.1\|11714_12074_+	hypothetical protein	A0A076G835	Escherichia_phage	5.6e-20	49.4
WP_000919345.1\|12073_12520_+	Fe3+-siderophore ABC transporter permease	NA	NA	NA	NA
WP_000210756.1\|12516_13035_+	nitrite reductase	NA	NA	NA	NA
WP_000972663.1\|13034_13265_+	hypothetical protein	NA	NA	NA	NA
WP_001167032.1\|13251_14109_+	hypothetical protein	NA	NA	NA	NA
WP_001236377.1\|14339_14867_+	thermonuclease family protein	O64020	Bacillus_phage	1.3e-09	37.0
WP_001043047.1\|14924_15197_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	4.2e-20	59.6

DBSCAN-SWA_3

18826 : 54246

Pseudomonas_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000286591.1\|18826_19288_+	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	1.5e-46	60.5
WP_000062185.1\|19290_19788_+	hypothetical protein	NA	NA	NA	NA
WP_000434071.1\|20349_21282_+	hypothetical protein	NA	NA	NA	NA
WP_001280522.1\|21355_22819_+	AAA family ATPase	U5XGM6	Phormidium_phage	2.4e-45	38.2
WP_000277953.1\|22974_23304_+	hypothetical protein	NA	NA	NA	NA
WP_000018404.1\|23308_23701_+	hypothetical protein	NA	NA	NA	NA
WP_000757530.1\|23749_23944_+	DUF2997 domain-containing protein	NA	NA	NA	NA
WP_000245299.1\|23937_24936_+	hypothetical protein	NA	NA	NA	NA
WP_019706040.1\|24943_25780_-\|transposase	IS5-like element ISEc61 family transposase	NA	NA	NA	NA
WP_000262467.1\|26345_27140_+	APH(3')-II family aminoglycoside O-phosphotransferase	Q75ZG1	Hepacivirus	6.4e-109	74.3
WP_000349358.1\|27166_27526_+	BLMT family bleomycin binding protein	NA	NA	NA	NA
WP_019706001.1\|27688_28636_+\|transposase	IS30-like element ISAs2 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-41	35.7
WP_016809943.1\|28718_29867_+	cephalosporin-hydrolyzing class C beta-lactamase FOX-5	NA	NA	NA	NA
WP_016809944.1\|30191_31364_+	MFS transporter	NA	NA	NA	NA
WP_016809945.1\|31382_32345_+	HTH-type transcriptional regulator YidZ	NA	NA	NA	NA
WP_019706001.1\|32956_33904_+\|transposase	IS30-like element ISAs2 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-41	35.7
WP_012585400.1\|34625_34874_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_001173919.1\|35000_35576_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-46	52.7
WP_001572362.1\|35846_36869_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016808107.1\|37433_37586_+	hypothetical protein	NA	NA	NA	NA
WP_019706040.1\|37687_38524_+\|transposase	IS5-like element ISEc61 family transposase	NA	NA	NA	NA
WP_000039129.1\|38747_39095_+	hypothetical protein	NA	NA	NA	NA
WP_000988987.1\|39091_39520_+	hypothetical protein	NA	NA	NA	NA
WP_000056203.1\|39858_40077_+	hypothetical protein	NA	NA	NA	NA
WP_001256128.1\|40088_40658_+	hypothetical protein	NA	NA	NA	NA
WP_000435224.1\|40660_41206_+	hypothetical protein	NA	NA	NA	NA
WP_000268395.1\|41322_42261_+	hypothetical protein	A0A2P9HXK7	Yersinia_phage	1.5e-69	50.2
WP_001096362.1\|42695_42938_+	hypothetical protein	NA	NA	NA	NA
WP_001258027.1\|42940_43303_+	hypothetical protein	NA	NA	NA	NA
WP_000098292.1\|43295_43508_+	hypothetical protein	NA	NA	NA	NA
WP_000194038.1\|43567_44323_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.8e-59	51.0
WP_001274811.1\|44337_45879_-\|transposase	IS21-like element ISAs29 family transposase	K4I413	Acidithiobacillus_phage	4.4e-130	47.6
WP_001050849.1\|46123_47158_+	site-specific DNA-methyltransferase	H8ZMF1	Synechococcus_phage	1.0e-05	20.9
WP_000058870.1\|47171_47621_+	hypothetical protein	NA	NA	NA	NA
WP_000338945.1\|47602_47914_+	hypothetical protein	NA	NA	NA	NA
WP_001151304.1\|48087_48873_+	ParA family protein	A0A1X9IGI7	Lactococcus_phage	6.1e-11	26.4
WP_001207227.1\|48876_50058_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.4e-11	28.7
WP_000703827.1\|50106_50379_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000074431.1\|50431_51067_-	N-6 DNA methylase	NA	NA	NA	NA
WP_000939033.1\|51158_51302_-	hypothetical protein	NA	NA	NA	NA
WP_001125905.1\|51620_51998_+	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	2.2e-22	49.6
WP_000044824.1\|51990_52272_+	hypothetical protein	NA	NA	NA	NA
WP_000344151.1\|52246_52921_+	thymidylate kinase	NA	NA	NA	NA
WP_005507681.1\|52988_53420_+	hypothetical protein	NA	NA	NA	NA
WP_000348669.1\|53404_53737_+	hypothetical protein	NA	NA	NA	NA
WP_000647189.1\|53745_54246_+	hypothetical protein	I3UMJ0	Colwellia_phage	1.7e-19	43.3

DBSCAN-SWA_4

57679 : 60766

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000542259.1\|57679_57979_+	hypothetical protein	A0A0K1LLW2	Caulobacter_phage	2.1e-20	55.4
WP_000468105.1\|58070_58559_-	hypothetical protein	NA	NA	NA	NA
WP_000366821.1\|58573_60766_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	2.9e-42	29.2

DBSCAN-SWA_5

92917 : 97553

Rhizobium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000085162.1\|92917_93886_+	AAA domain-containing protein	L7TKP0	Rhizobium_phage	2.8e-29	32.6
WP_000739139.1\|93896_94805_+	hypothetical protein	NA	NA	NA	NA
WP_000987165.1\|94865_95396_+	single-stranded DNA-binding protein	A0A291LCB6	Klebsiella_phage	2.6e-42	71.8
WP_001282585.1\|95490_96480_+	phage recombination protein Bet	B5AX97	Iodobacteriophage	1.1e-52	39.6
WP_000706865.1\|96542_97553_+	YqaJ viral recombinase family protein	E0YQ48	Mycobacterium_phage	5.6e-09	28.7

DBSCAN-SWA_6

106788 : 108414

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000201432.1\|106788_108414_+	DNA cytosine methyltransferase	A0A0N9SK84	Staphylococcus_phage	1.2e-05	25.8

DBSCAN-SWA_7

114975 : 118576

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000595210.1\|114975_115827_+	hypothetical protein	A0A219UQS0	Bacillus_phage	3.6e-09	29.4
WP_001077335.1\|116284_116671_+	hypothetical protein	NA	NA	NA	NA
WP_000122923.1\|116848_118576_+	hypothetical protein	A0A0P0ZFY3	Escherichia_phage	9.9e-14	32.6

DBSCAN-SWA_8

123973 : 159491

Escherichia_phage(27.27%)

transposase,integrase

attL 136677:136736|attR 155555:156416

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022542389.1\|123973_124978_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001138073.1\|125056_128029_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1
WP_001162012.1\|128031_128589_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
WP_000845039.1\|128894_129908_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001931474.1\|130113_130980_+	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-2	A0A077SL40	Escherichia_phage	4.8e-57	44.1
WP_001261740.1\|131097_131889_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_042946310.1\|131977_133327_-	group II intron reverse transcriptase/maturase	H7BV81	unidentified_phage	5.2e-10	28.1
WP_001256774.1\|134127_135387_+	CmlA family chloramphenicol efflux MFS transporter	S4TR35	Salmonella_phage	4.8e-26	31.7
WP_000800689.1\|135511_136144_+	type B-2 chloramphenicol O-acetyltransferase CatB11	M1HKK6	Paramecium_bursaria_Chlorella_virus	7.1e-26	43.0
WP_000679427.1\|136333_136681_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|136674_137514_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
136677:136736	attL	NA	NA	NA	NA
WP_000050481.1\|137918_139460_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012579084.1\|139792_140449_+	quinolone resistance pentapeptide repeat protein QnrA1	NA	NA	NA	NA
WP_000259031.1\|140648_141488_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|141892_143434_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_002008781.1\|143699_144200_+	hypothetical protein	A0A1V0SB21	Catovirus	3.3e-10	31.7
WP_000019304.1\|144199_144769_+	trimethoprim-resistant dihydrofolate reductase DfrA19	A0A1V0SD48	Indivirus	3.5e-08	27.2
WP_048228299.1\|144779_145385_+	hypothetical protein	NA	NA	NA	NA
WP_000845039.1\|145371_146385_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_000381802.1\|146530_147064_+	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
WP_000186237.1\|147146_147779_+	type B-3 chloramphenicol O-acetyltransferase CatB3	A0A2R8FE91	Brazilian_cedratvirus	4.1e-26	41.2
WP_000679427.1\|147935_148283_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259032.1\|148276_149116_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_001389365.1\|149290_150055_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001067855.1\|150231_150936_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000052512.1\|151385_152861_+	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_000155092.1\|152916_153801_+	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|153884_154589_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_004163135.1\|154479_155439_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.7e-47	40.5
WP_000946487.1\|155540_156392_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.1e-11	27.2
WP_000376623.1\|156519_157020_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
155555:156416	attR	NA	NA	NA	NA
WP_001163403.1\|157195_157978_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-33	35.0
WP_001324342.1\|157967_159491_-\|transposase	IS21-like element IS1326 family transposase	A0A2L1IVA1	Escherichia_phage	1.2e-15	24.2

DBSCAN-SWA_9

165142 : 182687

uncultured_Caudovirales_phage(55.56%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015063453.1\|165142_166837_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
WP_000522996.1\|166875_167301_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|167328_167604_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294656.1\|167619_167985_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|168056_168512_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001114073.1\|168848_169202_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-23	50.0
WP_000783215.1\|169249_169612_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_001556710.1\|169629_171381_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_000922630.1\|171429_172719_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.5e-171	73.5
WP_000065758.1\|172731_173157_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.2e-50	70.7
WP_004118313.1\|173187_173592_-	arsenic transporter ATPase	NA	NA	NA	NA
WP_001556711.1\|173600_174173_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-83	89.0
WP_011787801.1\|175301_176792_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-224	82.2
WP_011787802.1\|176826_177681_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-67	48.6
WP_011787803.1\|177771_178104_+	conjugal transfer protein TraR	NA	NA	NA	NA
WP_011787804.1\|178221_178842_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-26	37.1
WP_011787805.1\|179011_179272_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_011918375.1\|179271_179583_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011787830.1\|179606_182687_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.2e-51	30.6

DBSCAN-SWA_10

186210 : 187722

Pseudoalteromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000811656.1\|186210_187722_+	ATP-dependent helicase	A0A2D1GN12	Pseudoalteromonas_phage	3.6e-44	30.7

DBSCAN-SWA_11

195050 : 195323

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000356489.1\|195050_195323_+	nucleotide excision repair protein	A0A2H4J3B6	uncultured_Caudovirales_phage	1.3e-08	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026285

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026285_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026285_1

3571620-3571775

Orphan

Consensus_repeat	Method
ATATCGATGCGGCTTCTTCCCGGCTCGCGCTGCGCTTAGCCGGGCTACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026285_1

>merge|NZ_CP026285|1|3571620-3571775|CRISPRCasFinder
ATATCGATGCGGCTTCTTCCCGGCTCGCGCTGCGCTTAGCCGGGCTACAGTGCGGTAGCCCGGGTAAGGCGTTACGCCGCAACCCGGGGAATGCGCCGGGATGAATATATCGATGCGGCTTCTTCCCGGCTCGCGCTGCGCTTAGCCGGGCTACAG

>NZ_CP026285|1|1|3571620-3571775|CRISPRCasFinder
ATATCGATGCGGCTTCTTCCCGGCTCGCGCTGCGCTTAGCCGGGCTACAG	TGCGGTAGCCCGGGTAAGGCGTTACGCCGCAACCCGGGGAATGCGCCGGGATGAAT
ATATCGATGCGGCTTCTTCCCGGCTCGCGCTGCGCTTAGCCGGGCTACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026285.1\|WP_032751826.1\|3569873_3570734_+\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|237888
NZ_CP026285.1\|WP_009653851.1\|3566662_3567382_+\|phosphonate-utilization-transcriptional-regulator-PhnR	unknown	unknown	gnl\|CDD\|132380
NZ_CP026285.1\|WP_025107577.1\|3570736_3571534_+\|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV	unknown	unknown	gnl\|CDD\|132299
NZ_CP026285.1\|WP_032751825.1\|3567742_3568756_+\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|237887
NZ_CP026285.1\|WP_085955001.1\|3578221_3579103_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP026285.1\|WP_032751828.1\|3577264_3578218_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|182167
NZ_CP026285.1\|WP_032751830.1\|3579274_3579583_-\|CcdB-family-protein	unknown	unknown	gnl\|CDD\|376629
NZ_CP026285.1\|WP_014227303.1\|3575796_3576738_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP026285.1\|WP_004126838.1\|3562506_3562830_-\|DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225495
NZ_CP026285.1\|WP_032751827.1\|3573442_3573745_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
NZ_CP026285.1\|WP_014227302.1\|3576761_3577055_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_014227307.1\|3568761_3569874_+\|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT	unknown	unknown	gnl\|CDD\|132302
NZ_CP026285.1\|WP_004855618.1\|3564599_3565409_-\|phosphonoacetaldehyde-hydrolase	unknown	unknown	gnl\|CDD\|184075
NZ_CP026285.1\|WP_004855601.1\|3571835_3573215_-\|carbohydrate-porin	unknown	unknown	gnl\|CDD\|367007
NZ_CP026285.1\|WP_014227312.1\|3563385_3564567_+\|purine-ribonucleoside-efflux-pump-NepI	unknown	unknown	gnl\|CDD\|182309
NZ_CP026285.1\|WP_025107572.1\|3562813_3563173_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368831
NZ_CP026285.1\|WP_014227304.1\|3575190_3575502_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP026285.1\|WP_014227305.1\|3573853_3575179_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP026285.1\|WP_032751832.1\|3579585_3579822_-\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	unknown	unknown	gnl\|CDD\|377822
NZ_CP026285.1\|WP_032752001.1\|3565418_3566522_-\|2-aminoethylphosphonate--pyruvate-transaminase	unknown	unknown	gnl\|CDD\|184076

Protein	Function_ID	Function_description	E-value
NZ_CP026285.1\|WP_032751826.1\|3569873_3570734_+\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	gnl\|CDD\|237888	PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional.	2.44494e-128
NZ_CP026285.1\|WP_009653851.1\|3566662_3567382_+\|phosphonate-utilization-transcriptional-regulator-PhnR	gnl\|CDD\|132380	TIGR03337, phnR, phosphonate utilization transcriptional regulator PhnR. This family of proteins are members of the GntR family (pfam00392) containing an N-terminal helix-turn-helix (HTH) motif. This clade is found adjacent to or inside of operons for the degradation of 2-aminoethylphosphonate (AEP) in Salmonella, Vibrio Aeromonas hydrophila, Hahella chejuensis and Psychromonas ingrahamii. [Regulatory functions, DNA interactions].	5.38128e-134
NZ_CP026285.1\|WP_025107577.1\|3570736_3571534_+\|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV	gnl\|CDD\|132299	TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport system, membrane component PhnV. This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.	9.18903e-111
NZ_CP026285.1\|WP_032751825.1\|3567742_3568756_+\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|237887	PRK15046, PRK15046, 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional.	0
NZ_CP026285.1\|WP_085955001.1\|3578221_3579103_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.23548e-50
NZ_CP026285.1\|WP_032751828.1\|3577264_3578218_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|182167	PRK09956, PRK09956, ISNCY family transposase.	5.8361e-146
NZ_CP026285.1\|WP_032751830.1\|3579274_3579583_-\|CcdB-family-protein	gnl\|CDD\|376629	pfam01845, CcdB, CcdB protein.	6.2123e-41
NZ_CP026285.1\|WP_014227303.1\|3575796_3576738_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	3.0148e-47
NZ_CP026285.1\|WP_004126838.1\|3562506_3562830_-\|DNA-binding-transcriptional-regulator	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	6.45095e-48
NZ_CP026285.1\|WP_032751827.1\|3573442_3573745_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	3.76101e-33
NZ_CP026285.1\|WP_032751832.1\|3579585_3579822_-\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	gnl\|CDD\|377822	pfam07362, CcdA, Post-segregation antitoxin CcdA. This family consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein.	7.39215e-22
NZ_CP026285.1\|WP_014227307.1\|3568761_3569874_+\|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT	gnl\|CDD\|132302	TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.	0
NZ_CP026285.1\|WP_004855618.1\|3564599_3565409_-\|phosphonoacetaldehyde-hydrolase	gnl\|CDD\|184075	PRK13478, PRK13478, phosphonoacetaldehyde hydrolase; Provisional.	4.38669e-164
NZ_CP026285.1\|WP_004855601.1\|3571835_3573215_-\|carbohydrate-porin	gnl\|CDD\|367007	pfam02264, LamB, LamB porin. Maltoporin (LamB protein) forms a trimeric structure which facilitates the diffusion of maltodextrins across the outer membrane of Gram-negative bacteria. The membrane channel is formed by an antiparallel beta-barrel.	1.68046e-87
NZ_CP026285.1\|WP_014227312.1\|3563385_3564567_+\|purine-ribonucleoside-efflux-pump-NepI	gnl\|CDD\|182309	PRK10213, nepI, purine ribonucleoside efflux pump NepI.	0
NZ_CP026285.1\|WP_025107572.1\|3562813_3563173_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368831	pfam06296, RelE, RelE toxin of RelE / RelB toxin-antitoxin system. RelE is a family of Gram-negative bacterial antitoxins of the RelE/RelB toxin-antitoxin system. Its cognate antitoxin is family RelB, pfam04221.	2.23073e-48
NZ_CP026285.1\|WP_014227304.1\|3575190_3575502_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	2.86497e-40
NZ_CP026285.1\|WP_014227305.1\|3573853_3575179_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	4.94305e-135
NZ_CP026285.1\|WP_032752001.1\|3565418_3566522_-\|2-aminoethylphosphonate--pyruvate-transaminase	gnl\|CDD\|184076	PRK13479, PRK13479, 2-aminoethylphosphonate--pyruvate transaminase; Provisional.	0

>NZ_CP026285.1|WP_025107577.1|3570736_3571534_+|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV
MLIWSRKGRTAAGALAVTLFAGFFFLPLAVILMSSLSQQWNGLLPSGFTLGHFVNAFRGAAWDALFSSLMVGFCASLFALLCGMWAALSLRQYGAKLQKYLGLMFYLPSAIPSVSVGLGILVAFSQGPLQMNGTFWIVLAAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRLRHVTLPLMTPWMISALALSLSLSMGELGATVMIYPPGWTTLPVTIFSLTDRGNIADGSALTIVLVGVTLLLMIKLERIARRMSQR
>NZ_CP026285.1|WP_032751826.1|3569873_3570734_+|2-aminoethylphosphonate-ABC-transporter-permease-subunit
MSQILTLPRRSVHLRPLLWLLLPLLVLATLFFYPLLLIGEQALRDTEGHLGLETFWQVVESRRFLSALLNTLQIAVIATSGCLLLGSVLALILVFIPFPGSQLISRIIDTFIALPTFLITLAFTFIYGSAGLLNGTLMSLFAFELPPVDFLYSIQGVILAEMTVFTPLVMRPLMAGLRQIDKSQLEAASILGAHPLRVIGQVIFPAVLPALMAGGSLCLLLTTNEFGIVLFIGAKGVNTLPMMVYSKAILESDYSVACMIALINILLSLGLFMLYRLAAARTGVRS
>NZ_CP026285.1|WP_014227307.1|3568761_3569874_+|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT
MLMKTTVAPTPSLAGTSGITLDALRVSYHGNVVLKPLTLTIEPGEVLALIGPSGSGKTTVLRAIAGFVQPAGGRILLGDTDITHLPPYQRGLGMVVQNYALFPHMKVEDNVAFGLRAQKQPKAQIAERVQEALKIVGMADYASRYPHQLSGGQQQRVAIARAIAVRPRVLLLDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGIMKDGSLIAHGETHQLYHYPPNRFSAEFLGRANILQATALTDTAGPGLVSVSCGGGLIAAFSRGGQHGNNKLLCIRPQHMSLAPRSATSNRLNAILTSVHWQGDLTHLLCDVAGEAVRIVMTHVNPLPRAGDRLALYFEPNDAVLIEVS
>NZ_CP026285.1|WP_032751825.1|3567742_3568756_+|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein
MKLSRLALLSLFALTSSPVWADGIVTVYSADGLHDGDNSWYQHQFAAFTKATGIKVQYVEGGSGAIVERLAKERTNPQADVLVTVPPFIQRAAKEQLLAEFQPQDSARIPGVHDRYSPLVNNYLTFIYNSKLLKTAPASWQELLDSRFRNKLQYSTPGQAGDGTAVMLQAFHSMGSKEAGFDYLGKLQANNVGPSASTGKLTALVNKGELYIANGDLQMNLSQMARNPNVQIFWPADAQGERSALALPYTIGLVQNGPNGENGKKLINFLLDKSAQSSVSALSWGLPVRSDVTPEDANFKAAKAALNGVKSWEPNWDDVAVSLSADIARWHKVTDSE
>NZ_CP026285.1|WP_009653851.1|3566662_3567382_+|phosphonate-utilization-transcriptional-regulator-PhnR
MKSPSGETPQYLLIKAQLQARIQNGALKSGDKLPSERELCALFNTTRITVRESLAQLESSGVIYRADRRGWFVTPERLWLDPTQNTNFHKLCLEQGREPKTVLLDGRLAAVPLDVMAPLALQPFDQIYLLTRLRHADGRAICYCENHCLPARVPELLRHDLNGSLTEIYQTHYDLIYTSMHLSFWPTSMPPQAAEALGVMEGRPALLLRRLNYDQHGRILDYDIEYWRHDSLRIEVDTH
>NZ_CP026285.1|WP_032752001.1|3565418_3566522_-|2-aminoethylphosphonate--pyruvate-transaminase
MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNLGVVQVIRQRLVELATPANGYTSVLLQGSGSYAVEAVLGSAIGAQGKVLIISNGAYGARMIEMAKLMCIAHHPYDCGEVARPDAAAIERILQTDPAITHIAMVHSETTTGMLNPIEEVAALAKRYDKRYIVDAMSSFGGIPMDVAALNIDYLISSANKCIQGVPGFAFVIAREAELANCQGRSRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAEEGGVRARHQRYSTNQRRLVAGMRALGFQPLLDDSLHSPIITAFYSPDAPQYRFKDFYQRLKEQGFVIYPGKVSQSDCFRIGNIGEVYDADITALLAAIKNAMYWQC
>NZ_CP026285.1|WP_004855618.1|3564599_3565409_-|phosphonoacetaldehyde-hydrolase
MNRINAVILDWAGTTVDFGSFAPTQIFVEAFRQAFAVEITLEEARVPMGLGKWQHIEALGKLPAVDARWQAKFGRAMNAADIDAIYAAFMPLQIAKVVDFSAPIAGVVDTIAALRAEGIKIGSCSGYPRPVMEKLAPAAAAQGYAPDHWVATDDLAVGGRPGPWMALQNVIVLGIDSVAHCVKVDDSAPGITEGLNAGMWSVGLAVSGNEFGASWEEYQQMSAEEIAARREHAAGKLYAAGAHYVVDTLADLPGVIADINRRLAQGERP
>NZ_CP026285.1|WP_014227312.1|3563385_3564567_+|purine-ribonucleoside-efflux-pump-NepI
MTPSNASTPQAHQAARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAGQSVTTTAFVAMFASLFITSIIRSTDRRYVVILFSVLLTLSCLLVSFANSFALLLLGRACLGLALGGFWAMSASLTMRLVPMRVVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNGAAVMGVVCTIWVLKALPSLPGESTSAQQNMFGLLKRPGVMAGMCAIFMAFAGQFAFFTYIRPVYMTLAGFDVDGLTLVLLSFGIASFVGTSLSSMLLKRSVKAALAVAPVVLAISAAVLVLWGESKIVASTVAVIWGFAFALIPVGWSTWITRSLSDQAEKAGSIQVAVIQLANTCGAAVGGVALDHLGLLSPLVLSGTLMLLTGLLVATKVRV
>NZ_CP026285.1|WP_025107572.1|3562813_3563173_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MRVFKTKWFTREARAHAIDDGELCKAIEATLQGKADNLGGGVYKKRLNKNRDRAIILAKGAEHWFYTFLYAKQDIANIDNRELAAFRELARHYSLLSEEKMAALVKRKELVEICHDCKN
>NZ_CP026285.1|WP_004126838.1|3562506_3562830_-|DNA-binding-transcriptional-regulator
MTAKTKFKSPAFEAIHSAAAGLYSVDAIAQETMRSFDETCISRVSDFQPGEIKALRDQLNVSQPVFARYLNTSVSTVQKWESGAKRPGGLALKLLTIVQKHGLEVLA
>NZ_CP026285.1|WP_004855601.1|3571835_3573215_-|carbohydrate-porin
MKTVKMLPLTMAVVAALCPISVFAQEFTQEQIDAIVAKAVDKALAERQAKIDAAADKKVDVITNPQTTAATPDMAIPFGLKFSGYARYGAQFQTGDQKFVGVDGSYNGASAIGRLGNEGNGGEFQITKAFKSSKGAIWDINVMFDHWSDEVNLKKAYVGVTNVLESNPNAYIWAGRDFHQRPQQGINDYFWMNHDGQGAGVKNFDIGGVQFDVAGVSQVESCSPEVMADEANPSRITCTGGSGTGDNGHYALTTKTHNIKAGPIDVEVYANYGFDSKAVDSDERLDAWQGGLVLSHTNDSGVNKVILRYSDNSDNSVYNKTDDLTAIYASFEGLHKFTRQAQIEYLLAFHDYDNGKDNTDNRKNYGAIVRPMYFWNDVHSTWLEAGYQRVDYDQGGDNHGWKLTLSQNIAIGMGPEFRPMLRFYVTGGQVDNKRTAKVNGTKDEQLDSLNVGGMFEAWF
>NZ_CP026285.1|WP_032751827.1|3573442_3573745_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MIELEDAVMEIIVNAGQSRSLCFEALHCARNGNIDEARLLLNEADGYARRAHQMQTRLIEQDAGEARQQMTLIMVHAQDHLMNSLLAREFSEELIHLYQR
>NZ_CP026285.1|WP_014227305.1|3573853_3575179_-|PTS-sugar-transporter-subunit-IIC
MSSLYQSMIAAIEQSITPLAGRLGQQKYVIAIRDGFTAALPFMIIGSFMLVFIFPPFSPDTTNGFARGWLDFSQQYREQLMLPFNLSMGVMTFFISVGIGASLGRQFQLDPVMSGLLAFMAFLLVAAPYADGKISTQYLSGQGIFTALITAIYSTRVYAWLKQNNITIRLPKEVPTGVARSFEILIPVLVVIATLHPLNLFIEAQTGMILPQAIMHLLEPLVSASDSLPAILLSVLMCQIFWFAGIHGSLIVTGIMNPFWMANLSANQAALAAGAALPHVYLQGFWDHYLLIGGVGSTLPLAFLLLRSRVTHLRTIGKMGIVPSFFNINEPILFGAPIIMNPMMFIPFVFVPMINAVLAYGATRLGWLSQVVSLTPWTTPAPIGASWAANWTLSPVVMCLICMVMSAVIYLPFLRAYERSLMKTEVEKAKAAVPVAETVSQ
>NZ_CP026285.1|WP_014227304.1|3575190_3575502_-|PTS-sugar-transporter-subunit-IIB
MYKIMLCCSAGMSTSLLVRKMVDAAKERNLPVQIDAYGVSEFDMQFPQYQVVLLGPQVKYMLKNLAEKAAPLNIPVQPINAMDYGMQRGDNVLDYALSLIEAH
>NZ_CP026285.1|WP_014227303.1|3575796_3576738_+|LacI-family-transcriptional-regulator
MSTINDVSRLAGVSKATVSRVLSGSRGVKEASRQAVLQAAEALNYRPNMIAQSLLSQTTGCIGVICAQDNINQTTSYLYALEKQLSQHQMHLLLRFANSRGRVLHSLEELTCGLCDNVLIIGARFPLNIDRPDVVLIDCLESDATNSIQFDHAFAAETACNYLISQGRRQIALIHPQASGFADQVLLGYKHALEKNFLPFNRNLVFLDSHSPSVAVQELVNNATTLNFNALLVANEQQAQLVVPQLQAFNRAVPEKVMVFSLAGSLQLPGIPTIPAIEYSMDAMASQIVNWLTEKTQMLASSPLRGDLIIPNR
>NZ_CP026285.1|WP_014227302.1|3576761_3577055_-|hypothetical-protein
MKRMSFALSLAASLMFSSVATAAPLSGLKFEQQKQQIVKDVRKNCPASSALDDTQFANRVLESAENKTAVQSATRALDKNNSAAYQKAISGIQCPTP
>NZ_CP026285.1|WP_032751828.1|3577264_3578218_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MTQKGTPSTPHDAVFKQFLSHPECARDFIEIHLPASLRQLCNLQTLKLESGSFIEADLRASYSDVLWSLKTRDGDGYIYVVIEHQSTPDAHMAFRLMRYALAAMQRHLDAGHKTLPLVVPMLFYHGAKSPYPFSLCWLDEFTDTQTARRLYAAAFPLVDITVVPDDDIMQHRRVALLELIQKHIRQRDLLGLVERLAELLVKGCANDSQLKALFNYMLQCGDAPHFGEFLHEVERRVPQHKEVLMTIAERLRQEGRQEGKLEGKLEGKQEGRLEEALRIARSLLEQGFERELVQVACELTDDDLKRLQTPVAASPGR
>NZ_CP026285.1|WP_085955001.1|3578221_3579103_-|EamA-family-transporter
MLNVLIAAVLWGSSGVCAQYIMQQSQMSSPFLTMTRLLFAGLILLMLSFFHGDKIFRVLQNRKDAVSLLIFSLFGALTVQYTFLMTIEQSNAATATVLQFLSPTIIVAWFAIARKTRPSPLVLAAIATSLAGTFLLVTHGNPTTLSISPTALFWGIASAFAAAFYTTYPSTLIARYGTLPIVGWSMLLGGAMLLPFYAGQGNHFVVTGGLLLAFFYLVVIGTSLTFSLYLNGAQKIGGAKAGILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVVLIAMDSRRRVKTA
>NZ_CP026285.1|WP_032751830.1|3579274_3579583_-|CcdB-family-protein
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEEVCNLNHQLEVVKASMDFLFDGI
>NZ_CP026285.1|WP_032751832.1|3579585_3579822_-|type-II-toxin-antitoxin-system-CcdA-family-antitoxin
MPAAKRNKQNVSVTLDPGLVKQAREVGINLSLTLTTALKSEIHSLEIARWQKENAQAIDYLNNLTEENGLLSDEYRTF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026285_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026285_2

3590180-3590270

Orphan

Consensus_repeat	Method
TCCGGGCTACCCGAACGCAGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026285_2

>merge|NZ_CP026285|2|3590180-3590270|CRISPRCasFinder
TCCGGGCTACCCGAACGCAGGCGGCTGTGAAGCGGATTGAATCCCCCGGATGGCGGCTGTCGCCTTATCCGGGCTACCCGATCGCAGGCGG

>NZ_CP026285|2|2|3590180-3590270|CRISPRCasFinder
TCCGGGCTACCCGAACGCAGGCGG	CTGTGAAGCGGATTGAATCCCCCGGATGGCGGCTGTCGCCTTA
TCCGGGCTACCCGATCGCAGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026285.1\|WP_014227293.1\|3588140_3589265_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990
NZ_CP026285.1\|WP_032752002.1\|3581385_3582288_-\|N-acetylmuramic-acid-6-phosphate-etherase	unknown	unknown	gnl\|CDD\|235467
NZ_CP026285.1\|WP_025107595.1\|3595070_3595880_+\|lipoprotein-NlpA	unknown	unknown	gnl\|CDD\|182119
NZ_CP026285.1\|WP_032751838.1\|3593588_3594209_+\|phosphatase	unknown	unknown	gnl\|CDD\|226105
NZ_CP026285.1\|WP_032752004.1\|3592571_3593486_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176160
NZ_CP026285.1\|WP_025107590.1\|3589718_3590135_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP026285.1\|WP_032751836.1\|3585033_3588141_-\|multidrug-efflux-RND-transporter-permease-subunit-EefB	unknown	unknown	gnl\|CDD\|273335
NZ_CP026285.1\|WP_004855568.1\|3591078_3592575_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP026285.1\|WP_014227296.1\|3582448_3583615_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP026285.1\|WP_032751832.1\|3579585_3579822_-\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	unknown	unknown	gnl\|CDD\|377822
NZ_CP026285.1\|WP_085955001.1\|3578221_3579103_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP026285.1\|WP_032751839.1\|3594339_3594810_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|377770
NZ_CP026285.1\|WP_032751837.1\|3590350_3590998_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP026285.1\|WP_032751834.1\|3583665_3585030_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|182103
NZ_CP026285.1\|WP_032751841.1\|3596756_3597311_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP026285.1\|WP_032751830.1\|3579274_3579583_-\|CcdB-family-protein	unknown	unknown	gnl\|CDD\|376629
NZ_CP026285.1\|WP_032751845.1\|3598274_3599228_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|181818
NZ_CP026285.1\|WP_032751833.1\|3579927_3581361_-\|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|181971
NZ_CP026285.1\|WP_032751843.1\|3597480_3598260_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225130
NZ_CP026285.1\|WP_032751840.1\|3595904_3596765_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359

Protein	Function_ID	Function_description	E-value
NZ_CP026285.1\|WP_014227293.1\|3588140_3589265_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	3.38386e-112
NZ_CP026285.1\|WP_032752002.1\|3581385_3582288_-\|N-acetylmuramic-acid-6-phosphate-etherase	gnl\|CDD\|235467	PRK05441, murQ, N-acetylmuramic acid-6-phosphate etherase; Reviewed.	1.39762e-175
NZ_CP026285.1\|WP_025107595.1\|3595070_3595880_+\|lipoprotein-NlpA	gnl\|CDD\|182119	PRK09861, PRK09861, lipoprotein NlpA.	0
NZ_CP026285.1\|WP_032751838.1\|3593588_3594209_+\|phosphatase	gnl\|CDD\|226105	COG3576, COG3576, Predicted flavin-nucleotide-binding protein structurally related to pyridoxine 5'-phosphate oxidase [General function prediction only].	1.14109e-12
NZ_CP026285.1\|WP_032752004.1\|3592571_3593486_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176160	cd08471, PBP2_CrgA_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.66022e-91
NZ_CP026285.1\|WP_025107590.1\|3589718_3590135_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.06375e-10
NZ_CP026285.1\|WP_032751836.1\|3585033_3588141_-\|multidrug-efflux-RND-transporter-permease-subunit-EefB	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP026285.1\|WP_004855568.1\|3591078_3592575_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.22383e-70
NZ_CP026285.1\|WP_014227296.1\|3582448_3583615_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.76372e-84
NZ_CP026285.1\|WP_032751832.1\|3579585_3579822_-\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	gnl\|CDD\|377822	pfam07362, CcdA, Post-segregation antitoxin CcdA. This family consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein.	7.39215e-22
NZ_CP026285.1\|WP_085955001.1\|3578221_3579103_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.23548e-50
NZ_CP026285.1\|WP_032751839.1\|3594339_3594810_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|377770	pfam07080, DUF1348, Protein of unknown function (DUF1348). This family consists of several highly conserved hypothetical proteins of around 150 residues in length. The function of this family is unknown.	8.44728e-95
NZ_CP026285.1\|WP_032751837.1\|3590350_3590998_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.10609e-14
NZ_CP026285.1\|WP_032751834.1\|3583665_3585030_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|182103	PRK09837, PRK09837, Cu(I)/Ag(I) efflux RND transporter outer membrane protein.	5.53367e-100
NZ_CP026285.1\|WP_032751841.1\|3596756_3597311_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	2.11763e-36
NZ_CP026285.1\|WP_032751830.1\|3579274_3579583_-\|CcdB-family-protein	gnl\|CDD\|376629	pfam01845, CcdB, CcdB protein.	6.2123e-41
NZ_CP026285.1\|WP_032751845.1\|3598274_3599228_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|181818	PRK09393, ftrA, transcriptional activator FtrA; Provisional.	1.38791e-105
NZ_CP026285.1\|WP_032751833.1\|3579927_3581361_-\|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC	gnl\|CDD\|181971	PRK09586, murP, PTS system N-acetylmuramic acid transporter subunits EIIBC; Reviewed.	0
NZ_CP026285.1\|WP_032751843.1\|3597480_3598260_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225130	COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only].	4.24983e-17
NZ_CP026285.1\|WP_032751840.1\|3595904_3596765_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.08872e-13

>NZ_CP026285.1|WP_025107590.1|3589718_3590135_+|GNAT-family-N-acetyltransferase
MTLIITENINPADQEELLAGLREYNLRFLDPAQFGELGVYSRDDAGAMRGGLIGKRKGSWLCIDYLWVSEASRGSGLGSELMHEAENQARARGCSHVLVDTFSFQALPFYQKLGYQLQMSLPDFPHVGMQRHYLSKVL
>NZ_CP026285.1|WP_014227293.1|3588140_3589265_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MKYTLAPIAAALFLLSGCDNAQNASPQQMTQEVGVVTLHGQPVPVVSSLTGRTTASLSAEVRPQVGGIVQKRLFTEGDMVKAGQALYQIDPSSYRATFNEAAASLKQAQALVIADCQKAQRYAVLVKDNGVSRQDADDAIATCNQDKASVESKKAALESARINLNWTTVTAPIAGRIGISSVTPGALVSADQDTALATIRGLDTMYVDLTRSSVDLLRLRKQSLASNSDTLNVTLTLEDGSTYSEKGRLALTEVAVDESTGSVTLRAVFPNPQHVLLPGMFVRARIDEGIMNDAILAPQQGITRDAKGDATALVVDANNKVEQRSVETGETYGDKWLIVNGLKSGDRLIVEGTGKVAPGQQVKAAEVKNDGGNA
>NZ_CP026285.1|WP_032751836.1|3585033_3588141_-|multidrug-efflux-RND-transporter-permease-subunit-EefB
MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPAIKISATYTGASAETLENSVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPDTAQVQVQNKVQQAESRLPSEVQQSGVTVEKSQSSFLLILAVYDKNNKATSSDISDWLVSNMQDPMARIEGVGSLQVFGAEYAMRIWMDPTKLASYSLMPSDVQSAIEAQNVQVSAGKIGALPASNAQQLTATVRAQSRLQTVAQFKEIIVKSKSDGSVVRLSDVARVEMGSEDYTASANLNGHPAAGIAVMMAPGANALNTATLVKNKIAEFQRQMPQGYDIAYPKDSTEFIKISVEDVIQTLFEAIILVVCVMYLFLQNFRATLIPAVAVPVVLLGTFGVLALFGYSINTLTLFAMVLAIGLLVDDAIVVVENVERIMRDEGLPAREATEKSMGEISGALIAIALVLSAVFLPMAFFGGSTGVIYRQFSVTIISAMMLSVVVALTLTPALCGALLSHSKPHTKGFFGAFNRLWGRTEQGYQHRVVGGLRRSAMMMGAFVLICGGMALAMWKLPGSFLPTEDQGEIMVQYTLPAGATAVRTAEVRRQVTDWFLTKEKANTDVIFTVDGFSFSGSGQNAGMAFVSLKNWSERKGEENTAQAIALRATKELGSIRDATLFAMTPPSVDGLGQSNGFTFELMASGGTDRDSLMKMRSQLLAAANQSTELQSVRANDLPQMPQLQVDIDNNKAVSLGLSLSDVTDTLSSAWGGTYVNDFIDRGRVKKVYIQGESDARAVPSDLGKWFVRGSDDSMTPFSAFATTRWQYGPESLVRYNGSAAFEIQGENASGFSSGAAMDKMEALANNLPAGTTWAWSGMSLQEKLASGQAMSLYAISILVVFLCLAALYESWSVPFSVIMVIPLGLLGAALAAWMRGLSNDVYFQVALLTTIGLSSKNAILIVEFAESAVEEGYSLSRAAMRAAQTRLRPIVMTSLAFIAGVLPLAIATGAGANSRVAIGTGIIGGTLTATLLAVFFVPLFFVLVKRFFTRHRSSQE
>NZ_CP026285.1|WP_032751834.1|3583665_3585030_-|efflux-transporter-outer-membrane-subunit
MFRFTLVFVALLTAGCVSLDPHYERPAAPVPATLPGSHGEATAVVSDWQQVVNDARLKKVVNIALTSNRDVQKALADIEAARAQFGETRASLFPTLDAELSHTRSKTVASGLTSSAEADGAVSSFELDLFGKNQSLTRAARETWLASEFTAQNTRLTMIADLTTAWITLAADNSNLVLAQDTMASAENSRRIVTRQMEVGTASAGDLSDAESVYQQARASVASYRTLVAQDKNALNLLAGETVPDSLLPGTLESLGDRSITLVPAGVSSSVLLRRPDIQEAEHNLKSANADIGAARANFFPSISLTASAGVGSDSLSSLFSHGMQVWSFAPSISLPLFTGGSNLAQLRYAEAEKKGLIATYEKTIQSAFKDVADALARRETLSEQLDAQNKYVAAEQKSLNIAMKSYQAGVGDYLSVLTAQRTLWSAQATLISLQQTDLENRITLWQSLGGGAS
>NZ_CP026285.1|WP_014227296.1|3582448_3583615_-|multidrug-effflux-MFS-transporter
MSRISLSWVVVLGLLSAIGPLCTDFYLPALPEITQQLSATGTQTQLSLTAALIGLGLGQLFFGPLSDRIGRKKPLALSLLLFIFSSAMCAITYDIHMLIAWRFLQGFAGAGGSVLSRSIARDRYQGTLLTQFFALLMTVNGIAPVLSPVLGGWIITAFDWRILFWAMAAIGVVLLLLSLTVLHETLPAKSAASATRQQADAPVLKNRRFMRYCLIQAFMMAGLFSYIGSSSFVIQSEYAMSAMQFSLLFGLNGIGLIIAALIFSRLARRFSAEALLRGGQLLAVAFAAITLLFAWLPQPTLALVGLFFTVSMMSGISTVAGSEAMNAIHARQSGTASALMGTLMFVFGGIAAPLAGLGGETMLKMSFAMTLCYLAALLIGLKKPRPIA
>NZ_CP026285.1|WP_032752002.1|3581385_3582288_-|N-acetylmuramic-acid-6-phosphate-etherase
MNIDLSKLLTERRNANSANIDILTTEEMLTVINQEDQQVAHAITPYLPQIAQVVDKVAAALQAGGRLIYIGAGTSGRLGILDASECPPTFGTRPEQVVGIIAGGHKAILSAVENVEDNKAQGAMDLQNLNFSSRDVLVGLAASGRTPYVIGAMEYAHSQNAFVAIVSCNPHGEMAQLADVAITPVVGPEVVTGSTRLKAGTAQKLVLNMISTGAMIRIGKVYSNLMVDVEATNAKLIERQVSIVMEATECDRATAQSALEACDRHCKTAIVMVLADLSAADAQALLAKNNGYIRKALSHS
>NZ_CP026285.1|WP_032751833.1|3579927_3581361_-|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC
MAKINKEMIARILQHVGGAGNVAQAGNCMTRLRLTLRDESRADSAAIRQIDGVMGVIVSDEQFQVVLGPGKAQSAAEMMNALLEEAPADAPSLADVAAEKKQALKSKQTSGIQKFLAKFATIFTPLIPGFIAVGLLLGFATLAEQIFVLENAHPNATLMALIGYMKVFSKGMFTFLSILIGYNAQKAFGGSGVNGAIIAALFVLGYNPEATSGFYSGISTFFGHGIDPRGNIIGVLIAAIIGAWVERQVRRIMPANLDMILTSAVTLLIMGAITFTVIMPIGGWLFTGMSWLFLHLNGNPFGSAVLAGLFLLAVMFGVHQGFVPVYFALVDAQGFNSLFPILAMAGAGQVGAALALFWRAKHGSLLRTQIKGAIIPGFLGIGEPLIYGVTLPRMKPFITACLGGACGGFFLGLVAWLGLPVGLNTVFGPSGLVALPLMTSGSGIYAGMAVYAAGLAVSYLCGFALTWLFGSKNVDLS
>NZ_CP026285.1|WP_032751832.1|3579585_3579822_-|type-II-toxin-antitoxin-system-CcdA-family-antitoxin
MPAAKRNKQNVSVTLDPGLVKQAREVGINLSLTLTTALKSEIHSLEIARWQKENAQAIDYLNNLTEENGLLSDEYRTF
>NZ_CP026285.1|WP_032751830.1|3579274_3579583_-|CcdB-family-protein
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEEVCNLNHQLEVVKASMDFLFDGI
>NZ_CP026285.1|WP_085955001.1|3578221_3579103_-|EamA-family-transporter
MLNVLIAAVLWGSSGVCAQYIMQQSQMSSPFLTMTRLLFAGLILLMLSFFHGDKIFRVLQNRKDAVSLLIFSLFGALTVQYTFLMTIEQSNAATATVLQFLSPTIIVAWFAIARKTRPSPLVLAAIATSLAGTFLLVTHGNPTTLSISPTALFWGIASAFAAAFYTTYPSTLIARYGTLPIVGWSMLLGGAMLLPFYAGQGNHFVVTGGLLLAFFYLVVIGTSLTFSLYLNGAQKIGGAKAGILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVVLIAMDSRRRVKTA
>NZ_CP026285.1|WP_032751837.1|3590350_3590998_-|TetR/AcrR-family-transcriptional-regulator
MSAQKDNEAPRRPGRPRGQKSGSANREQLMDIALALFARHGIARISLNAIAKEAGVTPAMLHYYFSSREALVEKLVEERFMPLRSEIGQIFVAHSDDPVTAFTLLIETLAAMAEKNAWFAPLWMQEIIGEMPVLRQHMHARFGDEKYHKMLETVRRWQREGKLNPALSPELLFTTLISLVLVPFSRTHTDPRLQSVDRKMIVSHALALIGRGIGG
>NZ_CP026285.1|WP_004855568.1|3591078_3592575_+|MFS-transporter
MTSEIASQPAVPSIRLLFSALLLVMLLSALDQTIVSTALPTIVGELGGLDKLSWVVTAYILSSTIAVPLYGKFGDLFGRKIVLQVAIVLFLAGSALCGLAQNMTQLVLMRGLQGLGGGGLMVISMAAVADVIPPANRGRYQGLFGGVFGLATVIGPLIGGFLVQHASWRWIFYINLPLGLFALLVIGAVFHSSNKRSQHQIDWLGAIYLSMALLCIILFTSEGGSVRAWSDPQLWCILAFGLVGIVGFIHEERLASEPIIPLSLFRNRSFLLCSLIGFVIGMALFGSVTFLPLYLQVVKEATPTEAGLQLIPLMGGLLLTSIVSGRIISRTGKYRVFPIIGTLLGVVGMVLLTRITIHSAMWQLYLFTGVLGAGLGLVMQVLVLAVQNAMPAQMYGVATSGVTLFRSIGGSIGVALFGAVFTHVLQSNLQRLLPEGAQLPRALNPAAVQNLPAEIRLDYLDAFGSAIHAAFLMAACIMAVAFALSWLLKEAPLKTSAR
>NZ_CP026285.1|WP_032752004.1|3592571_3593486_-|LysR-family-transcriptional-regulator
MDRLSAMALLVKVAELGSMSAAARALNMPLTTVSRQIGELENTLGVRLMIRTTRKLTLTDAGVDYVAAARRILEEVENAERQAAGEYQEPKGELVLSAPTMFGRQHVLPVVTDFLARYPQIRVRLLLSDRNADLVGDHIDLAVRIGPLPDSGMVATRLGEMRIVTCAHPALLEKHGTPERPRELAALPTIRIESPMPYRGWRFNAEEAEDRLVTLQPVLSLTTPESAADAARLGAGVARLLHYQAIDGLACGELTLFLQAMEPEPAPVHLLYTSRDLAPLKLRKFIDFAAPALRQALLRIAAAV
>NZ_CP026285.1|WP_032751838.1|3593588_3594209_+|phosphatase
MPAEFLDIAMTPDVMAVQHEMGSDELWQSPHRQRRGERFGASEEAMITTRDSFYLATLSQTGWPYIQHRGGPVGFLHLLDETTLAMADFSGNRQYITTGNLRGSDRACLFLMDYPRRARLKIYATVEVVAVDADPQLLAQVAPENYRARIERIYRFHLQAFDWNCPQHITPRYTARQVAEYSRTLQQRIDELERENQRLQQLIYPK
>NZ_CP026285.1|WP_032751839.1|3594339_3594810_+|nuclear-transport-factor-2-family-protein
MTEQRPPLPPFTRESAAQKVRAAEDGWNSRDAAKVALAYTVESEWRNRSEFVHGRTQIIDFLQRKWRKEQEYRLIKELWAWSDNRIAVRFAYEWHDDSGNWFRSYGNENWEFDRHGLMQTRYACINDLPITESERLFHWPLGRRPDDHPGLSELGL
>NZ_CP026285.1|WP_025107595.1|3595070_3595880_+|lipoprotein-NlpA
MKLRLRTAAAVVLAGLLLAGCDQKGSDAKHIKVGVINGAEQDVAEVAKKVAKEKYGLDVELVGFSGSLLPNESTNAGDLDANVFQHRPFLEQDNKAHNYRLVAVGNTFVFPMAGYSRKIKSVAELKDGATIAIPNDPTNLGRALLLLQQEKLITLKAGTGLLPTAVDIIDNPHHLKIMELEGAQLPRVIDDPKVDVAIISTTYLQQTGLSPVRDGIFIEDKNSPYVNIIVTREDNKDAENVKAFIQSYQSPEVAKAAETIFNGGAVPGW
>NZ_CP026285.1|WP_032751840.1|3595904_3596765_+|EamA-family-transporter
MTRQRQADLLLIAATVIAACGWIFSREAIAGMPVFAFLGLRFFFAALLLLPFCRGLRVERQQWPRMIISGLWFALNLCLWIYSVSTTPSLGEGAFIMSLSMLFVPLTAWVMMKARPARAYWECLPIAVVGLGLLSLHMPIAFQPSQGWFLLTALVQSIWFCYTSKSAREVPLIPLTTVQLGITGIVGLGISAAVESWTQPFTLPTFGWLLASIVIATSLRFGLQMKGQKYAAVASAAIIMVLEPLLTVIAAALWYGEQLPLQKIIGGLLILVAQLWFRWRMLKPLR
>NZ_CP026285.1|WP_032751841.1|3596756_3597311_-|NUDIX-hydrolase
MKKKLTSDDLHDAEVLAHCPWFSMRKVGIDMAPGDRRDFYSIHYPRPAVGIVAMQDDKVLLIRHYRYLIDRVVWAIPSGGVDEGEDPREAALRELREETGWQAQRADEIIRYNPSYGSSDQLFITWLAHDLTWVGMDEDQDEVMETGWFTLEEIGQLIARGEMPDGLSLVPLLHLMAQRHTGLA
>NZ_CP026285.1|WP_032751843.1|3597480_3598260_+|MBL-fold-metallo-hydrolase
MKITHVRNATQLIDYAGIKFLIDPMLSAKGAWAGFAGTARSELRNPLVELPFSIETIVDVDAVIVTHTHQDHWDEAAIAAIPKTLPVYVQHEADGQLLRGQGFRDIRLLSEDSAFADVALVKTTSGQHGSDRTYAVPAMAERLGEACGVVLRHPQEKTLWLVGDTIWRDAVEADMLRLRPDVVVLNAGYAHVIGFGPIIMGKEDVLKAHFVLPEAKIVASHLEAVNHCLLSRDELRQYVADNQIAEAVSIPQDGESMVF
>NZ_CP026285.1|WP_032751845.1|3598274_3599228_+|helix-turn-helix-domain-containing-protein
MKLTEVAIVAVDGFSPFHYSVPCMLFGDTVSETKRFNLHICAERPGLLSARDGFALNASGDFSLLAQADIVVVPYWGAVNQRPPQPLLDGLVRARNNGAQIVGLCLGAFVLGYAGLLDDRRAATHWEFEQDFQRLFPQVRLDINALYVDDEGIITSAGTAAALDCCLYLIRQRFGSLVANQIARRMIVPPHREGGQAQFIAQPVPKNTRDARINGLLEYLQQHIREPHNLDSLAQVAAMSRRTLTRHFAKATGMGIADWLAAERLRRSQILLEAGDLPVGQVAEEVGYRSAVTWRQQFKARFGVSPAEWRRTFRRGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026285_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026285_3

4987892-4987987

Orphan

Consensus_repeat	Method
TTGTGCCAACAGAATGCCAACAGAGTGCCA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP026285_3

>merge|NZ_CP026285|3|4987892-4987987|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCAACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGGTTGTGCCAACAGAATGCCAACAGAGTGCCA

>NZ_CP026285|3|3|4987892-4987987|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCA	ACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGG
TTGTGCCAACAGAATGCCAACAGAGTGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026285.1\|WP_064353467.1\|4984657_4984864_-\|cell-division-inhibitor-protein	unknown	unknown	gnl\|CDD\|236900
NZ_CP026285.1\|WP_103468626.1\|4990600_4990807_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_103468623.1\|4988386_4989817_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672
NZ_CP026285.1\|WP_158656795.1\|4985104_4985734_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376179
NZ_CP026285.1\|WP_103468624.1\|4989816_4990122_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378956
NZ_CP026285.1\|WP_158656838.1\|4992259_4992568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_032748399.1\|4982006_4982711_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP026285.1\|WP_032748402.1\|4983392_4984052_-\|exodeoxyribonuclease-X	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|181186
NZ_CP026285.1\|WP_158656834.1\|4991003_4991288_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_103468628.1\|4991287_4991500_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_047684216.1\|4987050_4987272_+\|bacteriophage-CII-family-protein	unknown	unknown	gnl\|CDD\|336083
NZ_CP026285.1\|WP_004191589.1\|4986791_4987010_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP026285.1\|WP_023339053.1\|4982722_4983391_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379213
NZ_CP026285.1\|WP_021312733.1\|4986023_4986683_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP026285.1\|WP_101857254.1\|4992840_4993071_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_158656836.1\|4991812_4992172_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_103468878.1\|4992548_4992848_+\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP026285.1\|WP_103468625.1\|4990118_4990604_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_032748397.1\|4981818_4981995_-\|DUF1317-family-protein	unknown	unknown	gnl\|CDD\|284449
NZ_CP026285.1\|WP_032748404.1\|4984182_4984578_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133424

Protein	Function_ID	Function_description	E-value
NZ_CP026285.1\|WP_064353467.1\|4984657_4984864_-\|cell-division-inhibitor-protein	gnl\|CDD\|236900	PRK11354, kil, FtsZ inhibitor protein; Reviewed.	2.48375e-15
NZ_CP026285.1\|WP_103468623.1\|4988386_4989817_+\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	1.25687e-159
NZ_CP026285.1\|WP_158656795.1\|4985104_4985734_-\|hypothetical-protein	gnl\|CDD\|376179	pfam18757, Nmad5, Nucleotide modification associated domain 5. An alpha+beta fold domain associated with DNA base modifying genes in prokaryotes, and likely to be involved in modified DNA base biosynthesis.	7.07907e-48
NZ_CP026285.1\|WP_103468624.1\|4989816_4990122_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|378956	pfam12802, MarR_2, MarR family. The Mar proteins are involved in the multiple antibiotic resistance, a non-specific resistance system. The expression of the mar operon is controlled by a repressor, MarR. A large number of compounds induce transcription of the mar operon. This is thought to be due to the compound binding to MarR, and the resulting complex stops MarR binding to the DNA. With the MarR repression lost, transcription of the operon proceeds. The structure of MarR is known and shows MarR as a dimer with each subunit containing a winged-helix DNA binding motif.	0.00455833
NZ_CP026285.1\|WP_032748399.1\|4982006_4982711_-\|hypothetical-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	0.00293448
NZ_CP026285.1\|WP_032748402.1\|4983392_4984052_-\|exodeoxyribonuclease-X	gnl\|CDD\|181186	PRK07983, PRK07983, exodeoxyribonuclease X; Provisional.	9.74659e-130
NZ_CP026285.1\|WP_047684216.1\|4987050_4987272_+\|bacteriophage-CII-family-protein	gnl\|CDD\|336083	pfam05269, Phage_CII, Bacteriophage CII protein. This family consists of several phage CII regulatory proteins. CII plays a key role in the lysis-lysogeny decision in bacteriophage lambda and related phages.	1.95002e-09
NZ_CP026285.1\|WP_004191589.1\|4986791_4987010_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.00798e-11
NZ_CP026285.1\|WP_023339053.1\|4982722_4983391_-\|AAA-family-ATPase	gnl\|CDD\|379213	pfam13479, AAA_24, AAA domain. This AAA domain is found in a wide variety of presumed phage proteins.	0.000956
NZ_CP026285.1\|WP_021312733.1\|4986023_4986683_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	7.29673e-33
NZ_CP026285.1\|WP_103468878.1\|4992548_4992848_+\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	2.37199e-11
NZ_CP026285.1\|WP_032748397.1\|4981818_4981995_-\|DUF1317-family-protein	gnl\|CDD\|284449	pfam07026, DUF1317, Protein of unknown function (DUF1317). This family consists of several hypothetical bacterial and phage proteins of around 60 residues in length. The function of this family is unknown.	1.19358e-14
NZ_CP026285.1\|WP_032748404.1\|4984182_4984578_-\|hypothetical-protein	gnl\|CDD\|133424	cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0.0072991

>NZ_CP026285.1|WP_047684216.1|4987050_4987272_+|bacteriophage-CII-family-protein
MESSTTRNKVEARRIESWLHSQIAELGTTNIAKVAGVNKSTVSRWRESLLPNMSLLLAILISNRTGEKGGFEA
>NZ_CP026285.1|WP_004191589.1|4986791_4987010_+|helix-turn-helix-transcriptional-regulator
MNNLSKIRRRAGLTQRQIATELNLTAGAICHYENGKRDLSIEQCRKIVAALNKYGACVSIDDVFPPSKASAA
>NZ_CP026285.1|WP_021312733.1|4986023_4986683_-|helix-turn-helix-domain-containing-protein
MSMKWYDLAKSLMKTKGINQEELAEHLGITKGAVSHWLNARREPSLEDIAKILRFLGKNNFSVGAGGMIIDENIKGDVEYVGPYKRGNEYPVLSSVQAGSWREAIEPYSIKDVDLWLESNAHIQGEAFWLLVEGDSMTSPVGLSIPEGTYVLFDTGREPVNGSLVIAKLSESNEATFKKLIIDGGQKYLKGLNPQWPLVPVNGNCRIIGVAVETKLRLI
>NZ_CP026285.1|WP_158656795.1|4985104_4985734_-|hypothetical-protein
MTSVRLTNALREQIAKNALAKSGVIDAIESLDLKRQEVARDARIAAFGGKEKADKVDKQYEKLEKLEAELRSAGASLHISGNPQSSINIAISGRRLGWCSYGRNAEGKEIFLVTPNRELCLFGAEHEITKRFDSIIDEEQKLNSRKKEIEATVWAALKSVTTLSRLVEVWPESKELIPENVDSAKVALPALKIEDLNRLIGLPTELVEG
>NZ_CP026285.1|WP_064353467.1|4984657_4984864_-|cell-division-inhibitor-protein
MVSHHYGTQTVNRGAVLPGMLVKHRESTWTASANKRGRLYLHRGIERTYTTDLLVEVYLNGLGQGLRR
>NZ_CP026285.1|WP_032748404.1|4984182_4984578_-|hypothetical-protein
MQPLPRLTSERLASLPAGTRLKMGGHIVKLIGRGSFTNAAGITQNMVDYVDSRGVPGSFEEKIFLSTATEHLNAVQCEHCFALRHPKDCVVRSITNYMTTRQAHFCDDKGCAEKYFIKHPGRQKSGRRTKW
>NZ_CP026285.1|WP_032748402.1|4983392_4984052_-|exodeoxyribonuclease-X
MLRVIDTETTSLEGSVLEIASVDIVDGVICNPMSDFVKPTEAISFEAMAIHHITEDMVADAPLISEVIGRYLGADAYVAHNAKFDKSKLPQIDAPWICTLKLARIQYPEFESHGNQYMRYRLGLKPELPEGLYAHRALYDCYVTAELLLYMGRLAKWTMGEMRTISNSPSLMKAIRFGKHKGLSFEEIAKVDPGYLRWLSSNSDDEDILFTIKHWLKGA
>NZ_CP026285.1|WP_023339053.1|4982722_4983391_-|AAA-family-ATPase
MGTPVLILGDSGAGKSYSLRNFTPDEVILLQCIPKMLPFRATGWKLNGKELPDGSVQRGNIIRFDAWDAVLDSINRMVLSKTRRVLVIDDFQVVMQHENMMRAYQTGYQKFTEMADHVWQIIMAATRLPDDFRVYFLAHTEESDGKIRMKTTGKMLNEKLTPEGYFSIVLRAIKKDGKHVFLIKGDDNDTAKAPPDLFPGLTEMDNDLKAVDVAITEFMTEL
>NZ_CP026285.1|WP_032748399.1|4982006_4982711_-|hypothetical-protein
MNQPMSFIWNTEAATLAKKAGATGGISETGAYEGFITSAIYTFGKDGSQSQALELSLDSDGAKANYLRINYIGKDGQQTFGMGLISALLWAAQIKSAQPEQVQTENGVEWHCPALIGKKVGLFLQKVLYTKGDGTDGYKFEVRHIFQPGSRRTYAEYSENEAATAIAALEKSMKDKDDRVQGNPQFSGGGRQQAGANPYAQNPNAVPHSRLQQAASQHAQNIQNPPDFDDDIPF
>NZ_CP026285.1|WP_032748397.1|4981818_4981995_-|DUF1317-family-protein
MKHAQDDIRVGAVRLPFLKEVKGWLMPWGEVISNPLKAQRMAEELDTNEELDTKRGAQ
>NZ_CP026285.1|WP_103468623.1|4988386_4989817_+|AAA-family-ATPase
MTSDFMTPPHSIEAEQSVLGGLLLDDDSSERTQKVLSILKPESFYSRQHQVIFAEMRQMYRDHKPVDLLTLFDALESKGLTETVGGFAYLAEMSKNTPSAANIVAYAMRVRETAMERYGIEKTTKAIELLYARNGMTAEQKFDAIQGLFTEITEHVKTGRRTGLRTFYDAVNDWSNEFDDRMKPDGRSRGLSTGIRSLDELLGVKRIVRGSLFVIGARPKMGKTTLYTQMGVNCATVENEPALMFSLEMPEGQMVEKITAQKGRISPNLFYPDMTKDDYGYRGDWNSDLQKATGVMGALIETNNLLIDDTPGVSLAHVMAESRRIKRERGKVGMILVDYLTLMTADKAERNDLAYGLITKGLKILAKELDCVVVLLTQLNRDLEKRTNKRPLPSDSRDTGQIEQDCDYWLAIYREGAYDVNANQSDTELLLRLNRHGETGVVYCEQRHGAIYDCDQEAASQRRREKEEKPTKRGGF
>NZ_CP026285.1|WP_103468624.1|4989816_4990122_+|MarR-family-transcriptional-regulator
MKKNSGKQAVINYIGQHPGCNFQDIRRGTGLDQSVVNSALWQMNRDGRVKREGECRSYRYSLADKTTVTESTSADFQFSNRHCGANRLTNLFNQCLAGVRK
>NZ_CP026285.1|WP_103468625.1|4990118_4990604_+|hypothetical-protein
MNIETVNELIQSLESAGELSIKEQKYLELARAFKQLAAENVGLKAAFEQPQAYLSWHAIPPTWNDPLPCGEYLDVHDTDGHKNSDGTDCWPVYAKPEIETPATDRIVAGIKADGVEEFAELTDKVADEEEFYDNGESAEYLKYTAKQARLFAKQLREGADK
>NZ_CP026285.1|WP_103468626.1|4990600_4990807_+|hypothetical-protein
MSNRIPNFGWNRLKLAALTYEQLAQLEEQVKAEHACKNGIHLFDKAGQRKLDALSWAIYNKQKAERAA
>NZ_CP026285.1|WP_158656834.1|4991003_4991288_+|hypothetical-protein
MEAYWKVQCRGITDHCEVLQARIAELEPRTVKLPDDAEHDIMAPVAAYLSEKFKWDGSAARWDGRNEYDVLADRVKYALRMVIRRAAGIKVEVE
>NZ_CP026285.1|WP_103468628.1|4991287_4991500_+|hypothetical-protein
MAITEGFCADLYCDCDGCLSGKIYPQGKADFIGRNMTDISQQARKAGWRISKDRQRCYAPGHKISRGANQ
>NZ_CP026285.1|WP_158656836.1|4991812_4992172_+|hypothetical-protein
MLAYADSYRDMAKQGVQSVPIWSVITDLERNIAPLYRHAQQPVVPDYPETLPCPVLLELGLRFGKGVKTRLVLDAIQRRAEHSAELEAMTPEERAEYDAGIEEFKAMLPQPAQPAQPAR
>NZ_CP026285.1|WP_158656838.1|4992259_4992568_-|hypothetical-protein
MQQLNRIRDALLCSGNYWRAVSLATRTARDTHFTDNPPSITAPFAVMNALNSHNAFIVGWFAVIIFRLSLEHGGAAGVIIAKYSRLQYIDSLRWRVRVFVES
>NZ_CP026285.1|WP_103468878.1|4992548_4992848_+|DUF551-domain-containing-protein
MRLSCCKGSSGNVADNSGSDGPLAGRMKSPVIPDAWIPVSERMPDDSSDVLCTAEFDGPGDWRRKVGYWHEGKWVVYGASWMPTHWMPLPAAPQEVKGE
>NZ_CP026285.1|WP_101857254.1|4992840_4993071_+|hypothetical-protein
MNKVELLQKISALATECHALACELDIGDERTEMFEIYGVLHNLGRRGYASQVGQRMNPLLASCDDDDDDNWDEDDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026285_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026285_4

5304781-5304875

Orphan

Consensus_repeat	Method
TGCGGGGCGCAGCAAGTACAAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026285_4

>merge|NZ_CP026285|4|5304781-5304875|CRISPRCasFinder
TGCGGGGCGCAGCAAGTACAAAAAATGAGCAGAACTACTGGGCGCAATAGTGGTTAAAAAATGACCTTGTTGCGGGGCGCAACAAGTACAAAAAA

>NZ_CP026285|4|4|5304781-5304875|CRISPRCasFinder
TGCGGGGCGCAGCAAGTACAAAAAA	TGAGCAGAACTACTGGGCGCAATAGTGGTTAAAAAATGACCTTGT
TGCGGGGCGCAACAAGTACAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026285.1\|WP_032676558.1\|5312397_5313057_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213202
NZ_CP026285.1\|WP_000818555.1\|5305078_5305801_+\|TIGR03761-family-integrating-conjugative-element-protein	unknown	unknown	gnl\|CDD\|274771
NZ_CP026285.1\|WP_032676546.1\|5301524_5301779_+\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|182903
NZ_CP026285.1\|WP_032676545.1\|5299816_5301532_+\|ATP-synthase	unknown	unknown	gnl\|CDD\|213858
NZ_CP026285.1\|WP_000155614.1\|5310090_5310339_+\|DUF2442-domain-containing-protein	unknown	unknown	gnl\|CDD\|378424
NZ_CP026285.1\|WP_032676549.1\|5303504_5304737_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379352
NZ_CP026285.1\|WP_032676553.1\|5309237_5309786_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP026285.1\|WP_032676556.1\|5310647_5311526_-\|metal-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238557
NZ_CP026285.1\|WP_032692858.1\|5297129_5297336_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|372675
NZ_CP026285.1\|WP_031617517.1\|5297571_5298456_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP026285.1\|WP_032676552.1\|5309016_5309220_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_000077899.1\|5302599_5303196_+\|DUF2857-domain-containing-protein	unknown	unknown	gnl\|CDD\|378591
NZ_CP026285.1\|WP_032676697.1\|5301771_5302515_+\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP026285.1\|WP_032676551.1\|5308452_5308944_+\|DUF3577-domain-containing-protein	unknown	unknown	gnl\|CDD\|371899
NZ_CP026285.1\|WP_032676550.1\|5305814_5307824_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP026285.1\|WP_001178480.1\|5303195_5303426_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_032676543.1\|5298452_5299820_+\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP026285.1\|WP_032692859.1\|5296665_5297127_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026285.1\|WP_032676557.1\|5311528_5312401_-\|metal-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224033
NZ_CP026285.1\|WP_001144085.1\|5309864_5310107_+\|DUF4160-domain-containing-protein	unknown	unknown	gnl\|CDD\|379344

Protein	Function_ID	Function_description	E-value
NZ_CP026285.1\|WP_032676546.1\|5301524_5301779_+\|conjugal-transfer-protein-TraR	gnl\|CDD\|182903	PRK11019, PRK11019, DksA/TraR family C4-type zinc finger protein.	6.84688e-10
NZ_CP026285.1\|WP_000818555.1\|5305078_5305801_+\|TIGR03761-family-integrating-conjugative-element-protein	gnl\|CDD\|274771	TIGR03761, ICE_PFL4669, integrating conjugative element protein, PFL_4669 family. Members of this protein family, such as PFL4669, are found in integrating conjugative elements (ICE) of the PFGI-1 class as in Pseudomonas fluorescens.	3.82803e-85
NZ_CP026285.1\|WP_032676550.1\|5305814_5307824_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP026285.1\|WP_032676545.1\|5299816_5301532_+\|ATP-synthase	gnl\|CDD\|213858	TIGR03764, ICE_PFGI_1_parB, integrating conjugative element, PFGI_1 class, ParB family protein. Members of this protein family carry the ParB-type nuclease domain and are found in integrating conjugative elements (ICE) in the same class as PFGI-1 of Pseudomonas fluorescens Pf-5.	2.07497e-149
NZ_CP026285.1\|WP_000155614.1\|5310090_5310339_+\|DUF2442-domain-containing-protein	gnl\|CDD\|378424	pfam10387, DUF2442, Protein of unknown function (DUF2442). This family of bacterial and fungal proteins has several members annotated as being putative molybdopterin-guanine dinucleotide biosynthesis protein A; however this could not be verified. Hence the function is not known. This family also includes the DUF3532 that was found to be related and was merged into this family. Members of this family also fall into the NE0471 N-terminal domain-like superfamily, a family of proteins with a unique fold in SCOP:143880.	2.36359e-20
NZ_CP026285.1\|WP_032676549.1\|5303504_5304737_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	3.67398e-06
NZ_CP026285.1\|WP_032676553.1\|5309237_5309786_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.10147e-96
NZ_CP026285.1\|WP_032676556.1\|5310647_5311526_-\|metal-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238557	cd01137, PsaA, Metal binding protein PsaA. These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	7.54734e-125
NZ_CP026285.1\|WP_032692858.1\|5297129_5297336_+\|transcriptional-regulator	gnl\|CDD\|372675	pfam13693, HTH_35, Winged helix-turn-helix DNA-binding.	2.16482e-32
NZ_CP026285.1\|WP_031617517.1\|5297571_5298456_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	4.10444e-22
NZ_CP026285.1\|WP_000077899.1\|5302599_5303196_+\|DUF2857-domain-containing-protein	gnl\|CDD\|378591	pfam11198, DUF2857, Protein of unknown function (DUF2857). This is a bacterial family of uncharacterized proteins.	7.68619e-67
NZ_CP026285.1\|WP_032676697.1\|5301771_5302515_+\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	5.60735e-11
NZ_CP026285.1\|WP_032676551.1\|5308452_5308944_+\|DUF3577-domain-containing-protein	gnl\|CDD\|371899	pfam12101, DUF3577, Protein of unknown function (DUF3577). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 143 to 307 amino acids in length.	1.24493e-62
NZ_CP026285.1\|WP_032676543.1\|5298452_5299820_+\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP026285.1\|WP_032676558.1\|5312397_5313057_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213202	cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.	4.83126e-72
NZ_CP026285.1\|WP_032676557.1\|5311528_5312401_-\|metal-ABC-transporter-permease	gnl\|CDD\|224033	COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism].	2.92326e-47
NZ_CP026285.1\|WP_001144085.1\|5309864_5310107_+\|DUF4160-domain-containing-protein	gnl\|CDD\|379344	pfam13711, DUF4160, Domain of unknown function (DUF4160).	2.05304e-15

>NZ_CP026285.1|WP_032676549.1|5303504_5304737_+|helix-turn-helix-domain-containing-protein
MTIPADSIVAHTLSRMQRSLERRTDTGDVGQERSGLLFMGNVHDAFPRQLFLDTRLSPLDKTAWVMIRLYAQQNEGAVFPTYDELQVQLASAHSEKASRDTVSRVLLMLRLTGWLSLCKRVRDDHGRVRGNIYAQHDEPLGYRDAETFDPGWLTLVEESCLSRNKAVRMTALAVVNDILHDPGMRHRHSRLAIIESRLSAPATPEQMARQRQAVQSSPKSGLSKKRIKNSPNSLSPENGLSSLKPDNSQSPENGLSKKSRSYAGVRNSDCNVRSFTHSVNKKTYVPCGEQFLPDDFLNALNSEDRQMLSTQMASLPETMAKALADMLREQQALGRLNNPVGWMFSMLRRARSGELKISEDTATASSGGTISRPVESRTVPTADVPVQPAKRPSQGQVRAMIAAIRQQVQK
>NZ_CP026285.1|WP_001178480.1|5303195_5303426_+|hypothetical-protein
MQMTDFSSRQYVSPSVRRRAQRLFSAVCCGEKVFRRLTMNGYLKIDVGPFWRILSKDGGKHWWLMDHETYNREIRR
>NZ_CP026285.1|WP_000077899.1|5302599_5303196_+|DUF2857-domain-containing-protein
MSQHNLSQATTAILSSLLMDVKNGNIRRCESLGMSLEEIRALSQLSLDELHYLSQSHVSVLDVSLNHENFWLMLNQARNEQKRMLMIDRALELGGSMELIDKYFGLSPSEVSARRRLMGIESRQGRTQSLTEPQDSALWIEWKAAGLSSPDSHQALEAMMLAAEQHGLSLTAVWSRVCQWCRETTPSRKSESQQRKEA
>NZ_CP026285.1|WP_032676697.1|5301771_5302515_+|DUF2786-domain-containing-protein
MSENTKVIARIRRLMALGTRNSNPHEAARAVALAQRLMQRHGLTPDMLSLHDIQESVCQNLTSNAEKVPAWLSSLATVVCMATGCRCWFGWHIHTSCSGVKSVRRSLHFYGFSGRAEVALYIYTVLQRQLRADTDGQIAGYRKRRILKNTLRRRADQFREGWVSGVWQVLQSFAPSECENSMLQRWLAQRHTGDTLGTVNVRAAGKCRGDRAARVAGWLAGRDTEVHQGLTGAKAQQQITAGGCTHE
>NZ_CP026285.1|WP_032676546.1|5301524_5301779_+|conjugal-transfer-protein-TraR
MSEDLNDEMAQASTAIFTQRGIDAVRAKVHSLRPSKEICECCGADIPAARQLAVPGVELCAACQDVKEKQDVHRAAGCRGLHHV
>NZ_CP026285.1|WP_032676545.1|5299816_5301532_+|ATP-synthase
MSNVRSLNLGDAMLQRGKSPAQAADNNTPTVTQPVNEMAMVLTLDQLRPNPDNPRKGRNPRFEEIKASVRARGLDSIPKVTRDPDGDDVYIFSDGGNTRYQILCDLWQETGDERFYRVHTIFKPWPGRLKCLVGHLAENEVRGDLTYIEKAFGVHKARVIYEEQLGRSVTLRELSDLLGKEGYPIDNSSVSRMEDTLNYLYPHMPQLLESGMSRGQATPLLSLRSSAMKVWKSFSGDVNPECSLDDVFGAVCRCFDEPESYALDIFRDEFIGQLVKALPHPSLNYDRWLIELDPREQKRREQFGEPPPLPAPTPASEQSGGRERTSPPITTLPADTSSQPPVTGLRSGTLTTPGRPEAVPELQDNTALPGGMSVGSEPRREVQNDLFGGNPVITGQTENPDNDGEWQFKSDVNANSLVSAFGEQDETSTPSVSSVAFAATGLEPVNDIWHISALQDDIEHLQDMAYRLTFEIAEAMGCADCVREDKDHHSAGFSISENASEFTLFLAGLSGSLPNKQFNMFMFCLNFFGSQEPADTAVFDDVTVVKTMRLIRVIRRLRELQRLVVKGGENV
>NZ_CP026285.1|WP_032676543.1|5298452_5299820_+|replicative-DNA-helicase
MTSNNRRNVSGLFSQDAEQSVIGGLMLDNDCWDEVALRLDSDDFYFKVHQVIFHEMTRLVAAGRPIDLITLAESIENRGKDALEQLGGFAYLAELSKNTPSAANIVAYCDIVARYSQGRQLVAIGAEITETVKASGADIGAVMETAEQKITRLAERSEPQQAVTLLDGMEKLLTELERRCNVPDGITGTPTGFEDFDAMTSGLQAADLILIAARPSMGKTAFLISLILNSLLKKADTHAQFYSLEQPTEQILMRMVASLGSVDLTHLKNGQMDDEEWARVSNASSLLMGDLKDRLIIDDTGSLTPAMLRIRARRNARRYGHPSVIGLDYLQLMRCPDQENRTQEIAEISRSLKALAKEMGCPVVALSQLNRQLESRADKRPNNGDLRDSGALEQDADVIVFIYRDEVYHENTEDKGVAEIIVSKQRQGPIGTIRLQYEGRYTRFSANPGHTGRFA
>NZ_CP026285.1|WP_031617517.1|5297571_5298456_+|ParA-family-protein
MGVKPRIIPVVSTKGGEGKSTQSANLAGFLADAGIKTLLIDGDHAQPTASSIFPLEYEAPGGLYELLMQTVDLSNPDNLISRTSINNLDIIVSNDPRNFLPTAMLNAPDGRVRLRNALSHPLFNSYGVIIVDSQGSRSVMSELIILASTGTMVGIAKPILPDVREFMRGTVALMEELLPYCAFGIQLPVTKLLINCMEYDNLSVETLAEVKAIVEDKRYSAHADKIHIDLLETCIYDLTVYVLGHVKGVPVHRLEKNTRRKSDSAFTSMYQLACELFPEWKTNFDALANAGGEE
>NZ_CP026285.1|WP_032692858.1|5297129_5297336_+|transcriptional-regulator
MMKPEWHSADIIAALKKRGTSLSAVSRKSGLASSTLTNALIRHWPKGERLIAEALGVAPEKIWPSCYN
>NZ_CP026285.1|WP_032692859.1|5296665_5297127_+|hypothetical-protein
MATTLIQTHPLLSVHFNAATDFTVLADHCENFAETLIENDDPTLKMALCGRLNAALTLLQPTLLEPVPPHLVESLTVDTLPANSPEFGPECTELCRYCLALTQTLAEQGFSSEKEKQLSYLLYDLINYFAAEMKAPRWLRTVDGVKFIDGEAA
>NZ_CP026285.1|WP_000818555.1|5305078_5305801_+|TIGR03761-family-integrating-conjugative-element-protein
MAEKNEKRTGALQSEMTIALHTNYAIGLWQGRQPEKQDGEKPARHGIIGMPQFFHRATLINQDSLRNNPWADVAMFNLEEKIKVASDSMTALIQQLDAEMSMLPPGITLTEVASVEPLDIQVFTRTPLGYRCVFLLVGFDQFAKKALQASHYGLITRSRRDHHLSEGGRLIRQVYGSVLSYRRIDATRFDAVENNETWKQACEVAGEPDLSVLLGEKRSAFSPPVNESSVNLLRMRYRAA
>NZ_CP026285.1|WP_032676550.1|5305814_5307824_+|DNA-topoisomerase-III
MRLFICEKPSQGRDLANVLGATRRGDGFLTGPGVTVTWAVGHLLETAPPEAYGQQYGKPWSLSALPILPSPWQVVVKKETQSQFKVIERLLRQVDDVVISTDADREGEVIARELLEYCRWDGPVQRLWLSALDEMSIRAALQDLRPGAETLGMYHAGLGRARADWLIGMNLSRLYTLLAVQSGFDGVISVGRVQTPTLALVVRRDREIATFIPKPFWQVKALLSAGGRTFPAQWVPAKVYTDEEKRCVHQNIAQQVAHLCRQAGAATVTECETKREKAAAPLAFSLGTLQQACGLLWDMSPQQVLDTAQSLYEKHKATTYPRTDCGYLPESMREEIPSVLSAIGLSDPECSSLLSGLNTSFVSRIWNDKKITAHHGIIPTRNAFKFSALSEAERRVYTLIRRNYLAQFLPLHESDITRLQFDIGGQLFRTTGRTEIVMGWKVLFSKEEEDSPGDDDLSIELPPLRKGDRCGVNGAEVVQQMTRPPAHYTFATLIGAMMNASAFVTDIALRKVLKDNAGLGTEATRAGIVEQLLNRRFIVRKGKQLRATDLGADVIDALPSQLTDPGMTALWEQALDEVAEGRLTLNDFLQRQVGWTRNLVSMGGQQRVSIRIPPTPSCPLCGGKTRLKKGQKGDFWGCTRYPDCKGIINNDTQKRKSARSSKAVKPKNN
>NZ_CP026285.1|WP_032676551.1|5308452_5308944_+|DUF3577-domain-containing-protein
MTATTTASSSTTSSSASQKKEYFNLNVSGIGYLSSIRRVQGQNGEFTCAVINALTGPTDNASYTRFDVTVAGPEATKLINRCQKAVDEEEKVLLGFVLSGLKADVFTLQSGEHSGESRPSLKARLIKVEFIKKGQEVVYTAPNASQTPEQGSAAPKDYDPNSF
>NZ_CP026285.1|WP_032676552.1|5309016_5309220_+|hypothetical-protein
MGNPFGLLASEAGYQLQIQVLSSQRGFYIGTANEMGPVSRESVEYYKTSLQADIALEKGEWTQREYD
>NZ_CP026285.1|WP_032676553.1|5309237_5309786_+|single-stranded-DNA-binding-protein
MASRGINKVILVGHLGQDPEVRYMPNSTAVTGFSIATSESWRDKQSGEMKENTEWHRVVLFGKLAEIAGEYLKKGSQVYIEGHLRTRKWTDNGGVERWTTEVVVGVNGTMQMLGSRNAPAGTGNAQQPGSAQGGWGQPQQPQPQQSAAPHNPANEPPMDFDDDIPFLGHGYGICRKAIYAIS
>NZ_CP026285.1|WP_001144085.1|5309864_5310107_+|DUF4160-domain-containing-protein
MPVILRINGFKFFFYSNEGNPLEPAHIHVRNADGEAKFWLEDEVKLSRNDGFDARTLKELTKMVQHNQTMFVEAWNDYFS
>NZ_CP026285.1|WP_000155614.1|5310090_5310339_+|DUF2442-domain-containing-protein
MTISAKNVRFDETTMWVELNDGRVMGVPIAWFPRLLNATDKERNDYELSKRGIHWDNLDEDISVDGLLAGRGDVTHVPHRVA
>NZ_CP026285.1|WP_032676556.1|5310647_5311526_-|metal-ABC-transporter-substrate-binding-protein
MKRTALFLALSMGFMAHSASAKTINVVTSFSILGDMVQQVGGEHVSVKALVGPDGDPHTFEPSPQDSAAIASADIVVVNGLGLEGRLDRLIKASGFKGTLIVASEGVKTHTMDEDGETVVDPHAWNSAANGAQYAQNIVNGLISADPEDKEALRKSGEDYIAQLKALDDWAKNRFSGIPEAKRIVLTSHDTFGYFSRAYNVRFLSAQGLSSESEASAKDVAELIEQIKADHVTTWFMENQLDPRLVKQIARATGAKPGGELYPEALSPKGGPADTYTKAFRHNVDTIADSMK
>NZ_CP026285.1|WP_032676557.1|5311528_5312401_-|metal-ABC-transporter-permease
MTLHFLIQPFIEYGFMRRALVACLALSLSTTTLGVFLFLRRMSLVGDALSHAILPGVAIGYLLSGMSLFAMATGGFIAGIVVALVAGWVSRQTPLKEDASFAGLYLGSLALGVTLVSLHGSSVDLLHLLFGSILAVDRASLIFVAAVATLTLLSLAVCYRGLVSEVFDSTWLEVNKKRLPTLFHTLFLGLLVLNLVAGFQVLGTLMVVGVMMLPAVAARCWMQTLPGILLLAGVVGVLCSWLGLSISWAIALPAGPSVVLCASIFFFFSILFGGRSRLVVTLLRHFFGKE
>NZ_CP026285.1|WP_032676558.1|5312397_5313057_-|ATP-binding-cassette-domain-containing-protein
MIELQELSVGYNHSPVTSIISGHIAVGSMTAIVGENGCGKSTLLKTLAGFLPPVNGHIIWPHGRPDTGWLAQRNTLESDFPIVVQDVVSMGLWPRVSLFRSIRRSERLRIAAALERVGLLHLAKSPIETLSGGQFQRMLFARVWLQQAPLIMLDEPLTGVDENTSHVLMSLIEEMHQRGQTILAVLHDTTRVQRYFPSVLRLESERSYWQTQVHKECVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026285_3	3.1\|4987922\|36\|NZ_CP026285\|CRISPRCasFinder	4987922-4987957	36	NZ_CP026278	Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence	8602-8637	0	1.0

1. spacer 3.1|4987922|36|NZ_CP026285|CRISPRCasFinder matches to NZ_CP026278 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence) position: , mismatch: 0, identity: 1.0

acgcaaacccagtaaccacgctgcgtacaagtgagg	CRISPR spacer
acgcaaacccagtaaccacgctgcgtacaagtgagg	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

607 : 44419

Escherichia_phage(23.91%)

terminase,capsid,transposase,integrase,holin,tail,portal,protease,head

attL 389:413|attR 45190:45214

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
389:413	attL	NA	NA	NA	NA
WP_032750825.1\|607_1789_+\|integrase	integrase family protein	A0A2R2Z2Y0	Escherichia_phage	4.5e-199	84.5
WP_140356938.1\|1844_2693_+	hypothetical protein	NA	NA	NA	NA
WP_071995741.1\|2746_2932_-	hypothetical protein	G3CFG7	Escherichia_phage	5.2e-14	59.6
WP_032750822.1\|4555_5635_-	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	9.5e-148	73.0
WP_032750820.1\|5631_6420_-	hypothetical protein	A4JX52	Burkholderia_virus	8.4e-61	50.2
WP_032750819.1\|6419_6719_-	hypothetical protein	K7PJS4	Enterobacterial_phage	5.5e-13	45.7
WP_103468726.1\|7141_8299_-	type I restriction endonuclease subunit R	A0A1S5SAB0	Streptococcus_phage	2.4e-35	28.6
WP_032750818.1\|8470_8953_-	hypothetical protein	A0A2D1GNH0	Pseudomonas_phage	1.7e-11	41.5
WP_071995740.1\|9055_9325_+	helix-turn-helix domain-containing protein	D0UIL8	Aggregatibacter_phage	2.9e-13	49.3
WP_103468727.1\|9353_9584_+	hypothetical protein	NA	NA	NA	NA
WP_032750814.1\|9584_10040_+	hypothetical protein	K7PJS5	Enterobacterial_phage	2.3e-66	87.8
WP_071988277.1\|10277_10490_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.7e-16	72.7
WP_032750813.1\|10446_11361_+	transcriptional regulator	H2DE83	Erwinia_phage	3.1e-30	59.6
WP_103468728.1\|11357_12167_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	3.6e-115	71.5
WP_032750809.1\|12176_12566_+	RusA family crossover junction endodeoxyribonuclease	A0A192Y8N5	Salmonella_phage	3.6e-49	73.6
WP_032750807.1\|12580_13276_+	antirepressor	G0ZND1	Cronobacter_phage	1.6e-76	65.2
WP_103468729.1\|13272_14253_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.2e-135	68.4
WP_032750803.1\|14266_14845_+	DUF1133 family protein	A0A0U2S606	Escherichia_phage	5.8e-51	57.8
WP_032750801.1\|14995_15235_+	hypothetical protein	NA	NA	NA	NA
WP_004121584.1\|15400_15796_+	membrane protein	K7PHB9	Enterobacterial_phage	3.2e-61	93.9
WP_017145564.1\|15782_16064_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.3e-37	80.6
WP_032750800.1\|16063_16693_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	3.4e-105	89.5
WP_032750799.1\|16700_16976_+	hypothetical protein	G8C7W1	Escherichia_phage	1.9e-15	51.7
WP_032750798.1\|16926_17124_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.5e-22	85.2
WP_032750796.1\|17194_17683_+	hypothetical protein	NA	NA	NA	NA
WP_032408646.1\|17769_18153_+	hypothetical protein	Q6UAR9	Klebsiella_phage	5.2e-64	94.5
WP_032750795.1\|18219_18465_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.2e-19	61.7
WP_032750793.1\|18563_18998_+	hypothetical protein	NA	NA	NA	NA
WP_032750792.1\|19120_19471_+	HNH endonuclease	A0A1B5FP94	Escherichia_phage	2.7e-51	80.7
WP_032750791.1\|19627_20125_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.2e-62	72.7
WP_032750790.1\|20124_21882_+\|terminase	terminase large subunit	A0A1B5FP96	Escherichia_phage	0.0e+00	90.4
WP_032408651.1\|21892_22078_+	hypothetical protein	Q8HAD5	Salmonella_phage	6.2e-15	61.7
WP_086013483.1\|22248_23395_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
WP_103468730.1\|23358_24540_+\|portal	phage portal protein	Q8HAD4	Salmonella_phage	2.3e-187	82.9
WP_032750786.1\|24526_25180_+\|head,protease	HK97 family phage prohead protease	Q8W628	Enterobacteria_phage	7.9e-105	86.9
WP_032750785.1\|25194_26403_+\|capsid	phage major capsid protein	Q8HAD2	Salmonella_phage	1.1e-187	82.0
WP_032750784.1\|26441_26645_+	hypothetical protein	S5FNU1	Shigella_phage	1.4e-07	47.0
WP_032750783.1\|26641_26962_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	1.7e-15	39.8
WP_004884319.1\|26970_27309_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	6.4e-42	74.1
WP_032750782.1\|27305_27755_+	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	8.7e-63	81.9
WP_032750781.1\|27751_28099_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	2.3e-31	60.2
WP_032750779.1\|28155_28860_+	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	3.6e-79	67.4
WP_032750777.1\|28890_29295_+\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	7.2e-32	55.7
WP_032750775.1\|29297_29603_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	9.5e-29	66.0
WP_158656809.1\|29657_29813_+	hypothetical protein	NA	NA	NA	NA
WP_000019441.1\|29850_30831_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
WP_000019441.1\|33786_34767_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
WP_032750770.1\|36271_36745_+	hypothetical protein	A0A286S298	Klebsiella_phage	2.7e-54	62.5
WP_032750768.1\|36731_37217_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	1.8e-53	66.9
WP_032750767.1\|37226_37607_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	1.6e-57	80.2
WP_032750765.1\|37603_40681_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	67.8
WP_050597584.1\|40756_44419_+	hypothetical protein	A0A286S1R8	Klebsiella_phage	0.0e+00	90.4
45190:45214	attR	NA	NA	NA	NA

DBSCAN-SWA_2

138769 : 218073

Enterobacteria_phage(13.64%)

terminase,capsid,transposase,holin,tail,portal,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014839101.1\|138769_139750_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.8e-73	56.7
WP_032750700.1\|139798_141247_-	catalase	A0A2K9L0T1	Tupanvirus	6.9e-101	46.7
WP_004123076.1\|141516_142059_+	membrane protein	NA	NA	NA	NA
WP_032750698.1\|142155_143352_+	nicotinamide mononucleotide deamidase-related protein YfaY	NA	NA	NA	NA
WP_004852774.1\|143556_144339_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014839100.1\|144352_145558_+	L-rhamnonate dehydratase	Q6A202	Oenococcus_phage	1.8e-25	28.3
WP_004852770.1\|145610_146900_+	MFS transporter	NA	NA	NA	NA
WP_025106698.1\|146914_147718_+	2-keto-3-deoxy-L-rhamnonate aldolase	NA	NA	NA	NA
WP_032750696.1\|147740_148919_-	anaerobic glycerol-3-phosphate dehydrogenase subunit C	NA	NA	NA	NA
WP_032750695.1\|148915_150175_-	glycerol-3-phosphate dehydrogenase subunit GlpB	NA	NA	NA	NA
WP_014230223.1\|150164_151787_-	anaerobic glycerol-3-phosphate dehydrogenase subunit A	NA	NA	NA	NA
WP_032750694.1\|153414_154485_+	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	3.9e-08	42.9
WP_004104002.1\|154556_154811_-	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	8.2e-26	64.0
WP_004852757.1\|154810_155941_-	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	7.3e-175	78.9
WP_004852755.1\|156044_158330_-	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	1.3e-284	63.8
WP_032750693.1\|158674_159403_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_014839094.1\|159588_162222_+	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	6.2e-92	30.7
WP_048252457.1\|162352_165199_+	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	3.4e-43	26.3
WP_004103995.1\|165243_165894_-	transcriptional regulator RcsB	NA	NA	NA	NA
WP_032750692.1\|165910_168571_-	phosphotransferase RcsD	NA	NA	NA	NA
WP_032750690.1\|169342_170461_+	porin OmpC	Q1MVN1	Enterobacteria_phage	2.0e-116	58.8
WP_032750688.1\|170563_171616_+	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_032750686.1\|171688_172753_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	L7Y5F8	Megavirus	1.4e-18	47.2
WP_032750685.1\|172752_173403_+	DNA oxidative demethylase AlkB	NA	NA	NA	NA
WP_032750684.1\|173479_175123_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-09	22.3
WP_014230209.1\|175291_176728_+	magnesium transporter	NA	NA	NA	NA
WP_032750682.1\|176690_177938_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.2e-66	44.3
WP_025106713.1\|178217_179852_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_032750679.1\|179896_180388_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_009653963.1\|180659_181766_-	AI-2E family transporter	NA	NA	NA	NA
WP_032750677.1\|182353_183454_+	hypothetical protein	NA	NA	NA	NA
WP_032750675.1\|183569_184748_-	recombinase	A0A2H4J1K3	uncultured_Caudovirales_phage	3.6e-31	30.8
WP_032751902.1\|184750_184960_-	hypothetical protein	NA	NA	NA	NA
WP_086013483.1\|185172_186319_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
WP_016809733.1\|186558_186750_+	hypothetical protein	Q8SBE3	Shigella_phage	1.7e-23	85.7
WP_103468735.1\|186899_187949_+	site-specific DNA-methyltransferase	A5LH81	Enterobacteria_phage	1.5e-169	79.0
WP_103468736.1\|188331_188772_+	hypothetical protein	NA	NA	NA	NA
WP_103468737.1\|188768_190058_+	hypothetical protein	NA	NA	NA	NA
WP_015370231.1\|190281_190707_+	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	1.1e-59	84.4
WP_048258054.1\|190703_190859_+	DUF3927 family protein	A0A0A0YRI9	Escherichia_phage	4.2e-09	68.8
WP_103468739.1\|191337_191748_-	hypothetical protein	NA	NA	NA	NA
WP_004139418.1\|191990_192380_+	membrane protein	K7PHB9	Enterobacterial_phage	2.4e-48	80.3
WP_014228560.1\|192369_192648_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	4.0e-34	76.1
WP_103468740.1\|192647_193277_+	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	3.8e-88	75.8
WP_103468741.1\|193279_193555_+	hypothetical protein	G8C7W1	Escherichia_phage	6.6e-21	65.9
WP_158656811.1\|194196_194442_-	hypothetical protein	NA	NA	NA	NA
WP_050849666.1\|194481_194823_+	HNH endonuclease	K7P7P4	Enterobacteria_phage	9.3e-49	76.6
WP_064398049.1\|195004_195469_+\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	2.8e-48	62.7
WP_103468744.1\|195422_197159_+\|terminase	terminase large subunit	M4QNU0	Tetraselmis_viridis_virus	2.9e-138	44.6
WP_103468745.1\|197165_198485_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	4.4e-139	59.1
WP_014838140.1\|198460_199168_+\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	6.4e-68	63.0
WP_103468746.1\|199177_200398_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	7.5e-141	64.5
WP_014838142.1\|200443_200698_+	hypothetical protein	NA	NA	NA	NA
WP_032734570.1\|200703_201036_+\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	8.8e-12	31.6
WP_103468747.1\|201048_201387_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.8e-37	66.1
WP_103468748.1\|201383_201833_+	hypothetical protein	Q9MCS9	Enterobacteria_phage	9.7e-62	81.2
WP_103468749.1\|201829_202177_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	1.8e-31	61.1
WP_017145575.1\|202233_202944_+\|tail	tail protein	K7PHL2	Enterobacterial_phage	3.7e-84	68.6
WP_049069900.1\|202974_203379_+\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	2.5e-32	56.5
WP_016809743.1\|203381_203687_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	6.2e-28	64.0
WP_103468750.1\|203878_204394_+	KilA-N domain-containing protein	A0A1V0E5P7	Salmonella_phage	1.4e-61	70.1
WP_103468751.1\|204586_205141_+	hypothetical protein	NA	NA	NA	NA
WP_032749742.1\|205198_206392_-\|transposase	IS4 family transposase	S5FM71	Shigella_phage	1.5e-141	63.7
WP_103468752.1\|206515_209908_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	3.8e-283	55.0
WP_047720936.1\|209929_210403_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.2e-54	61.4
WP_103468753.1\|210389_210866_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	6.7e-53	67.1
WP_032750673.1\|210878_211259_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	2.0e-60	82.5
WP_032750671.1\|211255_214333_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	61.2
WP_053067550.1\|214410_218073_+	hypothetical protein	A0A286S1R8	Klebsiella_phage	0.0e+00	90.0

DBSCAN-SWA_3

224220 : 233198

Pseudomonas_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152765.1\|224220_225705_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_004152765.1\|226129_227614_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_050346433.1\|228185_229523_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.2e-32	35.5
WP_032751822.1\|229947_231432_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.1e-29	34.1
WP_032751898.1\|231511_231931_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	4.7e-34	55.9
WP_032750660.1\|231932_233198_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	1.6e-207	82.9

DBSCAN-SWA_4

378640 : 387034

Planktothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032751891.1\|378640_379504_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-11	29.0
WP_014230105.1\|379514_380288_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.8e-27	37.7
WP_032693715.1\|380704_381505_+	CadC family transcriptional regulator	NA	NA	NA	NA
WP_014230103.1\|381491_381962_+	hypothetical protein	NA	NA	NA	NA
WP_080528250.1\|381962_382856_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	2.0e-13	28.4
WP_103468758.1\|383100_384462_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.6e-200	92.0
WP_014230101.1\|384779_385502_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	2.4e-30	32.7
WP_016946933.1\|385498_387034_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	2.8e-28	27.6

DBSCAN-SWA_5

447887 : 457524

Enterobacteria_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103468763.1\|447887_449294_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	4.3e-39	28.9
WP_014230060.1\|449506_450571_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.2e-104	55.0
WP_049070182.1\|450584_451454_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	8.3e-110	67.7
WP_064378512.1\|451485_452376_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.4e-27	32.1
WP_014230057.1\|452391_452946_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	7.3e-51	56.7
WP_032693859.1\|453119_454286_+	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	7.0e-112	54.0
WP_139512586.1\|454859_454982_-	small membrane protein	NA	NA	NA	NA
WP_032416385.1\|455232_456156_+\|transposase	IS5-like element IS903 family transposase	Q1MVF0	Enterobacteria_phage	5.6e-173	97.4
WP_032693858.1\|456519_457524_-	NAD-dependent epimerase	E3T4Y8	Cafeteria_roenbergensis_virus	3.6e-32	30.1

DBSCAN-SWA_6

598922 : 634476

uncultured_Caudovirales_phage(33.33%)

lysis,tail,terminase,integrase

attL 590263:590276|attR 600391:600404

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
590263:590276	attL	NA	NA	NA	NA
WP_103468773.1\|598922_599939_-\|integrase	tyrosine-type recombinase/integrase	H9C152	Pectobacterium_phage	2.5e-126	64.8
WP_103468774.1\|599922_600168_-	DUF4224 domain-containing protein	H9C153	Pectobacterium_phage	1.2e-05	35.2
WP_049099642.1\|600377_600563_-	hypothetical protein	NA	NA	NA	NA
600391:600404	attR	NA	NA	NA	NA
WP_103215520.1\|600564_601125_-	siphovirus Gp157 family protein	H9C156	Pectobacterium_phage	2.6e-48	58.4
WP_103468775.1\|601124_603335_-	hypothetical protein	H9C157	Pectobacterium_phage	4.1e-97	34.1
WP_103468776.1\|603367_603652_-	hypothetical protein	NA	NA	NA	NA
WP_103215518.1\|603680_603926_-	hypothetical protein	A0A1B1W282	Salmonella_phage	2.8e-15	55.0
WP_103468777.1\|603933_604257_-	hypothetical protein	NA	NA	NA	NA
WP_094819180.1\|604890_605346_-	helix-turn-helix domain-containing protein	A0A0U2QW76	Escherichia_phage	1.2e-35	54.3
WP_000364674.1\|605454_605688_+	helix-turn-helix transcriptional regulator	A0A0U2S629	Escherichia_phage	2.9e-09	44.4
WP_082236706.1\|605750_606197_+	hypothetical protein	H9C162	Pectobacterium_phage	1.0e-26	51.4
WP_015365921.1\|606280_606439_+	hypothetical protein	NA	NA	NA	NA
WP_103468906.1\|606456_607425_+	helix-turn-helix domain-containing protein	H9C164	Pectobacterium_phage	1.6e-37	73.3
WP_103468907.1\|607433_608828_+	AAA family ATPase	Q76H51	Enterobacteria_phage	1.4e-103	46.9
WP_103468778.1\|608866_609535_+	hypothetical protein	NA	NA	NA	NA
WP_015365925.1\|609538_609772_+	hypothetical protein	NA	NA	NA	NA
WP_158236443.1\|609768_609939_+	hypothetical protein	NA	NA	NA	NA
WP_103468779.1\|609935_610526_+	adenine methylase	A0A2R9YJG0	Escherichia_phage	5.7e-94	84.7
WP_103468780.1\|610528_610759_+	hypothetical protein	A0A2H4JCC5	uncultured_Caudovirales_phage	2.9e-06	38.7
WP_015365929.1\|610755_611373_+	hypothetical protein	A0A2H4JEM6	uncultured_Caudovirales_phage	2.3e-05	24.9
WP_103468781.1\|611385_611724_+	hypothetical protein	A0A193GYX4	Enterobacter_phage	1.7e-47	82.0
WP_041165550.1\|611906_612098_+	hypothetical protein	NA	NA	NA	NA
WP_080528177.1\|612166_612763_+	DUF1367 family protein	H9C173	Pectobacterium_phage	1.4e-79	70.7
WP_103468782.1\|612774_613077_+	DUF968 domain-containing protein	A0A2H4FS95	Methylophilaceae_phage	1.2e-23	51.7
WP_158656817.1\|613064_613229_+	hypothetical protein	NA	NA	NA	NA
WP_015365933.1\|613232_613529_+	hypothetical protein	NA	NA	NA	NA
WP_103468783.1\|613556_613997_+	hypothetical protein	NA	NA	NA	NA
WP_032409891.1\|614007_614229_+	hypothetical protein	NA	NA	NA	NA
WP_103468784.1\|614232_615858_+\|tail	phage tail protein	A0A2H4J3N6	uncultured_Caudovirales_phage	3.4e-173	59.3
WP_032409894.1\|615854_616088_+	hypothetical protein	NA	NA	NA	NA
WP_103468785.1\|616074_616923_+	hypothetical protein	A0A2H4JEQ5	uncultured_Caudovirales_phage	1.2e-44	42.5
WP_103468786.1\|616956_617421_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	2.5e-60	70.0
WP_103468787.1\|617456_617864_+	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	5.5e-40	68.3
WP_103468788.1\|618081_618987_+	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.3e-44	39.6
WP_064167266.1\|619046_619610_+	hypothetical protein	A0A2H4JID6	uncultured_Caudovirales_phage	3.4e-48	49.7
WP_103468789.1\|619609_621601_+	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	9.5e-186	48.3
WP_077269610.1\|621600_622053_+	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	1.2e-22	44.3
WP_040200578.1\|622055_622544_+	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	3.5e-09	49.0
WP_103468790.1\|622549_625264_+	transglycosylase SLT domain-containing protein	G9L6D3	Escherichia_phage	2.0e-287	58.6
WP_103468791.1\|625263_628143_+	hypothetical protein	G9L6D4	Escherichia_phage	0.0e+00	68.0
WP_072041777.1\|628185_628512_+	hypothetical protein	NA	NA	NA	NA
WP_047063212.1\|628584_628926_+	hypothetical protein	A0A2H4J7H0	uncultured_Caudovirales_phage	1.5e-19	48.2
WP_103468792.1\|628922_630533_+\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	4.0e-227	71.0
WP_103468793.1\|630549_633030_+	hypothetical protein	A0A0A8JA02	Klebsiella_phage	4.6e-97	35.3
WP_158656819.1\|633071_633296_+	hypothetical protein	NA	NA	NA	NA
WP_015365951.1\|633375_633600_+\|lysis	phage lysis protein S	A0A0P0ZFW5	Escherichia_phage	2.0e-20	70.1
WP_103468794.1\|633583_634120_+	lysozyme	K7PM52	Enterobacteria_phage	6.1e-71	68.8
WP_103468795.1\|634116_634476_+	hypothetical protein	R9TPM9	Aeromonas_phage	1.3e-16	43.1

DBSCAN-SWA_7

986116 : 1060704

Escherichia_phage(40.0%)

integrase,transposase,plate

attL 1021752:1021768|attR 1047694:1047710

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032749823.1\|986116_987457_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_032749821.1\|987453_988143_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_032749819.1\|988139_989852_+	OmpA family protein	NA	NA	NA	NA
WP_014839086.1\|989856_990348_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_032749817.1\|990636_991002_+	hypothetical protein	NA	NA	NA	NA
WP_032749816.1\|990998_993524_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.1e-20	32.2
WP_032749815.1\|993510_994743_+	hypothetical protein	NA	NA	NA	NA
WP_103468800.1\|994749_995112_+	hypothetical protein	NA	NA	NA	NA
WP_032749813.1\|995559_995790_+	hypothetical protein	NA	NA	NA	NA
WP_032749811.1\|998221_1000510_+	hypothetical protein	NA	NA	NA	NA
WP_032749810.1\|1000513_1001206_+	hypothetical protein	NA	NA	NA	NA
WP_032749809.1\|1001940_1002138_+	hypothetical protein	NA	NA	NA	NA
WP_047723683.1\|1002379_1003126_+	hypothetical protein	NA	NA	NA	NA
WP_032749807.1\|1003157_1004366_+	hypothetical protein	NA	NA	NA	NA
WP_032749804.1\|1004362_1007830_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_000019441.1\|1009668_1010649_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
WP_032749800.1\|1011064_1011499_+	DUF1240 domain-containing protein	NA	NA	NA	NA
WP_050597577.1\|1014175_1014598_+	DUF1240 domain-containing protein	NA	NA	NA	NA
WP_139134510.1\|1015464_1015848_+	hypothetical protein	NA	NA	NA	NA
WP_032749793.1\|1015960_1017715_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_032749791.1\|1017678_1018764_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_032749789.1\|1018741_1019287_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_032749787.1\|1019789_1020878_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025105882.1\|1020949_1022719_+	iron ABC transporter permease	NA	NA	NA	NA
1021752:1021768	attL	NA	NA	NA	NA
WP_032692928.1\|1022711_1023782_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.2e-31	36.8
WP_014838693.1\|1023838_1024609_-	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_014838692.1\|1024632_1026312_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_004851637.1\|1026322_1027102_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_014229640.1\|1027208_1028081_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.3e-05	27.3
WP_004136705.1\|1028109_1028322_-	cold shock-like protein CspF	NA	NA	NA	NA
WP_032749785.1\|1029128_1030316_+	PLP-dependent transferase	NA	NA	NA	NA
WP_032749783.1\|1030308_1031727_+	sodium:proton antiporter	NA	NA	NA	NA
WP_004851627.1\|1031850_1031991_-	hypothetical protein	NA	NA	NA	NA
WP_032749782.1\|1032306_1033215_+	DUF535 family protein	NA	NA	NA	NA
WP_032749780.1\|1033330_1034002_-	cyclic nucleotide-binding protein	NA	NA	NA	NA
WP_025105874.1\|1034995_1035523_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_032749778.1\|1035568_1036570_-	fimbrial protein	NA	NA	NA	NA
WP_032749777.1\|1036585_1039156_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_025105871.1\|1039216_1039906_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_032749776.1\|1040006_1040525_-	fimbrial protein	NA	NA	NA	NA
WP_032749775.1\|1040981_1041530_-\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	7.2e-51	51.9
WP_032749774.1\|1041954_1044360_+	membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	NA	NA	NA	NA
WP_025105867.1\|1044435_1045401_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-17	29.0
WP_032749773.1\|1045397_1046378_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-12	29.3
WP_032749772.1\|1047321_1048281_-	ABC transporter permease	NA	NA	NA	NA
1047694:1047710	attR	NA	NA	NA	NA
WP_032749771.1\|1048324_1050028_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032749769.1\|1050297_1050936_-	CatA-like O-acetyltransferase	NA	NA	NA	NA
WP_025105857.1\|1050966_1051350_-	hypothetical protein	NA	NA	NA	NA
WP_004851588.1\|1051443_1052214_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.6e-16	28.7
WP_014229623.1\|1052227_1052857_-	LysE family transporter	NA	NA	NA	NA
WP_004119381.1\|1053081_1053717_+	carbonic anhydrase	NA	NA	NA	NA
WP_025105856.1\|1053823_1054630_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_032749766.1\|1054652_1055537_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.7e-82	56.1
WP_032749764.1\|1055910_1056303_+	YdeI family stress tolerance OB fold protein	NA	NA	NA	NA
WP_032750193.1\|1056515_1058126_-	FAD-NAD(P)-binding protein	NA	NA	NA	NA
WP_001118616.1\|1059780_1060704_+\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	1.1e-176	99.3

DBSCAN-SWA_8

1740729 : 1749153

Cronobacter_phage(28.57%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004850357.1\|1740729_1741344_-\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	1.2e-67	69.6
WP_032749340.1\|1741511_1742246_-	peptidase P60	Q6UAW4	Klebsiella_phage	1.6e-125	83.2
WP_025107965.1\|1742247_1743000_-\|tail	phage minor tail protein L	K7PKU0	Enterobacteria_phage	5.7e-115	76.3
WP_032749341.1\|1742996_1743344_-\|tail	phage tail protein	I6PBN7	Cronobacter_phage	2.4e-36	60.0
WP_032749342.1\|1743366_1744476_-\|tail	phage tail tape measure protein	I6PCW3	Cronobacter_phage	5.9e-52	48.5
WP_048263674.1\|1744560_1744806_-	hypothetical protein	A0A2H4J4F7	uncultured_Caudovirales_phage	2.3e-09	40.0
WP_004850345.1\|1744868_1745180_-	hypothetical protein	I6PDG2	Cronobacter_phage	1.5e-32	62.1
WP_014229127.1\|1745252_1745915_-\|tail	phage tail protein	I6PBN6	Cronobacter_phage	7.0e-77	65.0
WP_004850340.1\|1746034_1746454_-	hypothetical protein	Q6UAS0	Klebsiella_phage	9.4e-35	51.5
WP_004850338.1\|1746509_1747052_-	glycoside hydrolase family 108 protein	A0A0U2I1S0	Escherichia_phage	5.2e-70	66.7
WP_032749344.1\|1747059_1747332_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.2e-16	55.4
WP_009653048.1\|1747321_1747714_-	membrane protein	K7PHB9	Enterobacterial_phage	1.3e-38	66.2
WP_014229124.1\|1747790_1748153_-	hypothetical protein	C6ZR44	Salmonella_phage	7.1e-31	57.5
WP_009653037.1\|1748616_1749153_-	helix-turn-helix transcriptional regulator	K7PKK1	Enterobacteria_phage	5.2e-30	49.7

DBSCAN-SWA_9

1753802 : 1798153

Escherichia_phage(36.36%)

tRNA,protease,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000019441.1\|1753802_1754783_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	2.3e-185	99.1
WP_009652979.1\|1754882_1755989_+	porin OmpC	Q1MVN1	Enterobacteria_phage	4.9e-107	57.4
WP_004850325.1\|1756142_1756355_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_004101601.1\|1756437_1756872_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	7.2e-30	51.4
WP_014229121.1\|1757060_1757351_+	hypothetical protein	C6ZCX3	Enterobacteria_phage	9.7e-31	66.0
WP_025107976.1\|1757749_1758688_-\|protease	omptin family outer membrane protease	NA	NA	NA	NA
WP_032749348.1\|1759025_1759298_-	hypothetical protein	NA	NA	NA	NA
WP_004850317.1\|1759501_1760437_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.4e-139	93.4
WP_032749350.1\|1760481_1761855_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.8e-50	31.8
WP_004850311.1\|1762338_1763322_-	zinc transporter ZntB	NA	NA	NA	NA
WP_025107979.1\|1763664_1764285_-	response regulator transcription factor	NA	NA	NA	NA
WP_032749353.1\|1764901_1765645_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.6e-15	27.2
WP_032693679.1\|1765661_1766729_+	oxidoreductase	NA	NA	NA	NA
WP_025107982.1\|1766801_1768067_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	3.5e-157	66.4
WP_004850301.1\|1768066_1768489_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.6e-32	51.2
WP_014229113.1\|1768776_1768971_+	hypothetical protein	NA	NA	NA	NA
WP_004850297.1\|1769127_1769319_+	hypothetical protein	NA	NA	NA	NA
WP_001118616.1\|1769688_1770612_+\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	1.1e-176	99.3
WP_071995723.1\|1770655_1770877_+	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_014229112.1\|1770931_1771495_-	DUF1440 domain-containing protein	NA	NA	NA	NA
WP_032720811.1\|1771691_1772273_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_014838304.1\|1772398_1773028_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071532263.1\|1773389_1773578_-	cold-shock protein	NA	NA	NA	NA
WP_032749356.1\|1774293_1775274_-	nitronate monooxygenase	NA	NA	NA	NA
WP_032749357.1\|1775432_1776317_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014838299.1\|1776430_1777315_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014229103.1\|1777486_1778623_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_032749358.1\|1778832_1779954_+	MFS transporter	NA	NA	NA	NA
WP_071995735.1\|1780051_1780396_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_032749360.1\|1780497_1781226_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.1e-45	46.4
WP_032749361.1\|1781468_1781903_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_032749362.1\|1781899_1782619_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_032749366.1\|1782615_1783875_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_032749367.1\|1783876_1784599_+	DUF1365 domain-containing protein	NA	NA	NA	NA
WP_032749368.1\|1784595_1785819_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_032749369.1\|1785815_1786349_+	DUF3833 domain-containing protein	NA	NA	NA	NA
WP_014229093.1\|1786363_1787323_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_032749371.1\|1787386_1788769_-	carbohydrate porin	NA	NA	NA	NA
WP_025107999.1\|1789660_1791115_+	MFS transporter	NA	NA	NA	NA
WP_032749373.1\|1791169_1792849_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_032749375.1\|1793011_1794346_-	membrane protein	NA	NA	NA	NA
WP_014838282.1\|1794369_1794825_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_032749377.1\|1794826_1795366_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_032749379.1\|1795343_1796429_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_032749381.1\|1796392_1798153_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_10

1975679 : 2039272

Enterobacteria_phage(52.94%)

terminase,plate,tRNA,integrase,tail,portal,capsid,head

attL 1980967:1980984|attR 2018021:2018038

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032749533.1\|1975679_1976180_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_004138309.1\|1976343_1976790_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_032749534.1\|1976773_1977565_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032749535.1\|1977665_1978850_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_032749536.1\|1978887_1979580_-	CTP synthase	NA	NA	NA	NA
WP_032749537.1\|1979742_1980252_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_014228940.1\|1980238_1980583_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_025106943.1\|1980577_1980817_-	DUF333 domain-containing protein	NA	NA	NA	NA
1980967:1980984	attL	NA	NA	NA	NA
WP_004213128.1\|1981079_1981331_-	ogr/Delta-like zinc finger family protein	A0A2I8TV89	Erwinia_phage	3.4e-08	49.2
WP_103468816.1\|1981374_1982514_-	phage late control D family protein	B9A7A9	Serratia_phage	3.0e-144	70.7
WP_103468817.1\|1982669_1983842_+\|tail	phage tail sheath family protein	A0A0A7NV69	Enterobacteria_phage	3.2e-157	70.2
WP_103468818.1\|1983841_1984357_+\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	5.7e-58	61.8
WP_004131585.1\|1984402_1984720_+	hypothetical protein	B9A7B2	Serratia_phage	1.0e-17	54.8
WP_032440702.1\|1984719_1984878_+\|tail	GpE family phage tail protein	A0A0A7NQ96	Enterobacteria_phage	3.5e-11	63.3
WP_103468819.1\|1984864_1987840_+\|tail	phage tail tape measure protein	A0A0A7NRZ9	Enterobacteria_phage	2.3e-220	46.6
WP_103468820.1\|1987855_1988347_+\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	3.3e-55	62.7
WP_103468821.1\|1988560_1990402_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_103468822.1\|1991113_1992211_-\|tail	phage tail protein	G4KKN6	Yersinia_phage	4.8e-06	45.6
WP_103468823.1\|1992195_1992411_-	hypothetical protein	NA	NA	NA	NA
WP_103468824.1\|1992407_1995437_-\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	3.7e-24	40.7
WP_103468825.1\|1995426_1996350_-\|plate	baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	3.4e-53	43.9
WP_103468826.1\|1996351_1996702_-\|plate	baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	6.0e-27	55.7
WP_103468827.1\|1996698_1997286_-\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	1.4e-60	61.0
WP_103468828.1\|1997282_1997918_-	phage virion morphogenesis protein	A0A0A7NV60	Enterobacteria_phage	1.1e-55	51.0
WP_103468829.1\|1997914_1998382_-\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	3.1e-47	59.5
WP_158656823.1\|1998382_1998718_-	peptidase	NA	NA	NA	NA
WP_103468830.1\|1998904_1999450_-	lysozyme	Q1I0Z1	Pasteurella_virus	8.2e-31	42.5
WP_103468831.1\|1999446_1999731_-\|tail	phage tail protein	NA	NA	NA	NA
WP_004131559.1\|1999721_1999922_-\|tail	tail protein	A0A0A7NV57	Enterobacteria_phage	1.6e-16	63.1
WP_103468832.1\|1999921_2000437_-\|head	head completion/stabilization protein	A0A0A7NPU2	Enterobacteria_phage	2.2e-41	50.0
WP_103468833.1\|2000541_2001408_-\|terminase	terminase	A0A0A7NPX9	Enterobacteria_phage	7.6e-71	58.1
WP_103468834.1\|2001456_2002491_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	1.1e-95	49.7
WP_103468835.1\|2002500_2003340_-\|capsid	GPO family capsid scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	3.0e-96	67.4
WP_103468836.1\|2003496_2005224_+	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	3.1e-233	68.3
WP_103468837.1\|2005217_2006279_+\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	1.3e-141	68.7
WP_158656825.1\|2006743_2008495_+	AAA family ATPase	NA	NA	NA	NA
WP_103468839.1\|2008491_2009925_+	AAA family ATPase	NA	NA	NA	NA
WP_068815154.1\|2012616_2013633_-	phosphoadenosine phosphosulfate reductase family protein	B7SYG0	Stenotrophomonas_phage	1.5e-65	43.7
WP_103468840.1\|2013906_2014473_-	3'-5' exoribonuclease	D4HTX2	Vibrio_phage	2.3e-12	31.0
WP_004213098.1\|2014469_2014694_-	hypothetical protein	NA	NA	NA	NA
WP_047719966.1\|2014761_2015034_-	hypothetical protein	NA	NA	NA	NA
WP_103468841.1\|2015049_2015427_-	hypothetical protein	NA	NA	NA	NA
WP_103468842.1\|2015442_2015661_-	DUF4761 domain-containing protein	A0A0M5M1I3	Salmonella_phage	1.6e-06	47.3
WP_023300862.1\|2015794_2016010_+	hypothetical protein	NA	NA	NA	NA
WP_023300861.1\|2016114_2016384_-	hypothetical protein	Q1JS60	Enterobacteria_phage	3.9e-42	88.8
WP_038423230.1\|2016506_2016806_+	helix-turn-helix transcriptional regulator	Q1JS61	Enterobacteria_phage	3.5e-36	71.7
WP_031593607.1\|2016921_2017935_+\|integrase	tyrosine-type recombinase/integrase	Q83VS6	Escherichia_phage	7.6e-155	79.5
WP_032749538.1\|2018167_2019181_+	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
2018021:2018038	attR	NA	NA	NA	NA
WP_004101234.1\|2019238_2019340_+	YoaK family small membrane protein	NA	NA	NA	NA
WP_100248259.1\|2019339_2019414_+	protein YoaJ	NA	NA	NA	NA
WP_086074258.1\|2019554_2019680_+	hypothetical protein	NA	NA	NA	NA
WP_004131510.1\|2019728_2019992_-	DUF2534 family protein	NA	NA	NA	NA
WP_025106941.1\|2020121_2020760_-	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004138325.1\|2020850_2021765_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	4.5e-74	51.2
WP_032749539.1\|2022308_2023097_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_032749540.1\|2023356_2023878_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_103468843.1\|2023867_2024827_+	fec operon regulator FecR	NA	NA	NA	NA
WP_032749541.1\|2024924_2027261_+	TonB-dependent receptor family protein	NA	NA	NA	NA
WP_032749542.1\|2027319_2028222_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032749545.1\|2028218_2029217_+	iron-dicitrate ABC transporter permease FecC	A0A2H4IY97	uncultured_Caudovirales_phage	1.2e-11	24.4
WP_025106936.1\|2029213_2030167_+	Fe(3+) dicitrate ABC transporter permease subunit FecD	NA	NA	NA	NA
WP_032749547.1\|2030167_2030935_+	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G3M9Y6	Bacillus_virus	6.8e-15	26.7
WP_009653379.1\|2030971_2032015_-	type II asparaginase	NA	NA	NA	NA
WP_014228927.1\|2032294_2033485_+	HD domain-containing protein	NA	NA	NA	NA
WP_032749549.1\|2033562_2035347_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.3e-20	37.2
WP_004131480.1\|2035492_2036743_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	4.4e-19	90.7
WP_004138338.1\|2036979_2037630_+	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_025106932.1\|2037650_2038127_+	NUDIX hydrolase	NA	NA	NA	NA
WP_032749565.1\|2038165_2039272_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA

DBSCAN-SWA_11

3617249 : 3694730

Enterobacteria_phage(32.5%)

terminase,plate,tRNA,transposase,integrase,tail,portal,capsid,head,protease

attL 3621032:3621072|attR 3658068:3658108

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025108460.1\|3617249_3618236_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_004107505.1\|3618285_3619659_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	4.5e-09	23.3
WP_004127228.1\|3619655_3620354_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	4.0e-06	30.3
WP_004855993.1\|3620503_3621007_+	cell-envelope stress modulator CpxP	NA	NA	NA	NA
3621032:3621072	attL	NA	NA	NA	NA
WP_032751862.1\|3621191_3622172_-\|integrase	tyrosine-type recombinase/integrase	U5N0A8	Enterobacteria_phage	1.4e-153	83.0
WP_032751863.1\|3622241_3622535_-	helix-turn-helix transcriptional regulator	Q1JS21	Enterobacteria_phage	1.3e-35	74.2
WP_032751864.1\|3622685_3622871_+	hypothetical protein	NA	NA	NA	NA
WP_032751865.1\|3622858_3623065_-	hypothetical protein	NA	NA	NA	NA
WP_032751866.1\|3623186_3623459_+	hypothetical protein	Q1JS20	Enterobacteria_phage	8.2e-40	85.6
WP_032751867.1\|3623485_3623704_+	hypothetical protein	A0A0M5M1I3	Salmonella_phage	3.6e-06	48.1
WP_032705924.1\|3623719_3623950_+	DUF2724 domain-containing protein	A0A0M4S6M9	Salmonella_phage	1.5e-23	68.6
WP_032705922.1\|3623964_3624237_+	hypothetical protein	NA	NA	NA	NA
WP_032751868.1\|3624306_3624534_+	hypothetical protein	NA	NA	NA	NA
WP_032751869.1\|3624526_3625072_+	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	5.5e-11	26.1
WP_032751871.1\|3625304_3625499_+	hypothetical protein	NA	NA	NA	NA
WP_032751873.1\|3625491_3626445_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0M4QWR0	Salmonella_phage	2.8e-82	54.9
WP_032751875.1\|3627028_3628039_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	4.1e-100	55.9
WP_032751878.1\|3628272_3630519_+	replication endonuclease	F1BUS0	Erwinia_phage	9.6e-134	43.4
WP_032750325.1\|3631154_3631847_+	DNA methylase	A0A0M4S5U3	Salmonella_phage	5.3e-91	70.3
WP_032750322.1\|3632019_3633168_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_032723903.1\|3633157_3633676_+	PIN domain-containing protein	NA	NA	NA	NA
WP_032750321.1\|3634099_3635152_-\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	1.1e-140	68.4
WP_032750320.1\|3635151_3636873_-	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	3.1e-225	66.0
WP_032750319.1\|3637030_3637864_+\|capsid	phage capsid scaffolding protein	B9A7B4	Serratia_phage	9.4e-111	73.3
WP_032750317.1\|3637888_3638938_+\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	2.3e-106	54.8
WP_032750314.1\|3638985_3639882_+\|terminase	terminase	B9A7B6	Serratia_phage	5.4e-88	75.3
WP_032750312.1\|3639984_3640482_+\|head	head completion/stabilization protein	B9A7B7	Serratia_phage	3.8e-59	68.5
WP_032750311.1\|3640481_3640682_+\|tail	tail protein	A0A0A7NV57	Enterobacteria_phage	5.7e-14	63.1
WP_032750310.1\|3640672_3640954_+	hypothetical protein	B9A7B8	Serratia_phage	1.1e-18	55.8
WP_032750309.1\|3640950_3641502_+	lysozyme	Q1I0Z1	Pasteurella_virus	1.3e-28	41.3
WP_071995736.1\|3641742_3642042_+	peptidase	NA	NA	NA	NA
WP_032750302.1\|3642038_3642500_+\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	2.2e-32	47.1
WP_032750301.1\|3642496_3643138_+	phage virion morphogenesis protein	A0A0M4RCU1	Salmonella_phage	9.9e-44	46.8
WP_032750299.1\|3643137_3643722_+\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	2.8e-61	60.6
WP_032750298.1\|3643718_3644087_+\|plate	baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	1.8e-29	58.3
WP_032750297.1\|3644073_3644973_+\|plate	baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	4.0e-91	61.9
WP_103468859.1\|3644965_3645568_+\|tail	phage tail protein I	A0A218M4J3	Erwinia_phage	3.0e-42	47.7
WP_158656831.1\|3645570_3649227_+	hypothetical protein	A0A286S1R8	Klebsiella_phage	0.0e+00	76.6
WP_048252579.1\|3649281_3650310_+\|tail	phage tail protein	Q37842	Escherichia_phage	1.1e-25	45.6
WP_032747298.1\|3650408_3650897_-\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	4.4e-52	60.9
WP_050597564.1\|3650911_3653671_-\|tail	phage tail tape measure protein	B9A7B3	Serratia_phage	1.1e-208	70.6
WP_071836356.1\|3653660_3653837_-\|tail	GpE family phage tail protein	O80316	Escherichia_phage	3.0e-11	71.4
WP_032747300.1\|3653833_3654133_-\|tail	phage tail assembly protein	B9A7B2	Serratia_phage	3.4e-31	72.6
WP_032749998.1\|3654187_3654703_-\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	2.2e-57	64.7
WP_032747303.1\|3654702_3655884_-\|tail	tail protein	A0A0A7NV69	Enterobacteria_phage	2.7e-156	69.8
WP_032747308.1\|3656036_3657191_+	phage late control D family protein	B9A7A9	Serratia_phage	2.5e-178	80.7
WP_071995702.1\|3657235_3657484_+	hypothetical protein	NA	NA	NA	NA
WP_032750008.1\|3657583_3657967_+	hypothetical protein	A0A0M4QWT0	Salmonella_phage	6.8e-40	57.5
WP_014227425.1\|3658191_3659088_+	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
3658068:3658108	attR	NA	NA	NA	NA
WP_004127238.1\|3659290_3660253_+	6-phosphofructokinase	NA	NA	NA	NA
WP_004127241.1\|3660312_3660798_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_032747309.1\|3660890_3661817_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_004127247.1\|3662007_3663342_-	HslU--HslV peptidase ATPase subunit	W6AS21	Erwinia_phage	1.1e-44	30.3
WP_004107530.1\|3663351_3663882_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_071846047.1\|3663972_3664941_-	cell division protein FtsN	NA	NA	NA	NA
WP_004856005.1\|3665032_3666061_-	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_032747314.1\|3666211_3668407_-	primosomal protein N'	NA	NA	NA	NA
WP_004107543.1\|3668648_3668864_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_004107547.1\|3668961_3669279_-	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_014227429.1\|3669545_3670706_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_014227430.1\|3670708_3673141_+	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_004856015.1\|3673180_3673552_-	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_032747315.1\|3673642_3674548_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004856019.1\|3674714_3675602_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_014227432.1\|3675724_3676474_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.0e-24	34.1
WP_014227433.1\|3676602_3677706_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_004107558.1\|3677762_3678425_-	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	3.5e-28	34.0
WP_025106568.1\|3678630_3679494_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032747320.1\|3679645_3680293_+	metal-binding protein ZinT	NA	NA	NA	NA
WP_032747324.1\|3680389_3683041_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_025106570.1\|3683299_3684451_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_004870566.1\|3684635_3685640_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_086544362.1\|3685646_3686423_+	acetylglutamate kinase	NA	NA	NA	NA
WP_014227439.1\|3686500_3687874_+	argininosuccinate lyase	NA	NA	NA	NA
WP_014227441.1\|3688141_3689059_+	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_004116922.1\|3689041_3690442_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_004107582.1\|3690638_3691274_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_004856046.1\|3691289_3691649_+	YijD family membrane protein	NA	NA	NA	NA
WP_032719444.1\|3691695_3692796_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_001567368.1\|3693326_3694730_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

4956298 : 5023072

Enterobacteria_phage(24.07%)

terminase,tRNA,transposase,integrase,lysis,head,coat

attL 4979308:4979345|attR 5027940:5027977

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016947617.1\|4956298_4957279_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	6.8e-185	98.8
WP_032748354.1\|4960220_4961582_+	allantoinase AllB	NA	NA	NA	NA
WP_032748356.1\|4961742_4963050_+	uracil/xanthine transporter	NA	NA	NA	NA
WP_032748359.1\|4963071_4964217_+	glycerate 3-kinase	W6LM47	Streptococcus_phage	4.8e-49	42.3
WP_032748362.1\|4964353_4965136_-	(S)-ureidoglycine aminohydrolase	NA	NA	NA	NA
WP_032748363.1\|4965146_4966382_-	allantoate deiminase	NA	NA	NA	NA
WP_032748364.1\|4966403_4967453_-	ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_032748365.1\|4967768_4969436_+	acyl-CoA synthetase FdrA	NA	NA	NA	NA
WP_032748367.1\|4969445_4970705_+	DUF1116 domain-containing protein	NA	NA	NA	NA
WP_032748369.1\|4970714_4971509_+	DUF2877 domain-containing protein	NA	NA	NA	NA
WP_032748371.1\|4971518_4972412_+	carbamate kinase	NA	NA	NA	NA
WP_014228235.1\|4972675_4973743_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_004848424.1\|4973739_4974249_-	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_032748374.1\|4974345_4974675_-	hypothetical protein	NA	NA	NA	NA
WP_032748376.1\|4974780_4975503_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_004099775.1\|4975506_4976001_-	peptidylprolyl isomerase B	NA	NA	NA	NA
WP_004848430.1\|4976174_4977560_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.0e-45	35.1
WP_025107125.1\|4977854_4978067_-	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_004099791.1\|4978068_4978935_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	6.5e-30	34.8
4979308:4979345	attL	NA	NA	NA	NA
WP_103468874.1\|4979367_4980531_-\|integrase	site-specific integrase	G8C7S0	Escherichia_phage	7.2e-202	86.0
WP_103468619.1\|4980407_4980743_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_103468620.1\|4980744_4980963_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_103468621.1\|4980959_4981169_-	hypothetical protein	NA	NA	NA	NA
WP_103468622.1\|4981165_4981822_-	DNA methyltransferase	G8C7S6	Escherichia_phage	3.8e-115	88.9
WP_032748397.1\|4981818_4981995_-	DUF1317 family protein	M1FJ61	Enterobacteria_phage	7.7e-07	50.0
WP_032748399.1\|4982006_4982711_-	hypothetical protein	A0A088C400	Shewanella_sp._phage	3.0e-25	39.6
WP_023339053.1\|4982722_4983391_-	AAA family ATPase	G9L667	Escherichia_phage	1.1e-48	44.3
WP_032748402.1\|4983392_4984052_-	exodeoxyribonuclease X	A0A1W5PTR6	Pseudoalteromonas_phage	6.0e-20	33.3
WP_032748404.1\|4984182_4984578_-	hypothetical protein	NA	NA	NA	NA
WP_064353467.1\|4984657_4984864_-	cell division inhibitor protein	A0A0M4S6W3	Salmonella_phage	5.3e-31	92.6
WP_158656795.1\|4985104_4985734_-	hypothetical protein	K7PKU5	Enterobacteria_phage	1.4e-53	50.2
WP_021312733.1\|4986023_4986683_-	helix-turn-helix domain-containing protein	K7P7K3	Enterobacteria_phage	1.9e-69	61.5
WP_004191589.1\|4986791_4987010_+	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	1.4e-13	50.7
WP_047684216.1\|4987050_4987272_+	bacteriophage CII family protein	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
WP_047684223.1\|4987497_4988397_+	hypothetical protein	F1C5C3	Cronobacter_phage	1.6e-87	54.9
WP_103468623.1\|4988386_4989817_+	AAA family ATPase	Q9MCT4	Escherichia_phage	3.8e-184	66.9
WP_103468624.1\|4989816_4990122_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_103468625.1\|4990118_4990604_+	hypothetical protein	R9TME7	Aeromonas_phage	1.8e-13	35.3
WP_103468626.1\|4990600_4990807_+	hypothetical protein	R9TRD3	Aeromonas_phage	8.1e-32	97.1
WP_158656834.1\|4991003_4991288_+	hypothetical protein	NA	NA	NA	NA
WP_103468628.1\|4991287_4991500_+	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	6.2e-11	45.5
WP_158656836.1\|4991812_4992172_+	hypothetical protein	R9TQX3	Aeromonas_phage	1.9e-15	89.1
WP_158656838.1\|4992259_4992568_-	hypothetical protein	NA	NA	NA	NA
WP_103468878.1\|4992548_4992848_+	DUF551 domain-containing protein	A0A1I9LJU9	Stx_converting_phage	1.2e-15	54.1
WP_101857254.1\|4992840_4993071_+	hypothetical protein	G8C7S3	Escherichia_phage	1.7e-09	53.4
WP_009652643.1\|4993329_4993779_+	recombination protein NinB	Q8VNP6	Enterobacteria_phage	2.2e-37	51.7
WP_103468631.1\|4994567_4994798_+	hypothetical protein	NA	NA	NA	NA
WP_103468632.1\|4994794_4994935_+	YlcG family protein	NA	NA	NA	NA
WP_103468633.1\|4994931_4995741_+	antitermination protein	M9NZB0	Enterobacteria_phage	5.3e-119	75.8
WP_048252288.1\|4996729_4997587_+	site-specific DNA-methyltransferase	H2EQJ0	Salmonella_phage	3.3e-50	69.5
WP_032748430.1\|4997639_4997921_+	hypothetical protein	NA	NA	NA	NA
WP_064367594.1\|4998078_4998303_+\|lysis	lysis protein	M9NZI9	Enterobacteria_phage	6.3e-30	87.8
WP_103468634.1\|4998280_4998775_+	lysozyme	M9P0E5	Enterobacteria_phage	2.4e-82	89.0
WP_103468635.1\|4998863_4999331_+\|lysis	lysis protein	Q76H63	Enterobacteria_phage	7.5e-57	74.2
WP_103468879.1\|4999366_4999642_+	hypothetical protein	K7P6G5	Enterobacteria_phage	5.4e-23	61.5
WP_103468880.1\|4999963_5000611_+	hypothetical protein	I6S676	Salmonella_phage	1.5e-100	79.6
WP_103468881.1\|5000641_5001130_+	DUF2280 domain-containing protein	I6S1P9	Salmonella_phage	9.2e-50	75.2
WP_103468882.1\|5001126_5002686_+\|terminase	terminase	G8C7P3	Escherichia_phage	3.8e-291	88.0
WP_032748444.1\|5002698_5004168_+	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	4.5e-148	56.9
WP_032748446.1\|5004094_5005102_+\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	4.9e-114	68.1
WP_103468636.1\|5005223_5006585_+	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	3.1e-127	52.2
WP_016529582.1\|5006584_5007046_+	hypothetical protein	B1GS72	Salmonella_phage	5.0e-29	50.3
WP_032748452.1\|5007042_5008098_+\|coat	phage coat protein	B1GS73	Salmonella_phage	3.8e-101	53.1
WP_103468637.1\|5008130_5008394_+	hypothetical protein	NA	NA	NA	NA
WP_103468638.1\|5008396_5008777_+	hypothetical protein	F1C5E2	Cronobacter_phage	9.1e-29	54.5
WP_032710897.1\|5008776_5008950_+	hypothetical protein	Q5G8X7	Enterobacteria_phage	5.4e-13	53.6
WP_043906744.1\|5008949_5009312_+	hypothetical protein	A0A0M3LSC9	Mannheimia_phage	1.9e-20	50.0
WP_004151265.1\|5009314_5009740_+	hypothetical protein	R9TPP7	Aeromonas_phage	5.1e-28	47.9
WP_004178853.1\|5009736_5010129_+	hypothetical protein	G0ZNE4	Cronobacter_phage	3.3e-34	51.9
WP_004151263.1\|5010197_5010950_+	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	5.8e-43	42.1
WP_029884068.1\|5011002_5011680_+	hypothetical protein	F1C5E8	Cronobacter_phage	9.7e-74	58.4
WP_004151261.1\|5011855_5012611_+	DNA-binding protein	K7PGT4	Enterobacteria_phage	2.4e-60	51.0
WP_004151260.1\|5012613_5012868_+	hypothetical protein	K7PM89	Enterobacteria_phage	6.7e-20	73.0
WP_023328739.1\|5013288_5013609_+	hypothetical protein	NA	NA	NA	NA
WP_047684316.1\|5013660_5014095_-	hypothetical protein	NA	NA	NA	NA
WP_047685272.1\|5014099_5014348_-	Arc family DNA-binding protein	E7C9U8	Salmonella_phage	8.0e-26	72.8
WP_049594418.1\|5014435_5014597_+	Arc family DNA-binding protein	I6S1K8	Salmonella_phage	1.6e-11	63.3
WP_103468639.1\|5015705_5019230_+	tape measure protein	R9TMK1	Aeromonas_phage	2.8e-297	67.1
WP_103468646.1\|5019329_5019749_+	hypothetical protein	A0A2P1MXB5	Escherichia_phage	4.1e-30	47.1
WP_103468640.1\|5019748_5020219_+	hypothetical protein	R9TPR6	Aeromonas_phage	2.4e-26	39.7
WP_103468641.1\|5020215_5020611_+	hypothetical protein	F1C5F2	Cronobacter_phage	6.1e-36	54.8
WP_103468642.1\|5020597_5023072_+	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	3.8e-200	45.6
5027940:5027977	attR	NA	NA	NA	NA

DBSCAN-SWA_13

5150753 : 5201984

Catovirus(14.29%)

holin,transposase,integrase

attL 5145315:5145329|attR 5172739:5172753

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5145315:5145329	attL	NA	NA	NA	NA
WP_032748624.1\|5150753_5152418_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	3.0e-60	31.1
WP_032748625.1\|5152432_5153905_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_032748626.1\|5153915_5154509_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_025107047.1\|5154637_5156671_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	5.8e-21	28.1
WP_004130292.1\|5156893_5157046_+	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_032748627.1\|5157240_5158026_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_032747738.1\|5158303_5159284_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.1e-24	29.9
WP_032751349.1\|5159720_5161370_-	glycerone kinase	NA	NA	NA	NA
WP_032751347.1\|5161437_5162856_-	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_014226902.1\|5162866_5163499_-	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_009651831.1\|5163510_5164581_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_009651847.1\|5165177_5166275_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_032751345.1\|5166379_5168293_+	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_071532228.1\|5168432_5168756_+	DUF1889 family protein	NA	NA	NA	NA
WP_032751344.1\|5169095_5170412_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	4.6e-35	29.8
WP_032751342.1\|5170642_5171284_-	OmpA family protein	NA	NA	NA	NA
WP_050597589.1\|5171295_5173248_-	hypothetical protein	NA	NA	NA	NA
5172739:5172753	attR	NA	NA	NA	NA
WP_032751341.1\|5173244_5174516_-	hypothetical protein	NA	NA	NA	NA
WP_103468913.1\|5174534_5175482_-	ATP-binding protein	A0A0R6PCP6	Moraxella_phage	6.6e-44	40.1
WP_086544347.1\|5176056_5176212_-	hypothetical protein	NA	NA	NA	NA
WP_032751340.1\|5176428_5176866_+	hypothetical protein	NA	NA	NA	NA
WP_032751339.1\|5177209_5177440_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_032751338.1\|5177564_5178977_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_086013483.1\|5179194_5180342_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
WP_095283445.1\|5180519_5181335_-	aquaporin	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	9.4e-15	29.9
WP_095283446.1\|5181380_5183201_-	diol dehydratase reactivase subunit alpha	NA	NA	NA	NA
WP_095283447.1\|5183214_5183640_-	diol dehydratase small subunit	NA	NA	NA	NA
WP_095283448.1\|5183636_5184227_-	propanediol/glycerol family dehydratase medium subunit	NA	NA	NA	NA
WP_095284383.1\|5184240_5185908_-	propanediol/glycerol family dehydratase large subunit	NA	NA	NA	NA
WP_095283449.1\|5186309_5186738_+	heme-binding protein	NA	NA	NA	NA
WP_095283450.1\|5186771_5187935_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_095283451.1\|5188004_5188370_+	hypothetical protein	NA	NA	NA	NA
WP_095283452.1\|5188372_5188921_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_095283453.1\|5188898_5190824_-	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_103468887.1\|5190948_5192049_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_103468888.1\|5192641_5193712_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_095283456.1\|5193722_5194355_+	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_103468889.1\|5194371_5195793_+	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_095283458.1\|5195877_5197530_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_032751337.1\|5199018_5199549_-	hypothetical protein	NA	NA	NA	NA
WP_000227969.1\|5200907_5201984_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

6057396 : 6069938

Escherichia_coli_O157_typing_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032750881.1\|6057396_6059874_-	phage protein	A0A0F6TK45	Escherichia_coli_O157_typing_phage	0.0e+00	84.2
WP_032750880.1\|6059877_6061686_-	hypothetical protein	A0A0F6TJQ3	Escherichia_coli_O157_typing_phage	6.8e-239	71.1
WP_077254520.1\|6061682_6063998_-	transglycosylase SLT domain-containing protein	A0A0F6R8M6	Escherichia_coli_O157_typing_phage	1.6e-107	35.7
WP_032750878.1\|6064231_6064729_-	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	3.4e-07	42.9
WP_032750877.1\|6064820_6065120_+	hypothetical protein	A0A2H4JEE3	uncultured_Caudovirales_phage	7.4e-10	40.3
WP_048252483.1\|6065187_6065697_-	hypothetical protein	H9C162	Pectobacterium_phage	6.1e-20	41.8
WP_049086103.1\|6065836_6066091_+	DUF4224 domain-containing protein	H9C153	Pectobacterium_phage	2.4e-09	46.5
WP_032750876.1\|6066400_6067663_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_004853188.1\|6067669_6068701_-	hypothetical protein	NA	NA	NA	NA
WP_001310555.1\|6068921_6069938_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP026283

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026283_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026283_1

51226-51963

Orphan

Consensus_repeat	Method
GTGGGAAACAGGTCAACT	CRT

20 spacers

The CRISPR arrays of NZ_CP026283_1

>merge|NZ_CP026283|1|51226-51963|CRT
GTGGGAAACAGGTCAACTTTATGGACGCTCAGGACTATGGGAAACAGGTCAACTTCGCGGACGGCCGGGAGTGTGGGGAACAGGTCAACTTCGCGGACGGCCCGGACTATGGGAAACAGGTCAACTTCGCGGATGGCCGGGAGTGTGGGAAACAGGTCAACTTTGCAGACGACGGGGACTGTGGGAAACAGGTCAACTCCGCGGACGGCCGGGAGTGTGGGAAACAGGTCAACTTTGCAGACGACCGGGACTGTGGGAAACAGGTCAACTCCGGGGACGGCCCGGACTATGGGAAACAGGTCAACTTTGCAGACGACCGGGACAGTGGGAAACAGGTCAACTCCGGGGACGGCCCGGACTGTGGGAAACAGGTCAACTTTGCAGATGACCGGGACTGCGGGAAACAGGTCAACTCCTCGGACAGCCAAGACTGTGGGAAACAGGTCAACTTTGCAGACGGCCGGGACTGCGGGAAACAGGTCAACTTTGCAGACGACCGGGACTGTGGGAAACAGGTCAACTCCGCGGACGGCCCGGACTATGGGAAACAGGTCAACTTTGCAGACGACCGGGACTGTGGGAAACAGGTCAACTTCGCGGACGGCCCGGACTATGGGAAACAGGTCAACTCCGCGGACGGCGCGTACTGTGGGAAACAGGTCAACTTTGCAGACGTCCGGGACTGTGGGAAACAGGTCAACTACGCGGACAGCCGGGATTGCGTGAAACAGGTCAAGT

>NZ_CP026283|1|1|51226-51963|CRT
GTGGGAAACAGGTCAACT	TTATGGACGCTCAGGACT
ATGGGAAACAGGTCAACT	TCGCGGACGGCCGGGAGT
GTGGGGAACAGGTCAACT	TCGCGGACGGCCCGGACT
ATGGGAAACAGGTCAACT	TCGCGGATGGCCGGGAGT
GTGGGAAACAGGTCAACT	TTGCAGACGACGGGGACT
GTGGGAAACAGGTCAACT	CCGCGGACGGCCGGGAGT
GTGGGAAACAGGTCAACT	TTGCAGACGACCGGGACT
GTGGGAAACAGGTCAACT	CCGGGGACGGCCCGGACT
ATGGGAAACAGGTCAACT	TTGCAGACGACCGGGACA
GTGGGAAACAGGTCAACT	CCGGGGACGGCCCGGACT
GTGGGAAACAGGTCAACT	TTGCAGATGACCGGGACT
GCGGGAAACAGGTCAACT	CCTCGGACAGCCAAGACT
GTGGGAAACAGGTCAACT	TTGCAGACGGCCGGGACT
GCGGGAAACAGGTCAACT	TTGCAGACGACCGGGACT
GTGGGAAACAGGTCAACT	CCGCGGACGGCCCGGACT
ATGGGAAACAGGTCAACT	TTGCAGACGACCGGGACT
GTGGGAAACAGGTCAACT	TCGCGGACGGCCCGGACT
ATGGGAAACAGGTCAACT	CCGCGGACGGCGCGTACT
GTGGGAAACAGGTCAACT	TTGCAGACGTCCGGGACT
GTGGGAAACAGGTCAACT	ACGCGGACAGCCGGGATT
GCGTGAAACAGGTCAAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026283.1\|WP_001277463.1\|57956_58322_-\|mercury-resistance-co-regulator-MerD	unknown	unknown	gnl\|CDD\|184299
NZ_CP026283.1\|WP_032752080.1\|48428_49403_-\|StbA-family-protein	unknown	unknown	gnl\|CDD\|310773
NZ_CP026283.1\|WP_032420949.1\|48032_48425_-\|plasmid-stability-protein	unknown	unknown	gnl\|CDD\|119304
NZ_CP026283.1\|WP_032420954.1\|44250_44538_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
NZ_CP026283.1\|WP_032420955.1\|44002_44254_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|225072
NZ_CP026283.1\|WP_000993245.1\|57445_57658_-\|DUF3330-domain-containing-protein	unknown	unknown	gnl\|CDD\|288642
NZ_CP026283.1\|WP_032420987.1\|52051_52918_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP026283.1\|WP_001087807.1\|57723_57960_-\|broad-spectrum-mercury-transporter-MerE	unknown	unknown	gnl\|CDD\|184297
NZ_CP026283.1\|WP_032752086.1\|55074_55347_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_001446012.1\|57620_57740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_013087123.1\|55947_56151_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_032752083.1\|54344_54986_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_096834042.1\|46258_47383_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_032752077.1\|42564_43836_+\|Y-family-DNA-polymerase	unknown	unknown	gnl\|CDD\|179607
NZ_CP026283.1\|WP_032752075.1\|42139_42565_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP026283.1\|WP_032752120.1\|56140_56431_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_017901448.1\|49642_50017_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026283.1\|WP_032420986.1\|53562_54345_-\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
NZ_CP026283.1\|WP_017901447.1\|50016_50649_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP026283.1\|WP_032420989.1\|45293_46040_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026283.1\|WP_001277463.1\|57956_58322_-\|mercury-resistance-co-regulator-MerD	gnl\|CDD\|184299	PRK13749, PRK13749, HTH-type transcriptional regulator MerD.	2.25165e-68
NZ_CP026283.1\|WP_032752080.1\|48428_49403_-\|StbA-family-protein	gnl\|CDD\|310773	pfam06406, StbA, StbA protein. This family consists of several bacterial StbA plasmid stability proteins.	2.0733e-126
NZ_CP026283.1\|WP_032420949.1\|48032_48425_-\|plasmid-stability-protein	gnl\|CDD\|119304	pfam10784, Plasmid_stab_B, Plasmid stability protein. This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterized.	4.87455e-25
NZ_CP026283.1\|WP_032420954.1\|44250_44538_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	8.9425e-22
NZ_CP026283.1\|WP_032420955.1\|44002_44254_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|225072	COG2161, StbD, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	9.93937e-10
NZ_CP026283.1\|WP_032420987.1\|52051_52918_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	9.83899e-54
NZ_CP026283.1\|WP_001087807.1\|57723_57960_-\|broad-spectrum-mercury-transporter-MerE	gnl\|CDD\|184297	PRK13747, PRK13747, putative mercury resistance protein; Provisional.	2.67797e-48
NZ_CP026283.1\|WP_000993245.1\|57445_57658_-\|DUF3330-domain-containing-protein	gnl\|CDD\|288642	pfam11809, DUF3330, Domain of unknown function (DUF3330). This family of proteins are functionally uncharacterized. This family is only found in bacteria.	6.39794e-25
NZ_CP026283.1\|WP_032752077.1\|42564_43836_+\|Y-family-DNA-polymerase	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	0
NZ_CP026283.1\|WP_032752075.1\|42139_42565_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	5.52492e-50
NZ_CP026283.1\|WP_032420986.1\|53562_54345_-\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	1.7463e-36
NZ_CP026283.1\|WP_017901447.1\|50016_50649_-\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.43502e-18

>NZ_CP026283.1|WP_017901447.1|50016_50649_-|ParA-family-protein
MAWIVGFISQKGGVGKSTKARALAREASACGIKTKLADLDLEQATSAEWHRRRLSAGLPPVASVEVFSTAKQAIESAGEFDLLILDGPARASKGTSEIAKVADLIVQPTGASLDDLVPAIKVFNALVKEGVPRSKLVFALSRVGTEAEELDARAYISEAGYETLAGCLFEKPAYRKAMNSGLAVTETRYKGLNERADELIQALIDKIGEE
>NZ_CP026283.1|WP_017901448.1|49642_50017_-|hypothetical-protein
MADASKLKTKRARGGLGVPPGPDEVATSLNAPEIAPAVAATDVQIQQADLSPVHHDPVGTQTVTEAYTRRDGRSARKTNRTLAFATRVTPAFDQEIRDIAEREGLKLVEVLEKAVEAYKEKQGY
>NZ_CP026283.1|WP_032752080.1|48428_49403_-|StbA-family-protein
MKIFCDDGSTNVKLAWFEGKTLKSAVSVNSFRHNWKVEGLGSSRTYNYLLDGRKYTYDPVSEAAISTTHIEYQYSDTNVLAVHHALLNSGIEPQEIDLTVTLPISEFYTADCQKNTLNIERKISNLMREVTLNKGGTFTIKSVEVMPESLPAVFTRLVADNVGQYEKSLVIDLGGTTLDVGVIVGQFEDVSAVHGNPDIGVSMVTKATLTALKMASSDTSPMIADELIKNRENLDFVGQVVNEAAKQNLVLDTIDTAIHKLGELVVDDLLQYRNVNRVYIVGGGAALIADAVRKAWNHLGEKVVLMDEPQTALVQAIARFKAEE
>NZ_CP026283.1|WP_032420949.1|48032_48425_-|plasmid-stability-protein
MHDGEERKKLSLYLHPEDSADRLALAEIETVPRKNRGELYRQALITGLIMHQLDARIPAVLTALFTRELNADEVISQIAQITGWKPSVADLKDVLAALGGNQETSSPKPSGDDVEQARLKAARTKMQNLM
>NZ_CP026283.1|WP_096834042.1|46258_47383_-|hypothetical-protein
MMDDEQSQTLNMLDVMQRDSYVETISNILDISQGNEVLKDLLLRGFYQNPNRVVHHENNSLLNRLIAAGKKSEWLCEHDGCTNPSIYSHELSERAVLSYLADDNHKAFILQRNLKNNSFEFSFEDKHIRNISNFAGYCSIHDEGLFKLIDDPGREVDLEYVNLQALKMMKRHMLDHEITLKVAKNIATEINKKIDEIKGAEQIITGLQESFDIFQQAIKDMESSSEALRVFYNNLWVGIQLREYIIDYRKIPCNKTGWVFSHSFEVIEEESHERILSFIFKVDVNQQPVLIHAWDNTTLASKHEDFYISSEKVIECMLLNKEKLVFSLGFLKTMEITHLERLLDDESIYNNVKNPVFIFLFKKIFLDELEGDLG
>NZ_CP026283.1|WP_032420989.1|45293_46040_-|hypothetical-protein
MKIELDTLSNYLIATLENHVSHSKKEPDLMWMIHEMDSFFHQEVFDHEYDANAATMLLATNSYMMLSNAVLQALSGHRVAVLPVARIALESACYAYLTSSSEKMSELWFNRDKSKTAKDNCRKAFTIGATVAKLKRISPDMSDYLKKLYELSIEYGAHPNIKAISHHLRDGGLVDDKCRVFSHTGVYGENSNQVNGALLFCVDVGQAIAFLLCASSKEHPIINERIHYFQNWMDEKNNLIDKISAEFY
>NZ_CP026283.1|WP_032420954.1|44250_44538_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MTYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCDEPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDDHLIIAVVAVGKRERSDVYNLASERMR
>NZ_CP026283.1|WP_032420955.1|44002_44254_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MPNIILSDTSASISELKKNPMATVSAGDGFPVAILNRNQPAFYCIPAELYEKMLDAMDDQELAKLVSERSNQQLLDVDLDTYL
>NZ_CP026283.1|WP_032752077.1|42564_43836_+|Y-family-DNA-polymerase
MFALADVNSFYASCEKVFRPDLRGKPVVVLSNNDGCVIARSAEAKLLGIKMGTPWFQLKEAQFPEKLYVFSSNYELYASLSNRVVALLEDLSPRVEQYSIDECFLDARGIGHCMDLEDFGRQLRGHVLSGTGLTIGVGFGATKTLAKSAQWASKEWPQFRGVLALSPDNPRRTAKLLSLQPVEEIWGVGNRIAKKLHVMGITTALQLSLTNPTFIRKNFNVVLERTVRELNGESCISLEEAPPPKQQIVCSRSFGQRITTYEEMRQAVCQYAERAAEKLRGERQYCRHISTFIKTSPFAVNEPYYGNVATEKLNTPTRDTRDIIAAAVRSLDRIWLDGHRYAKAGIMLNDFSPNGVAQLNLFDDVQPRPHSDALMKVLDGINHSGLGKVWFAGRGIAPEWQMKREMLSPAYTTRWKELPVARF
>NZ_CP026283.1|WP_032752075.1|42139_42565_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MKFIPAVSEASIVKIPLFTERCPAGFPSPAADYTESELDLNEYCIHRRHSTYFVRAIGNSMTDIGLYSGDLMVVDKAEQPRHGDIVIAEIEGEFTVKRLLLTPRPALQAMNPNFPSLYPDPETLQIFGVVTAFIHKTRRAD
>NZ_CP026283.1|WP_032420987.1|52051_52918_-|replication-initiation-protein
MGKRSSSVLTYPLVDKVQIFPVDKYRDSLQFLFSLSLWVGKNLPIGIEMDTQALLPATKTFKKRASIKQSNELTEAAYYLPLQAKRVLWLCLMQAYFNDSQEDDSDVLPLFKISVSDYVKYFNVATSVASRDVKAGVNALGESTVTFYPKEGEFEEVKRPWLAEAGMKRGRGSWQIEFNYKVMPFLVGLTSQFTTYSLYDCGQLNSVRVIRLYESLCQFRSTGVWITTHDWLCERFMLPASQKNNIAEMKRTFLEPALKKINEKTPLKVTYTTEEDGRLLFNFLDKKQ
>NZ_CP026283.1|WP_032420986.1|53562_54345_-|phage-integrase-family-protein
MDRHQLPALSGPQYSVPVVIDYPAALALRQMALVQDDLPKYLLAPEVSALLHYVPDLHRKMLLATLWNTGARINEALALTRADFSLAPPWPFVQLATLKQRTEKAARTAGRAPAGSQVHRLVPLSDANYVGQLEMMVATLKIPLERRNRRTGRTEKARLWEITDRTVRTWLAEAVAAAADDGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPEADAVALMKQLERR
>NZ_CP026283.1|WP_032752083.1|54344_54986_-|hypothetical-protein
MADWFIATEGVKVVKDSASLWPQIITAVLSAGAAFGGVWYGQWRITQREKEAAAAKLASERLFIATELVFILERFAQRCVGSAQESDGPEKYDQYGYVRIEHPIPEIDYTSVTGDWRALPSDLMYRLSELPVLRQEAASSIDATFYENTPFDGTAGISELNQQASRLGLKAIRLSRCLRHLCEMPEDRLSEQPWSAWRVRGRCIQKLTAARDN
>NZ_CP026283.1|WP_032752086.1|55074_55347_-|hypothetical-protein
MTDVQLQQKLSNSNVATIWIYQSTNNNGVVLYILNYNGHELARKEYNTRSGGWDDTTDPKMWFYPLPNNANDIDVHPIGDFSFFIAMYDF
>NZ_CP026283.1|WP_013087123.1|55947_56151_+|hypothetical-protein
MTVFLILTAIAYGIVSTGGYILLVDKGYQGWTLFWKNYDDLPHIYRSRWRYQRRFILRRIWKRLFNR
>NZ_CP026283.1|WP_032752120.1|56140_56431_-|hypothetical-protein
MNPENQQRIREMIESGEFNGYTLVSGEDWQLPTARETTFVRGLIPLTDIQLANRLNVDERTVRKWKSGQTRMVFTTWCCLCWLAGLGMLLDNLLSD
>NZ_CP026283.1|WP_000993245.1|57445_57658_-|DUF3330-domain-containing-protein
MNANAPNTASCTTCCVCCKEIPLDAAFTPEGAEYVEHFCGLDCYERFQARAKAATESDIAPVPGGSQPSD
>NZ_CP026283.1|WP_001446012.1|57620_57740_+|hypothetical-protein
MVQLAVFGAFAFMVVLLQIGSEAQSCPLSAGWEAVMIFP
>NZ_CP026283.1|WP_001087807.1|57723_57960_-|broad-spectrum-mercury-transporter-MerE
MNSPEHLPSETHKPITGYLWGALAVLTCPCHLPILAIVLAGTTAGAFIGEHWGIAALTLTGLFVLSVTRLLRAFKGRS
>NZ_CP026283.1|WP_001277463.1|57956_58322_-|mercury-resistance-co-regulator-MerD
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDTALQRLRFVRAAFEAGIGLDALARLCRALDAADGDGASAQLAVLRQLVERRREALASLEMQLAAMPTEPAQHAESLP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1231 : 54345

Shigella_phage(13.04%)

integrase,transposase

attL 37195:37208|attR 54428:54441

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032752147.1\|1231_1399_-\|integrase	integrase	NA	NA	NA	NA
WP_004118843.1\|2399_3326_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	4.2e-19	28.7
WP_032752149.1\|4002_9894_+	DUF3320 domain-containing protein	NA	NA	NA	NA
WP_097311113.1\|10008_11215_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.6e-103	64.0
WP_086013483.1\|13086_14234_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
WP_004182074.1\|15201_15615_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004152721.1\|15615_15894_-	helix-turn-helix transcriptional regulator	O64356	Escherichia_phage	2.5e-07	39.4
WP_004152720.1\|15883_16204_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	6.8e-09	39.5
WP_020325128.1\|16284_16509_-	hypothetical protein	NA	NA	NA	NA
WP_032752153.1\|16519_16732_-	hypothetical protein	NA	NA	NA	NA
WP_019706019.1\|16792_17149_-	hypothetical protein	A0A248SL90	Klebsiella_phage	4.4e-25	58.1
WP_023320095.1\|17780_18131_-	hypothetical protein	NA	NA	NA	NA
WP_011787830.1\|18627_21708_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.2e-51	30.6
WP_011918375.1\|21731_22043_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011787805.1\|22042_22303_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_011787804.1\|22472_23093_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-26	37.1
WP_011787803.1\|23210_23543_-	conjugal transfer protein TraR	NA	NA	NA	NA
WP_011787802.1\|23633_24488_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-67	48.6
WP_011787801.1\|24522_26013_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-224	82.2
WP_032752057.1\|26530_27016_+	hypothetical protein	NA	NA	NA	NA
WP_032426744.1\|27176_27338_-	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_032752058.1\|27554_27881_-	hypothetical protein	NA	NA	NA	NA
WP_032752059.1\|27877_28606_-	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_032752061.1\|28602_29034_-	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_032752064.1\|29078_31079_-	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	7.2e-24	26.3
WP_032752067.1\|31147_31396_-	DUF905 domain-containing protein	NA	NA	NA	NA
WP_032752069.1\|31444_31984_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	9.2e-51	73.2
WP_032752071.1\|32789_33353_-	methyltransferase	A0A2I7RHK4	Vibrio_phage	2.6e-19	34.8
WP_032752072.1\|33400_34756_-	DUF3560 domain-containing protein	NA	NA	NA	NA
WP_001568051.1\|34807_35038_-	hypothetical protein	NA	NA	NA	NA
WP_032420961.1\|35129_35357_-	hypothetical protein	NA	NA	NA	NA
WP_032420959.1\|36085_36403_-	hypothetical protein	NA	NA	NA	NA
WP_032420958.1\|36437_36692_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.3e-12	51.3
WP_004118478.1\|36928_37354_-	antirestriction protein	NA	NA	NA	NA
37195:37208	attL	NA	NA	NA	NA
WP_110222094.1\|37573_37651_-	DUF1472 domain-containing protein	NA	NA	NA	NA
WP_004206779.1\|37876_38107_-	hypothetical protein	NA	NA	NA	NA
WP_004152765.1\|38340_39825_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_032751822.1\|40249_41734_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.1e-29	34.1
WP_032752075.1\|42139_42565_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.4e-30	49.6
WP_032752077.1\|42564_43836_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	3.3e-155	63.7
WP_032420955.1\|44002_44254_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_032420954.1\|44250_44538_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.7e-19	47.4
WP_032420989.1\|45293_46040_-	hypothetical protein	NA	NA	NA	NA
WP_096834042.1\|46258_47383_-	hypothetical protein	NA	NA	NA	NA
WP_032420949.1\|48032_48425_-	plasmid stability protein	NA	NA	NA	NA
WP_032752080.1\|48428_49403_-	StbA family protein	A0A222YXF2	Escherichia_phage	2.9e-71	44.2
WP_017901448.1\|49642_50017_-	hypothetical protein	NA	NA	NA	NA
WP_017901447.1\|50016_50649_-	ParA family protein	A0A0K1LMB9	Rhodobacter_phage	1.8e-29	39.6
WP_032420987.1\|52051_52918_-	replication initiation protein	A0A222YYK1	Escherichia_phage	1.5e-23	31.1
WP_032420986.1\|53562_54345_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	2.9e-53	92.1
54428:54441	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP026279

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026279_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026279_1

409-531

Orphan

Consensus_repeat	Method
TTTCTGTATTGTGCAATACAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP026279_1

>merge|NZ_CP026279|1|409-531|PILER-CR
TTTGTGTATTGTGCAATACATCTTTTTTCACCTGCTCAGACTTCGCGGGTTTTTCTGTATTGTGCAATACAGGTTTCTTCTGTTGCTCACTGGCTCCGGCTGATTTTGTATTGTGCAATACAG

>NZ_CP026279|1|1|409-531|PILER-CR
TTTGTGTATTGTGCAATACAT	CTTTTTTCACCTGCTCAGACTTCGCGGGTT
TTTCTGTATTGTGCAATACAG	GTTTCTTCTGTTGCTCACTGGCTCCGGCTG
ATTTTGTATTGTGCAATACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026279.1\|WP_046092601.1\|8317_8785_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197267
NZ_CP026279.1\|WP_020323171.1\|1621_3154_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|238547
NZ_CP026279.1\|WP_102765493.1\|11026_11890_-\|TrbG/VirB9-family-P-type-conjugative-transfer-protein	unknown	unknown	gnl\|CDD\|274296
NZ_CP026279.1\|WP_020323165.1\|8841_9843_-\|Flp-pilus-assembly-complex-ATPase-component	unknown	unknown	gnl\|CDD\|274301
NZ_CP026279.1\|WP_020323170.1\|7031_7394_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_020323155.1\|1403_1622_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_020323153.1\|9893_11027_-\|TrbI/VirB10-family-protein	unknown	unknown	gnl\|CDD\|319755
NZ_CP026279.1\|WP_020323154.1\|3158_6377_+\|conjugative-relaxase	unknown	unknown	gnl\|CDD\|378042
NZ_CP026279.1\|WP_032416518.1\|8009_8321_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_020323157.1\|6373_7039_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026279.1\|WP_020323171.1\|1621_3154_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|238547	cd01127, TrwB, Bacterial conjugation protein TrwB, ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.	3.92291e-152
NZ_CP026279.1\|WP_020323153.1\|9893_11027_-\|TrbI/VirB10-family-protein	gnl\|CDD\|319755	cd16429, VirB10, VirB10 forms part of core complex in Type IV secretion system (T4SS). This family contains VirB10, a component of the type IV secretion system (T4SS), including homologs TrbI, TraF, TrwE and TraL. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both, the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TrwE in R33 plasmid has been shown to be anchored to the inner membrane and its C-terminal is necessary for conjugation; the transmembrane domains of TrwB and TrwE are involved in TrwB-TrwE interactions. TraF protein of the RP4 plasmid is involved in circularization of pilin subunits of P-type pili. In gonococcal genetic island (GGI) of Neisseria gonorrhoeae, T4SS encodes TrbI and circularization occurs via a covalent intermediate between the C terminus of putative pilin protein TraA and TrbI.	1.23869e-69
NZ_CP026279.1\|WP_046092601.1\|8317_8785_-\|phospholipase-D-family-protein	gnl\|CDD\|197267	cd09170, PLDc_Nuc, Catalytic domain of EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Catalytic domain of an EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Nuc is an endonuclease cleaving both single- and double-stranded DNA. It is the smallest known member of the phospholipase D (PLD, EC 3.1.4.4) superfamily that includes a diverse group of proteins with various catalytic functions. Most members of this superfamily have two copies of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue) in a single polypeptide chain and both are required for catalytic activity. However, Nuc only has one copy of the HKD motif per subunit but form a functionally active homodimer (it is most likely also active in solution as a multimeric protein), which has a single active site at the dimer interface containing the HKD motifs from both subunits. Due to the lack of a distinct domain for DNA binding, Nuc cuts DNA non-specifically. It utilizes a two-step mechanism to cleave phosphodiester bonds: Upon substrate binding, the bond is first attacked by a histidine residue from one HKD motif to form a covalent phosphohistidine intermediate, which is then hydrolyzed by water with the aid of a second histidine residue from the other HKD motif in the opposite subunit.	3.58823e-70
NZ_CP026279.1\|WP_020323165.1\|8841_9843_-\|Flp-pilus-assembly-complex-ATPase-component	gnl\|CDD\|274301	TIGR02788, conjugal_transfer_protein, P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.	1.43101e-76
NZ_CP026279.1\|WP_020323154.1\|3158_6377_+\|conjugative-relaxase	gnl\|CDD\|378042	pfam08751, TrwC, TrwC relaxase. Relaxases are DNA strand transferases which function during the conjugative cell to cell DNA transfer. TrwC binds to the origin of transfer (oriT) and melts the double helix.	4.74334e-97
NZ_CP026279.1\|WP_102765493.1\|11026_11890_-\|TrbG/VirB9-family-P-type-conjugative-transfer-protein	gnl\|CDD\|274296	TIGR02781, Protein_virB9, P-type conjugative transfer protein VirB9. The VirB9 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in a type IV secretion system . VirB9 is a homolog of the F-type conjugative transfer system TraK protein (which is believed to be an outer membrane pore-forming secretin, TIGR02756) as well as the Ti system TrbG protein. [Cellular processes, Conjugation].	2.29262e-61

>NZ_CP026279.1|WP_020323155.1|1403_1622_+|hypothetical-protein
MSAFSSELKGLVKQLSQLKLPPPGQMMLHESLAIETVILLRSMATPANMKSAWGELERNGYKVWESKQERTE
>NZ_CP026279.1|WP_020323171.1|1621_3154_+|type-IV-secretion-system-DNA-binding-domain-containing-protein
MTEQERGLIFLCSLLGPIPFVWFITAKFVYGINSETAHYLVPYLLKNTFNLWPLWVSIIAGSVIGLCGFIGFIIYDKGRVYKGPRFKRVLRGTKLVRASSLAEKTKERGHKQLTVAGVPVPTEYETLHFSIGGATGTGKSTIIKEAIYSSLKRGRDKRVILDPNGEYVETFYRENDIILNPYDKRSPGWSMFNEIRDEFDYDLYAVSIIQESKERSAEEWYRYGRLLYREVSKKLLTHKRNPSMEEVLYWCNVAEYDKVKDFVKGTPAESLFIKGAERATGSARFVLGDKLASHLKMPEGNFSLRDWLEDDKPGTLFITWQEQMKKSLNPLISCWLDIMFSSLLGMGKRDQRTLFFIDELESLEYLPNLQDLLTKGRKSGASVWAGYQTFSQLVERYGINIAETLLGSMRSGIVMGSSRLGKATLEHMSRALGEIEGEIERRQGSLLQSGPNNRPRIETRTVRAVTPTEISELRNLTGYIYFPGDLPVGKFKTKHVQYTRKNPVPGIIMR
>NZ_CP026279.1|WP_020323154.1|3158_6377_+|conjugative-relaxase
MLDITTITRIDIASVVGYYADAKDDYYSKDSSFTAWHGQGAEALGLSGEVSSQRFKELLVGEIDPFTQMKRSSGDATKERLGYDLTFSAPKGVSMQALIHGDKAIIAAHEKAVAAAVQEAEKLAQARTTHAGKTITQNTGNLVVASFRHETSRALDPELHTHAFVMNMTQRGDGQWRALKNDELMRAKMHLGDVYKQELALELTKAGYELRYNNKNNTFDMAHFTDEQIRGFSRRSAQIEEGLAAMGLTRETADAQTKSRVSMATRDKKTDDYSREDIHKEWVNRANELGIDFNDLSWAGKGKDGPQTSMNTVPNFTSPEVKADRAIQFALKSLSERDASFDQSRLLAVANKKAIGQASKQDIEAAYYRAVAKGAIIEGEARYTTTTDQRSKDAPPLPAMTKAEWQAQLTDKKGMNNGQAKALVAEGIKSGRLKKTSHRVTTVEGIRVEKAVLNIEARGRGKVIAALTSEQVTAQLVGKTLKAEQQKSVVDICTTTDRFVAAHGFAGTGKSYMTMSAKAVLESQGFHVTALAPYGTQKKSLEDEGMPARTVAAFVKAKDKKIDEKSVVFIDEAGVIPARQMKVLMETIEKAGARAVFLGDTSQTKAVEAGKPFEQLISAGMQTSYMKDIQRQKNDVLLEAVKLAAEGHISGSLARLSNISAEKDQDKRLEAVANRWLSFSPEQREGTLIISGTNESRVILNSQIREALQLQGKGVEVNFLERVDSTQAERRDSKYYQVGQIIIPEKDYKNGLQRGESYRVLDTGPGNLLTVAGSDGQKISFSPRTHKNLSVYTSVAAELAVGDKVMVTRNDKTLDVANGDRFTVTGATEKGTFTLTNAKGREIELDQKQAAYLSYAYATTVHKAQGLTCDRVLFNIDTRSLTTSKDVFYVGISRARHEVEIFTDDKGRLLSSASRNSPKTTASEIDRFLGMEERYKDVNRSYGHDDGQQAKSYGHEAGQQTGEKENTMKNATEAAHDGPDTSGTENTSQDLRQREQEEVNAAIRYEQRQEATPEMEANPYHDYERYADEGPDYGDMQDYSTYEEYERARDVELPQHEHENHQHDYDKEGYGL
>NZ_CP026279.1|WP_020323157.1|6373_7039_+|hypothetical-protein
MMFWNRNKKEKAAAGNEKNRFDHLLSVAEKLPVEALPDLIRAIVRPVQSDFLLAVAEEGTDARPDMTPQEFFFEGLIQVQSYEKMKEGELDGADYPLSLASDMVLPWPWSLTRYIDNVSHIGTRKGRPWKQDKINHYVDLWLPWRIGFVRGGNHSITAGILAGEGTVIPEHVYDMSWLFELVRTDGNHWFVDGQKAEAVKSGRSAAVFEIGRLLTEGAKNG
>NZ_CP026279.1|WP_020323170.1|7031_7394_+|hypothetical-protein
MGEQITNAEWEKISPDNFETASLLRAVDAIDDLRGDFSDGEYSAPPQIRTDLLRLHEIAMAVINEGSRSRVSALFELASDLDEQISHLVNRLDEVQDTLSQLMELYPESLYYDDIEGDEE
>NZ_CP026279.1|WP_032416518.1|8009_8321_-|hypothetical-protein
MREKFERYIFKHAVQPLKLLAVVAIVAELSRRGLMFIGVPAFTSFITNMLGILIIMLMQKPIMIRGVYETKDRSSSYRWMHFAITGLQSMSVVVLLLIPIYER
>NZ_CP026279.1|WP_046092601.1|8317_8785_-|phospholipase-D-family-protein
MAGDSPSVQVGFSPEGSAQTLVIGAIDSAQSSIRMMAYSFTAMDIMQALVKAKNRGVDVKIVIDERGNRNDVSHRAMKFIVKNEIPLRVDSDFPIQHDKVMIIDERSVQTGSFNYTKAAESKNSENAVVIWNMPQLAKPYLEHWKDRWDRGEDYK
>NZ_CP026279.1|WP_020323165.1|8841_9843_-|Flp-pilus-assembly-complex-ATPase-component
MNQSSAYYQLGPLREYFEDPGVFEIRINRYNEVVCDTFEGRKIIQNDSITGAFIDNLTAALTSANDVKRQMINDVVLPDGSRGIICLPPAVIDNTAAIAFRKNIALDKDLATLSKEGIFEFCREIDSHKRELDDDDLLLKELYRAKRREEFLLTAVRKKRTVVVVGETGSGKTVLTRALLKAISPQERVIIMEDAHEVEATHLEEAVYMKYGGKDKPGLATPTQCLKACMRLTPDRIFMTELRDDAAWDYLQALNTGHPGGLTSTHANSAMDAFTRIGLMVKATEVGRMLDISDIMRLLHSTIDVVVFMAKRKIREIYYSPEYKYECMNGGIK
>NZ_CP026279.1|WP_020323153.1|9893_11027_-|TrbI/VirB10-family-protein
MARKVDIDSELDNNNSFDDERGGMPAQKRRTAPGLKAFIAILAIIAMCFVGVTIYTHTRKAPDTAKADSGNKNDGVSSLPNYQFNTNPNVGGAAAPDANQKAMQDKARAEYEASHSNAGRASNGKKQLTPEEVAMQRRLGGDLSGEQGGSQTPAKKEQQSDEGSEGSSALAKELTPARLKGSRAGVMQNMSMTIAKGTMIPCGTSTELDTTVPGMVSCRVTRDVYSLDGLVKLIDKGAFVTGQMNGGLKNGQARVFVLWERVVNPDGTFVNLDSAGTNSLGSSGVPGQVDSHFWDRFEGAVFISVLSDALQAGVAAAQNGNNIQFSNTQNNSQELASEALRATINIPPTLYDQQGDAISIYVVRDLDFSDIYSLADN
>NZ_CP026279.1|WP_102765493.1|11026_11890_-|TrbG/VirB9-family-P-type-conjugative-transfer-protein
MIAMALAGATFNAAALQAPKSSPYDYRIKTVVYNPVDVVRIDAVVGLFTHIVVAPDETYITHAFGDSDGWTFSHKLNHMFVKPKREMSDTNLTIVTDKRSYNIVLHYIGDTTTKNADGTETKSFIKTPWSMKQATLQLTYEYPFDEQKKASSAAEKKRLTEKLRESAFAGPKNYQYEMSDEPEMADIQPIHVWDNYRFTRFEFPENADLPQVYYISSSGKETLPNCRPVGEHNNILECQNVAKEWRVRLGWTKVVGIRNINYVPSAGAISTGTASPDVRRVQKGGDN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026279_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026279_2

23195-23292

Orphan

Consensus_repeat	Method
AGATAAATCCCCCCCCCTAAACCGAGATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026279_2

>merge|NZ_CP026279|2|23195-23292|CRISPRCasFinder
AGATAAATCCCCCCCCCTAAACCGAGATATATTACCCCCCCCTAGCAAGATAAATTGCCCCCCTAACCGAGATAAATCCCCCCCCCTAAACCAAGATA

>NZ_CP026279|2|1|23195-23292|CRISPRCasFinder
AGATAAATCCCCCCCCCTAAACCGAGATA	TATTACCCCCCCCTAGCAAGATAAATTGCCCCCCTAACCG
AGATAAATCCCCCCCCCTAAACCAAGATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026279.1\|WP_032416645.1\|19999_20224_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_020323168.1\|21776_22109_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_009652789.1\|28634_29108_+\|MFS/sugar-transport-domain-protein	unknown	unknown	gnl\|CDD\|236610
NZ_CP026279.1\|WP_032449364.1\|27392_27677_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_032416643.1\|20227_20536_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_009652788.1\|29119_30613_+\|alpha-N-arabinofuranosidase	unknown	unknown	gnl\|CDD\|226064
NZ_CP026279.1\|WP_020323149.1\|24151_24685_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP026279.1\|WP_032416587.1\|18335_19118_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381613
NZ_CP026279.1\|WP_020323174.1\|26416_26980_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_032449362.1\|21002_21611_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP026279.1\|WP_020323151.1\|23705_24035_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374591
NZ_CP026279.1\|WP_032416642.1\|19538_19889_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227596
NZ_CP026279.1\|WP_001642212.1\|25682_26105_+\|ArdB-protein	unknown	unknown	gnl\|CDD\|377006
NZ_CP026279.1\|WP_032449363.1\|26963_27344_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_020323175.1\|26221_26413_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026279.1\|WP_006118530.1\|20820_21006_+\|ribbon-helix-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|289422
NZ_CP026279.1\|WP_032449361.1\|19217_19535_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP026279.1\|WP_020323160.1\|24714_25503_-\|SprT-like-family-protein	unknown	unknown	gnl\|CDD\|370932
NZ_CP026279.1\|WP_015060075.1\|17792_18089_-\|conjugal-transfer-protein-TraM	unknown	unknown	gnl\|CDD\|368210
NZ_CP026279.1\|WP_020323144.1\|22248_23130_+\|plasmid-encoded-RepA-protein	unknown	unknown	gnl\|CDD\|309782

Protein	Function_ID	Function_description	E-value
NZ_CP026279.1\|WP_020323149.1\|24151_24685_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.58918e-85
NZ_CP026279.1\|WP_009652789.1\|28634_29108_+\|MFS/sugar-transport-domain-protein	gnl\|CDD\|236610	PRK09669, PRK09669, putative symporter YagG; Provisional.	9.51947e-27
NZ_CP026279.1\|WP_009652788.1\|29119_30613_+\|alpha-N-arabinofuranosidase	gnl\|CDD\|226064	COG3534, AbfA, Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].	0
NZ_CP026279.1\|WP_020323160.1\|24714_25503_-\|SprT-like-family-protein	gnl\|CDD\|370932	pfam10263, SprT-like, SprT-like family. This family represents a domain found in eukaryotes and prokaryotes. The domain contains a characteristic motif of the zinc metallopeptidases. This family includes the bacterial SprT protein.	5.57072e-11
NZ_CP026279.1\|WP_032416587.1\|18335_19118_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381613	cd16892, LT_VirB1-like, VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	5.40103e-69
NZ_CP026279.1\|WP_032449362.1\|21002_21611_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	4.55012e-61
NZ_CP026279.1\|WP_020323151.1\|23705_24035_+\|hypothetical-protein	gnl\|CDD\|374591	pfam16509, KORA, TrfB plasmid transcriptional repressor. KORA is a family of Gram-negative bacterial proteins that act as global repressors of genes involved in plasmid replication, conjugative transfer and stable inheritance in the IncP group of plasmids. KORA operates as a symmetric dimer, and contacts the DNA via the helix-turn-helix region at the N-terminus.	2.69416e-20
NZ_CP026279.1\|WP_032416642.1\|19538_19889_+\|hypothetical-protein	gnl\|CDD\|227596	COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only].	0.00565211
NZ_CP026279.1\|WP_006118530.1\|20820_21006_+\|ribbon-helix-helix-domain-containing-protein	gnl\|CDD\|289422	pfam12651, RHH_3, Ribbon-helix-helix domain. This short bacterial protein contains a ribbon-helix-helix domain that is likely to be DNA-binding.	2.78035e-11
NZ_CP026279.1\|WP_032449361.1\|19217_19535_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	3.19518e-11
NZ_CP026279.1\|WP_020323144.1\|22248_23130_+\|plasmid-encoded-RepA-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	1.86101e-26
NZ_CP026279.1\|WP_015060075.1\|17792_18089_-\|conjugal-transfer-protein-TraM	gnl\|CDD\|368210	pfam04956, TrbC, TrbC/VIRB2 family. Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure. This family also contains several VIRB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species.	0.00593557
NZ_CP026279.1\|WP_001642212.1\|25682_26105_+\|ArdB-protein	gnl\|CDD\|377006	pfam03230, Antirestrict, Antirestriction protein. This family includes various protein that are involved in antirestriction. The ArdB protein efficiently inhibits restriction by members of the three known families of type I systems of E. coli.	2.16047e-18

>NZ_CP026279.1|WP_020323144.1|22248_23130_+|plasmid-encoded-RepA-protein
MAEDRKQLTKRQQKAIDTAALIRQEPPQGDDMAFTHSILCQVGLPRSKVEGREFMRRSGDAWLVVQAGWLDEGNGPVEQPLPYGAMPRLTFAWISSYALRNKTREIAIGHSASEFLRLMGMELQGARHRTLRIQMQALAACRLQLGFKGRTYNGQPVEQFDAWLKDGDTKQLTLWPGTLTLSEGYYNGLIESAVPLDNRALHVLKGSALALDIYAWLAHRLHRIEGRPVMLYWMKLREQFAQEYSGKNADKDFKRAFMPALKQVLSVYPAAKVDQVKGGLLLYSSPPPIPYKS
>NZ_CP026279.1|WP_020323168.1|21776_22109_-|hypothetical-protein
MTERQQNRNICVVGKVKDGMTIDTSKIKIEDVSERVISIDDSFNTEDATLSLRTVMRNVATRIYLPSVLKGACPAFEAWADKRSVGEKLPRGKYFKSREFIRQFKIQNYV
>NZ_CP026279.1|WP_032449362.1|21002_21611_-|recombinase-family-protein
MYIFGYLRASAHDQDASRAQQRLKAFALEHNHRVAGWYVENASGASLQRPELMRLLNDAEKGDLILIEQVDRLSRLDDEGWQQLKRMMQEKNLAIISLDLPTSYAALMPHGSDEFTRSMLTAINSMMLDMLAAIARKDYTDRRRRQQEGVRKAKEKGVYRGRMPDQNKHDLIRSLRHQGKSISETARLAGVSERTVTRVSKS
>NZ_CP026279.1|WP_006118530.1|20820_21006_+|ribbon-helix-helix-domain-containing-protein
MAEPYLKNRRRFTSSLDNQLVPLFDALAAKTRIPKSRLLDEAIEDLLVKHGVPGKQVDSQN
>NZ_CP026279.1|WP_032416643.1|20227_20536_+|hypothetical-protein
MKKLIPAIIAAALLSGCATQNDAVALSNRISDQQKQINALSVRLQSAEHRLSQQESAFRSEQTQNSSYCYLNGVKYSQGSVFAGRICDGSSGSAAWRLYSHR
>NZ_CP026279.1|WP_032416645.1|19999_20224_+|hypothetical-protein
MAGKLQGNEATSGPDCVMGRQSFFEIRIYTPYYNPGATAAARKVFLSSCPMTTISENKNTLELIIQRYGRSFQE
>NZ_CP026279.1|WP_032416642.1|19538_19889_+|hypothetical-protein
MGNVIEFKRPKGERNQKDKMPKRGILLWFKKTALSLKNNLFTYSKSCCCICLFFVSAASRKLLKLIATLSIVLFLVEWFMGRLGAPEFYNLLFLMGLLLVINVISTSCIKWIRGNV
>NZ_CP026279.1|WP_032449361.1|19217_19535_+|H-NS-histone-family-protein
MLVPLQSEKRPKGTPVYRDPENPFNTWSGYGKRPVWLQERLSDGYLLDEMKLPGAVVDRDTKSPRYRDPANPDNTWTGVGRRPKWLVELLENGVDLDDLKIRERE
>NZ_CP026279.1|WP_032416587.1|18335_19118_-|lytic-transglycosylase-domain-containing-protein
MKKTWCLIAVCISGLSFQGVAHAASASDTIASLAARCAPDVSPLTMAYIVGHESGNNPYFINVNRGASLKRQPQTEAEAVEVANRLIKNLKKDESIDMGLAMINSNNLSSLGITVEQVFKPCINLRASQTILKDCYSTALKSNPPGQIALRHALSCYNTGSQVRGISNGYVTKVINVAKQSDLKIPTLLPDGQNEEAESQPVSAKGATFEGEHDAFTGESDSGGDVFSQDNTDAFLTKAEQKGSEVMNDKNLSPVAVSNN
>NZ_CP026279.1|WP_015060075.1|17792_18089_-|conjugal-transfer-protein-TraM
MVTFFKNNGFALLVALLCIAAPELALAAGGADTGASTGNNIKSWLDTWIPIACTIGVIVSFLVWLFHLISAGFMFRLAIAMVGIGSASYLVSLTGIGS
>NZ_CP026279.1|WP_020323151.1|23705_24035_+|hypothetical-protein
MARKQTRSMTQEEWDRLLPAMQTFTHLSTEIGHSVLVKGESNKDVAERVGRTKQNVGSTVKRIWDLYQSVAVDFEGEKLRKVDVWLPEKMALKVLKEAEKYAINQNKTE
>NZ_CP026279.1|WP_020323149.1|24151_24685_+|single-stranded-DNA-binding-protein
MASRGVNKVILVGNLGQDPEMRYMPNGGAVANLRLATSESWRDKATGEQKEVTEWHTVVIFGKLAEIAGEYLRKGSQVYIEGQLRTRKWQDKDQQDRYSTEVVVSMNGVMQMLGGRQGGGAPAGQGGQQQFSGGGAPAAAPGTQGQQPQQGAMPDFEDDIPFAPVTLPFPNHAIHAL
>NZ_CP026279.1|WP_020323160.1|24714_25503_-|SprT-like-family-protein
MTLPTPETYEELQHAYDFFDERLFNNELPPCLITLQREKRTYGYCSFQRFVGRESGQMVDEIAMNPVFFSIRTIKATLSSLVHEMVHQWQYHFGKAGRRGYHNKEWSAMMERIGLMPSDTGQPGGRKVGQSMAHYIITGGAFDRACDELLTRNFQLSWMDRFPPFQPKPGAPQSPSGKGYIDDENDDREYPPDDDYTDEPGELDNEIIEAMKFVSPPPETPVNKSNRAKYTCPVCHVNLWGKPGLVVFCGGEHCEKAELQPS
>NZ_CP026279.1|WP_001642212.1|25682_26105_+|ArdB-protein
MANTVTAKIYGPAQKMRFLPYAFAEFYLQAENYVCSFMKKYAVGYDGGCWEYITYENGACAFIAPDGYQLTLPNYFDEPVSAKEAGIIVALYAYSHFCCVAFERGWQRVNETMAERYHTLRDFTETLPPESQSRIFRAID
>NZ_CP026279.1|WP_020323175.1|26221_26413_+|hypothetical-protein
MASVRFWPDIQETIFPPLQVPEGKRRVVRCRCGINDWNEDGRWLGEYCCASCGQYIQVFEKKD
>NZ_CP026279.1|WP_020323174.1|26416_26980_+|hypothetical-protein
MAFDFKKEDAAKYGREVYRAFRSKGNHRWDTCVFVNESGAYSAVFRHSFRKKVIEDGKEIRRNVIDDEIVVAAPDAGSFTRAKFPQLADAKELKQSGFFARLRFVAEASAYREAWPGHDGGVVLIWEGKAYGWKNCLRDAHHERPGAIAIDTNGHVFIAEGGNEYDGAKCWVAMTGDITEGDNGDKS
>NZ_CP026279.1|WP_032449363.1|26963_27344_+|hypothetical-protein
MVIKVNGVALLAILFISATAMAGIKSPIKVVSLIDFRGDNQELMVRDTESQCDYHVAVTKSEKNIEWLGVTLPQSRWEFVVDRRKCGDIIERVNMQIVPDTKIKTLPIEAGSVYYIYPDWDAFSQK
>NZ_CP026279.1|WP_032449364.1|27392_27677_+|hypothetical-protein
MEQPTDMFSMYLKFIPVILAVIFWIYCLSSKYSLSRMETMRQLKRWYDLPRASATENKEETLNNMIAAEQKRAALSFRTAIVFTAIAIFWLVYI
>NZ_CP026279.1|WP_009652789.1|28634_29108_+|MFS/sugar-transport-domain-protein
MKLYIYVGFITAAISILIYFIDPRNIETIFALNTLRGYIGAITVPIFWSFIGDADDFGAWKFKRRMSGVYASGNLFALKVSLAIAGTITATILSLTHYVPDAPQQTPETLNAIMLLITVIPAAGSIITSLLFLFFYKLDTRMMNEIQTDLKANHYPA
>NZ_CP026279.1|WP_009652788.1|29119_30613_+|alpha-N-arabinofuranosidase
MSKLHFAITPDNRIAEINPRLFGSFVEHLGRAVYTGIYEPGHPEADAQGFRQDVINLVKEMNVTTVRYPGGNYVSGFNWRDGIGPKEERPVRLDYAWISKESNQFGISEFNHWCQQTHVEPMIAINLGTGTPQEAGYFIEYCNHPGGTTLSDLRVQHGDAEPYNFKLWCLGNEMDGPWQTGQMSADDYAKKARETAKILRCVDPEVELIACGSSSSMMDTFPTWDRVVLEELYDYVDYISCHQYYENEGTESDFLASFVNMDNFIETIVSTANYVKAYKRGKKDIMISFDEWNVWYLRGDPWDAPMKHKENRFKVAPPLLEDRYSFLDALVVGGLLCSLINHCDRVKMASLAQLVNVIAPIFTEAGGGVIRQTIFWPFAMVANVAKGSALRHFIPAGTFSSKYGDARRIQSAVVHNAAAGKLYLFALNSDFHDSFTLDPDLSAFGQTRLAEHQILRCDDLYAKNTFDRPDRVAPETLTASDLTLPPLSWNRITFDIL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	430-459	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_KX784503	Citrobacter freundii strain 17285 plasmid p17285-IMP, complete sequence	10818-10847	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_KX784502	Klebsiella oxytoca strain 7121 plasmid p7121-IMP, complete sequence	10803-10832	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_KT148595	Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence	31444-31473	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_KT345947	Klebsiella pneumoniae strain 2013050801 plasmid p0801-IMP, complete sequence	10925-10954	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP010378	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence	51328-51357	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	MK368725	Escherichia coli strain JN24 plasmid pJN24NDM1, complete sequence	10938-10967	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NC_019163	Klebsiella pneumoniae plasmid pTR4, complete sequence	10936-10965	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	139306-139335	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP029112	Escherichia coli strain AR436 plasmid unnamed3, complete sequence	51995-52024	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP026205	Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence	62-91	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP034398	Escherichia coli strain CRE1 plasmid pCRE1.4, complete sequence	8399-8428	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP042548	Klebsiella michiganensis strain C52 plasmid pC52_003, complete sequence	16610-16639	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NC_015872	Escherichia coli plasmid p271A, complete sequence	20501-20530	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP027137	Escherichia coli strain AR_0369 plasmid unnamed1, complete sequence	47619-47648	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP026232	Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence	47721-47750	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP019907	Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence	18681-18710	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NC_024954	Escherichia coli strain ECS01 plasmid pNDM-ECS01, complete sequence	10938-10967	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	52732-52761	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP034403	Escherichia coli strain CRE10 plasmid pCRE10.4, complete sequence	34770-34799	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_EF219134	Klebsiella pneumoniae isolate JIE137 plasmid pJIE137, complete sequence	51099-51128	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP022277	Citrobacter freundii strain 18-1 plasmid pD18-1, complete sequence	20194-20223	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP050010	Citrobacter sp. Y3 plasmid unnamed1, complete sequence	32499-32528	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	20352-20381	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP024879	Klebsiella pneumoniae strain NH25 plasmid pNH25.5, complete sequence	34877-34906	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP043856	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence	320-349	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP026184	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence	39054-39083	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	33174-33203	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP040826	Enterobacter cloacae strain NH77 plasmid pEcloNH77, complete sequence	29868-29897	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP043516	Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence	44808-44837	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP027125	Escherichia coli strain AR_0374 plasmid unnamed3	3425-3454	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	481-510	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_KX784503	Citrobacter freundii strain 17285 plasmid p17285-IMP, complete sequence	10869-10898	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_KX784502	Klebsiella oxytoca strain 7121 plasmid p7121-IMP, complete sequence	10854-10883	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP015078	Escherichia coli strain Ecol_448 plasmid pEC448_OXA163, complete sequence	32880-32909	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_KT148595	Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence	31495-31524	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_KT345947	Klebsiella pneumoniae strain 2013050801 plasmid p0801-IMP, complete sequence	10976-11005	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP034403	Escherichia coli strain CRE10 plasmid pCRE10.4, complete sequence	34719-34748	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP010378	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence	51379-51408	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_EF219134	Klebsiella pneumoniae isolate JIE137 plasmid pJIE137, complete sequence	51048-51077	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	MN967025	Klebsiella pneumoniae strain KP2611 plasmid pKP2611-N, complete sequence	11482-11511	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP022277	Citrobacter freundii strain 18-1 plasmid pD18-1, complete sequence	20143-20172	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	MK368725	Escherichia coli strain JN24 plasmid pJN24NDM1, complete sequence	10989-11018	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NC_019163	Klebsiella pneumoniae plasmid pTR4, complete sequence	10987-11016	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	139357-139386	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP050010	Citrobacter sp. Y3 plasmid unnamed1, complete sequence	32448-32477	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	20301-20330	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP024879	Klebsiella pneumoniae strain NH25 plasmid pNH25.5, complete sequence	34826-34855	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP029112	Escherichia coli strain AR436 plasmid unnamed3, complete sequence	52046-52075	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP043856	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence	269-298	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP026205	Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence	113-142	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_LT985223	Escherichia coli strain 711 plasmid RCS25_p, complete sequence	3799-3828	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP026184	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence	39003-39032	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP034398	Escherichia coli strain CRE1 plasmid pCRE1.4, complete sequence	8450-8479	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP042548	Klebsiella michiganensis strain C52 plasmid pC52_003, complete sequence	16661-16690	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NC_015872	Escherichia coli plasmid p271A, complete sequence	20552-20581	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	33123-33152	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP040826	Enterobacter cloacae strain NH77 plasmid pEcloNH77, complete sequence	29817-29846	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP043516	Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence	44757-44786	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP027137	Escherichia coli strain AR_0369 plasmid unnamed1, complete sequence	47670-47699	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP026232	Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence	47772-47801	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	MN583554	Escherichia coli strain M17224 plasmid p17511_70, complete sequence	39760-39789	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP019907	Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence	18732-18761	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_LT985250	Escherichia coli strain 170 plasmid RCS38_p, complete sequence	186437-186466	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NC_024954	Escherichia coli strain ECS01 plasmid pNDM-ECS01, complete sequence	10989-11018	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP027125	Escherichia coli strain AR_0374 plasmid unnamed3	3374-3403	0	1.0
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	52783-52812	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	23224-23263	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_KT148595	Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence	976-1015	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	169583-169622	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP029112	Escherichia coli strain AR436 plasmid unnamed3, complete sequence	16875-16914	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP026232	Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence	7925-7964	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	22397-22436	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	51791-51830	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP026184	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence	14118-14157	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	74625-74664	0	1.0
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP027125	Escherichia coli strain AR_0374 plasmid unnamed3	38535-38574	0	1.0
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	MN967025	Klebsiella pneumoniae strain KP2611 plasmid pKP2611-N, complete sequence	11431-11460	1	0.967
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_LT985223	Escherichia coli strain 711 plasmid RCS25_p, complete sequence	3748-3777	1	0.967
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_LT985250	Escherichia coli strain 170 plasmid RCS38_p, complete sequence	186386-186415	1	0.967
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP015078	Escherichia coli strain Ecol_448 plasmid pEC448_OXA163, complete sequence	32931-32960	1	0.967
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	MN583554	Escherichia coli strain M17224 plasmid p17511_70, complete sequence	39811-39840	1	0.967
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP026205	Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence	22855-22894	1	0.975
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	NZ_CP035471	Escherichia coli strain U12A plasmid pU12A_D, complete sequence	8472-8501	2	0.933
NZ_CP026279_1	1.1\|430\|30\|NZ_CP026279\|PILER-CR	430-459	30	KX863569	Uncultured bacterium plasmid pTRE-131 clone TRE-131, complete sequence	11592-11621	2	0.933
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	NZ_CP035471	Escherichia coli strain U12A plasmid pU12A_D, complete sequence	8523-8552	3	0.9
NZ_CP026279_1	1.2\|481\|30\|NZ_CP026279\|PILER-CR	481-510	30	KX863569	Uncultured bacterium plasmid pTRE-131 clone TRE-131, complete sequence	11643-11672	3	0.9
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP019907	Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence	8399-8438	4	0.9
NZ_CP026279_2	2.1\|23224\|40\|NZ_CP026279\|CRISPRCasFinder	23224-23263	40	NZ_CP017587	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence	38093-38132	4	0.9

1. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP026279 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

2. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_KX784503 (Citrobacter freundii strain 17285 plasmid p17285-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

3. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_KX784502 (Klebsiella oxytoca strain 7121 plasmid p7121-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

4. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_KT148595 (Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

5. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_KT345947 (Klebsiella pneumoniae strain 2013050801 plasmid p0801-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

6. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP010378 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

7. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to MK368725 (Escherichia coli strain JN24 plasmid pJN24NDM1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

8. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NC_019163 (Klebsiella pneumoniae plasmid pTR4, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

9. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

10. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP029112 (Escherichia coli strain AR436 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

11. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP026205 (Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

12. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP034398 (Escherichia coli strain CRE1 plasmid pCRE1.4, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

13. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP042548 (Klebsiella michiganensis strain C52 plasmid pC52_003, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

14. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NC_015872 (Escherichia coli plasmid p271A, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

15. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP027137 (Escherichia coli strain AR_0369 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

16. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP026232 (Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

17. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP019907 (Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

18. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NC_024954 (Escherichia coli strain ECS01 plasmid pNDM-ECS01, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

19. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP010382 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

20. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP034403 (Escherichia coli strain CRE10 plasmid pCRE10.4, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

21. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_EF219134 (Klebsiella pneumoniae isolate JIE137 plasmid pJIE137, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

22. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP022277 (Citrobacter freundii strain 18-1 plasmid pD18-1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

23. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP050010 (Citrobacter sp. Y3 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

24. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP027617 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

25. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP024879 (Klebsiella pneumoniae strain NH25 plasmid pNH25.5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

26. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP043856 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

27. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP026184 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

28. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

29. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP040826 (Enterobacter cloacae strain NH77 plasmid pEcloNH77, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

30. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP043516 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

31. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP027125 (Escherichia coli strain AR_0374 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcgggtt	Protospacer
******************************

32. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP026279 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

33. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_KX784503 (Citrobacter freundii strain 17285 plasmid p17285-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

34. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_KX784502 (Klebsiella oxytoca strain 7121 plasmid p7121-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

35. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP015078 (Escherichia coli strain Ecol_448 plasmid pEC448_OXA163, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

36. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_KT148595 (Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

37. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_KT345947 (Klebsiella pneumoniae strain 2013050801 plasmid p0801-IMP, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

38. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP034403 (Escherichia coli strain CRE10 plasmid pCRE10.4, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

39. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP010378 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

40. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_EF219134 (Klebsiella pneumoniae isolate JIE137 plasmid pJIE137, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

41. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to MN967025 (Klebsiella pneumoniae strain KP2611 plasmid pKP2611-N, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

42. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP022277 (Citrobacter freundii strain 18-1 plasmid pD18-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

43. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to MK368725 (Escherichia coli strain JN24 plasmid pJN24NDM1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

44. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NC_019163 (Klebsiella pneumoniae plasmid pTR4, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

45. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

46. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP050010 (Citrobacter sp. Y3 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

47. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP027617 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

48. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP024879 (Klebsiella pneumoniae strain NH25 plasmid pNH25.5, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

49. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP029112 (Escherichia coli strain AR436 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

50. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP043856 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

51. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP026205 (Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

52. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_LT985223 (Escherichia coli strain 711 plasmid RCS25_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

53. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP026184 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

54. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP034398 (Escherichia coli strain CRE1 plasmid pCRE1.4, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

55. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP042548 (Klebsiella michiganensis strain C52 plasmid pC52_003, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

56. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NC_015872 (Escherichia coli plasmid p271A, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

57. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

58. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP040826 (Enterobacter cloacae strain NH77 plasmid pEcloNH77, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

59. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP043516 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

60. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP027137 (Escherichia coli strain AR_0369 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

61. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP026232 (Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

62. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to MN583554 (Escherichia coli strain M17224 plasmid p17511_70, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

63. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP019907 (Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

64. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_LT985250 (Escherichia coli strain 170 plasmid RCS38_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

65. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NC_024954 (Escherichia coli strain ECS01 plasmid pNDM-ECS01, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

66. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP027125 (Escherichia coli strain AR_0374 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

67. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP010382 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtttcttctgttgctcactggctccggctg	CRISPR spacer
gtttcttctgttgctcactggctccggctg	Protospacer
******************************

68. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP026279 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

69. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_KT148595 (Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

70. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

71. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP029112 (Escherichia coli strain AR436 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

72. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP026232 (Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

73. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP010382 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

74. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP027617 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

75. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP026184 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

76. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

77. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP027125 (Escherichia coli strain AR_0374 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
tattacccccccctagcaagataaattgcccccctaaccg	Protospacer
****************************************

78. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to MN967025 (Klebsiella pneumoniae strain KP2611 plasmid pKP2611-N, complete sequence) position: , mismatch: 1, identity: 0.967

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcggggt	Protospacer
**************************** *

79. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_LT985223 (Escherichia coli strain 711 plasmid RCS25_p, complete sequence) position: , mismatch: 1, identity: 0.967

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcggggt	Protospacer
**************************** *

80. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_LT985250 (Escherichia coli strain 170 plasmid RCS38_p, complete sequence) position: , mismatch: 1, identity: 0.967

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcggggt	Protospacer
**************************** *

81. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP015078 (Escherichia coli strain Ecol_448 plasmid pEC448_OXA163, complete sequence) position: , mismatch: 1, identity: 0.967

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcggggt	Protospacer
**************************** *

82. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to MN583554 (Escherichia coli strain M17224 plasmid p17511_70, complete sequence) position: , mismatch: 1, identity: 0.967

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
cttttttcacctgctcagacttcgcggggt	Protospacer
**************************** *

83. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP026205 (Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence) position: , mismatch: 1, identity: 0.975

-tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
atatta-ccccccctagcaagataaattgcccccctaaccg	Protospacer
 ***** **********************************

84. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to NZ_CP035471 (Escherichia coli strain U12A plasmid pU12A_D, complete sequence) position: , mismatch: 2, identity: 0.933

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
ctttttttacctgctcagacttcgcgggct	Protospacer
*******.********************.*

85. spacer 1.1|430|30|NZ_CP026279|PILER-CR matches to KX863569 (Uncultured bacterium plasmid pTRE-131 clone TRE-131, complete sequence) position: , mismatch: 2, identity: 0.933

cttttttcacctgctcagacttcgcgggtt	CRISPR spacer
ctttttttacctgctcagacttcgcgggct	Protospacer
*******.********************.*

86. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to NZ_CP035471 (Escherichia coli strain U12A plasmid pU12A_D, complete sequence) position: , mismatch: 3, identity: 0.9

gtttcttctgttgctcactggctccggctg	CRISPR spacer
ttttcttttgttgctcactggctccggttg	Protospacer
 ******.*******************.**

87. spacer 1.2|481|30|NZ_CP026279|PILER-CR matches to KX863569 (Uncultured bacterium plasmid pTRE-131 clone TRE-131, complete sequence) position: , mismatch: 3, identity: 0.9

gtttcttctgttgctcactggctccggctg	CRISPR spacer
ttttcttttgttgctcactggctccggttg	Protospacer
 ******.*******************.**

88. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP019907 (Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.9

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
aaattaccccccctagcaagataaattgcccccctaaccg	Protospacer
 * *  **********************************

89. spacer 2.1|23224|40|NZ_CP026279|CRISPRCasFinder matches to NZ_CP017587 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence) position: , mismatch: 4, identity: 0.9

tattacccccccctagcaagataaattgcccccctaaccg	CRISPR spacer
aaattaccccccctagcaagataaattgcccccctaaccg	Protospacer
 * *  **********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP026278

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026278_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026278_1

8572-8667

Orphan

Consensus_repeat	Method
TTGTGCCAACAGAATGCCAACAGAGTGCCA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP026278_1

>merge|NZ_CP026278|1|8572-8667|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCAACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGGTTGTGCCAACAGAATGCCAACAGAGTGCCA

>NZ_CP026278|1|1|8572-8667|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCA	ACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGG
TTGTGCCAACAGAATGCCAACAGAGTGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026278.1\|WP_023339053.1\|3402_4071_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379213
NZ_CP026278.1\|WP_103468624.1\|10496_10802_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378956
NZ_CP026278.1\|WP_101857254.1\|13522_13753_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026278.1\|WP_103468627.1\|11483_11969_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026278.1\|WP_103468625.1\|10798_11284_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026278.1\|WP_032748404.1\|4862_5258_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133424
NZ_CP026278.1\|WP_103468626.1\|11280_11487_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026278.1\|WP_032748399.1\|2686_3391_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236362
NZ_CP026278.1\|WP_103468628.1\|11968_12181_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026278.1\|WP_103468644.1\|13032_13530_+\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP026278.1\|WP_032748397.1\|2498_2675_-\|DUF1317-family-protein	unknown	unknown	gnl\|CDD\|284449
NZ_CP026278.1\|WP_047684216.1\|7730_7952_+\|bacteriophage-CII-family-protein	unknown	unknown	gnl\|CDD\|336083
NZ_CP026278.1\|WP_009652643.1\|14011_14461_+\|recombination-protein-NinB	unknown	unknown	gnl\|CDD\|368607
NZ_CP026278.1\|WP_064353467.1\|5337_5544_-\|cell-division-inhibitor-protein	unknown	unknown	gnl\|CDD\|236900
NZ_CP026278.1\|WP_103468623.1\|9066_10497_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672
NZ_CP026278.1\|WP_158656795.1\|5784_6414_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376179
NZ_CP026278.1\|WP_004191589.1\|7471_7690_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP026278.1\|WP_103468629.1\|14453_14624_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182029
NZ_CP026278.1\|WP_032748402.1\|4072_4732_-\|exodeoxyribonuclease-X	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|181186
NZ_CP026278.1\|WP_021312733.1\|6703_7363_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885

Protein	Function_ID	Function_description	E-value
NZ_CP026278.1\|WP_023339053.1\|3402_4071_-\|AAA-family-ATPase	gnl\|CDD\|379213	pfam13479, AAA_24, AAA domain. This AAA domain is found in a wide variety of presumed phage proteins.	0.000956
NZ_CP026278.1\|WP_103468624.1\|10496_10802_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|378956	pfam12802, MarR_2, MarR family. The Mar proteins are involved in the multiple antibiotic resistance, a non-specific resistance system. The expression of the mar operon is controlled by a repressor, MarR. A large number of compounds induce transcription of the mar operon. This is thought to be due to the compound binding to MarR, and the resulting complex stops MarR binding to the DNA. With the MarR repression lost, transcription of the operon proceeds. The structure of MarR is known and shows MarR as a dimer with each subunit containing a winged-helix DNA binding motif.	0.00455833
NZ_CP026278.1\|WP_032748404.1\|4862_5258_-\|hypothetical-protein	gnl\|CDD\|133424	cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0.0072991
NZ_CP026278.1\|WP_009652643.1\|14011_14461_+\|recombination-protein-NinB	gnl\|CDD\|368607	pfam05772, NinB, NinB protein. The ninR region of phage lambda contains two recombination genes, orf (ninB) and rap (ninG), that have roles when the RecF and RecBCD recombination pathways of E. coli, respectively, operate on phage lambda. NinB binds to single-stranded DNA.	1.23616e-55
NZ_CP026278.1\|WP_032748399.1\|2686_3391_-\|hypothetical-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	0.00293448
NZ_CP026278.1\|WP_103468644.1\|13032_13530_+\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	6.28023e-12
NZ_CP026278.1\|WP_032748397.1\|2498_2675_-\|DUF1317-family-protein	gnl\|CDD\|284449	pfam07026, DUF1317, Protein of unknown function (DUF1317). This family consists of several hypothetical bacterial and phage proteins of around 60 residues in length. The function of this family is unknown.	1.19358e-14
NZ_CP026278.1\|WP_047684216.1\|7730_7952_+\|bacteriophage-CII-family-protein	gnl\|CDD\|336083	pfam05269, Phage_CII, Bacteriophage CII protein. This family consists of several phage CII regulatory proteins. CII plays a key role in the lysis-lysogeny decision in bacteriophage lambda and related phages.	1.95002e-09
NZ_CP026278.1\|WP_064353467.1\|5337_5544_-\|cell-division-inhibitor-protein	gnl\|CDD\|236900	PRK11354, kil, FtsZ inhibitor protein; Reviewed.	2.48375e-15
NZ_CP026278.1\|WP_103468623.1\|9066_10497_+\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	1.25687e-159
NZ_CP026278.1\|WP_158656795.1\|5784_6414_-\|hypothetical-protein	gnl\|CDD\|376179	pfam18757, Nmad5, Nucleotide modification associated domain 5. An alpha+beta fold domain associated with DNA base modifying genes in prokaryotes, and likely to be involved in modified DNA base biosynthesis.	7.07907e-48
NZ_CP026278.1\|WP_004191589.1\|7471_7690_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.00798e-11
NZ_CP026278.1\|WP_103468629.1\|14453_14624_+\|hypothetical-protein	gnl\|CDD\|182029	PRK09689, PRK09689, prophage protein NinE; Provisional.	1.37325e-20
NZ_CP026278.1\|WP_032748402.1\|4072_4732_-\|exodeoxyribonuclease-X	gnl\|CDD\|181186	PRK07983, PRK07983, exodeoxyribonuclease X; Provisional.	9.74659e-130
NZ_CP026278.1\|WP_021312733.1\|6703_7363_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	7.29673e-33

>NZ_CP026278.1|WP_047684216.1|7730_7952_+|bacteriophage-CII-family-protein
MESSTTRNKVEARRIESWLHSQIAELGTTNIAKVAGVNKSTVSRWRESLLPNMSLLLAILISNRTGEKGGFEA
>NZ_CP026278.1|WP_004191589.1|7471_7690_+|helix-turn-helix-transcriptional-regulator
MNNLSKIRRRAGLTQRQIATELNLTAGAICHYENGKRDLSIEQCRKIVAALNKYGACVSIDDVFPPSKASAA
>NZ_CP026278.1|WP_021312733.1|6703_7363_-|helix-turn-helix-domain-containing-protein
MSMKWYDLAKSLMKTKGINQEELAEHLGITKGAVSHWLNARREPSLEDIAKILRFLGKNNFSVGAGGMIIDENIKGDVEYVGPYKRGNEYPVLSSVQAGSWREAIEPYSIKDVDLWLESNAHIQGEAFWLLVEGDSMTSPVGLSIPEGTYVLFDTGREPVNGSLVIAKLSESNEATFKKLIIDGGQKYLKGLNPQWPLVPVNGNCRIIGVAVETKLRLI
>NZ_CP026278.1|WP_158656795.1|5784_6414_-|hypothetical-protein
MTSVRLTNALREQIAKNALAKSGVIDAIESLDLKRQEVARDARIAAFGGKEKADKVDKQYEKLEKLEAELRSAGASLHISGNPQSSINIAISGRRLGWCSYGRNAEGKEIFLVTPNRELCLFGAEHEITKRFDSIIDEEQKLNSRKKEIEATVWAALKSVTTLSRLVEVWPESKELIPENVDSAKVALPALKIEDLNRLIGLPTELVEG
>NZ_CP026278.1|WP_064353467.1|5337_5544_-|cell-division-inhibitor-protein
MVSHHYGTQTVNRGAVLPGMLVKHRESTWTASANKRGRLYLHRGIERTYTTDLLVEVYLNGLGQGLRR
>NZ_CP026278.1|WP_032748404.1|4862_5258_-|hypothetical-protein
MQPLPRLTSERLASLPAGTRLKMGGHIVKLIGRGSFTNAAGITQNMVDYVDSRGVPGSFEEKIFLSTATEHLNAVQCEHCFALRHPKDCVVRSITNYMTTRQAHFCDDKGCAEKYFIKHPGRQKSGRRTKW
>NZ_CP026278.1|WP_032748402.1|4072_4732_-|exodeoxyribonuclease-X
MLRVIDTETTSLEGSVLEIASVDIVDGVICNPMSDFVKPTEAISFEAMAIHHITEDMVADAPLISEVIGRYLGADAYVAHNAKFDKSKLPQIDAPWICTLKLARIQYPEFESHGNQYMRYRLGLKPELPEGLYAHRALYDCYVTAELLLYMGRLAKWTMGEMRTISNSPSLMKAIRFGKHKGLSFEEIAKVDPGYLRWLSSNSDDEDILFTIKHWLKGA
>NZ_CP026278.1|WP_023339053.1|3402_4071_-|AAA-family-ATPase
MGTPVLILGDSGAGKSYSLRNFTPDEVILLQCIPKMLPFRATGWKLNGKELPDGSVQRGNIIRFDAWDAVLDSINRMVLSKTRRVLVIDDFQVVMQHENMMRAYQTGYQKFTEMADHVWQIIMAATRLPDDFRVYFLAHTEESDGKIRMKTTGKMLNEKLTPEGYFSIVLRAIKKDGKHVFLIKGDDNDTAKAPPDLFPGLTEMDNDLKAVDVAITEFMTEL
>NZ_CP026278.1|WP_032748399.1|2686_3391_-|hypothetical-protein
MNQPMSFIWNTEAATLAKKAGATGGISETGAYEGFITSAIYTFGKDGSQSQALELSLDSDGAKANYLRINYIGKDGQQTFGMGLISALLWAAQIKSAQPEQVQTENGVEWHCPALIGKKVGLFLQKVLYTKGDGTDGYKFEVRHIFQPGSRRTYAEYSENEAATAIAALEKSMKDKDDRVQGNPQFSGGGRQQAGANPYAQNPNAVPHSRLQQAASQHAQNIQNPPDFDDDIPF
>NZ_CP026278.1|WP_032748397.1|2498_2675_-|DUF1317-family-protein
MKHAQDDIRVGAVRLPFLKEVKGWLMPWGEVISNPLKAQRMAEELDTNEELDTKRGAQ
>NZ_CP026278.1|WP_103468623.1|9066_10497_+|AAA-family-ATPase
MTSDFMTPPHSIEAEQSVLGGLLLDDDSSERTQKVLSILKPESFYSRQHQVIFAEMRQMYRDHKPVDLLTLFDALESKGLTETVGGFAYLAEMSKNTPSAANIVAYAMRVRETAMERYGIEKTTKAIELLYARNGMTAEQKFDAIQGLFTEITEHVKTGRRTGLRTFYDAVNDWSNEFDDRMKPDGRSRGLSTGIRSLDELLGVKRIVRGSLFVIGARPKMGKTTLYTQMGVNCATVENEPALMFSLEMPEGQMVEKITAQKGRISPNLFYPDMTKDDYGYRGDWNSDLQKATGVMGALIETNNLLIDDTPGVSLAHVMAESRRIKRERGKVGMILVDYLTLMTADKAERNDLAYGLITKGLKILAKELDCVVVLLTQLNRDLEKRTNKRPLPSDSRDTGQIEQDCDYWLAIYREGAYDVNANQSDTELLLRLNRHGETGVVYCEQRHGAIYDCDQEAASQRRREKEEKPTKRGGF
>NZ_CP026278.1|WP_103468624.1|10496_10802_+|MarR-family-transcriptional-regulator
MKKNSGKQAVINYIGQHPGCNFQDIRRGTGLDQSVVNSALWQMNRDGRVKREGECRSYRYSLADKTTVTESTSADFQFSNRHCGANRLTNLFNQCLAGVRK
>NZ_CP026278.1|WP_103468625.1|10798_11284_+|hypothetical-protein
MNIETVNELIQSLESAGELSIKEQKYLELARAFKQLAAENVGLKAAFEQPQAYLSWHAIPPTWNDPLPCGEYLDVHDTDGHKNSDGTDCWPVYAKPEIETPATDRIVAGIKADGVEEFAELTDKVADEEEFYDNGESAEYLKYTAKQARLFAKQLREGADK
>NZ_CP026278.1|WP_103468626.1|11280_11487_+|hypothetical-protein
MSNRIPNFGWNRLKLAALTYEQLAQLEEQVKAEHACKNGIHLFDKAGQRKLDALSWAIYNKQKAERAA
>NZ_CP026278.1|WP_103468627.1|11483_11969_+|hypothetical-protein
MTTDITELAQSHELRNKVNHRLYGALEFQGTSGENATITLSIDECKSIIAAMDERLALVEALEKAKGMEAYWKVQCRGITDHCEVLQARIAELEPRTVKLPDDAEHDIMAPVAAYLSEKFKWDGSAARWDGRNEYDVLADRVKYALRMVIRRAAGIKVEVE
>NZ_CP026278.1|WP_103468628.1|11968_12181_+|hypothetical-protein
MAITEGFCADLYCDCDGCLSGKIYPQGKADFIGRNMTDISQQARKAGWRISKDRQRCYAPGHKISRGANQ
>NZ_CP026278.1|WP_103468644.1|13032_13530_+|DUF551-domain-containing-protein
MLQAQSEDDDGEPTDDERIMAIEGIHNCERCSDGGWVIGEMGITRCACGQADSSPVIPGAEQRIADAVELLQKAAPAMLADNSGSDGPLAGRMKSPVIPDAWIPVSERMPDDSSDVLCTAEFDGPGDWRRKVGYWHEGKWVVYGASWMPTHWMPLPAAPQEVKGE
>NZ_CP026278.1|WP_101857254.1|13522_13753_+|hypothetical-protein
MNKVELLQKISALATECHALACELDIGDERTEMFEIYGVLHNLGRRGYASQVGQRMNPLLASCDDDDDDNWDEDDD
>NZ_CP026278.1|WP_009652643.1|14011_14461_+|recombination-protein-NinB
MKQQFHLVNDAIKQNAINFIRELPVDARRPLILDIKEMTRTLEQNKKMWPLLKDLSDQVVWFGNKYDSDDWKDLITALVAKSKKQEQRMAPGLDGGVVMFGQRTSKMTVRQMVEVIEAIYWFGTQQGVKFSEKSRIEIEWAKRWGESHA
>NZ_CP026278.1|WP_103468629.1|14453_14624_+|hypothetical-protein
MHSPLAKVIERSIFRMPARRKRKVEVKPSDIPTLKGYTARLVDKKWLCLRARRPHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026278_1	1.1\|8602\|36\|NZ_CP026278\|CRISPRCasFinder	8602-8637	36	NZ_CP026278	Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence	8602-8637	0	1.0

1. spacer 1.1|8602|36|NZ_CP026278|CRISPRCasFinder matches to NZ_CP026278 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence) position: , mismatch: 0, identity: 1.0

acgcaaacccagtaaccacgctgcgtacaagtgagg	CRISPR spacer
acgcaaacccagtaaccacgctgcgtacaagtgagg	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1424 : 20015

Enterobacteria_phage(30.77%)

lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103468620.1\|1424_1643_-	TraR/DksA family transcriptional regulator	A0A0N7C211	Escherichia_phage	7.1e-10	49.3
WP_103468621.1\|1639_1849_-	hypothetical protein	NA	NA	NA	NA
WP_103468622.1\|1845_2502_-	DNA methyltransferase	G8C7S6	Escherichia_phage	3.8e-115	88.9
WP_032748397.1\|2498_2675_-	DUF1317 family protein	M1FJ61	Enterobacteria_phage	7.7e-07	50.0
WP_032748399.1\|2686_3391_-	hypothetical protein	A0A088C400	Shewanella_sp._phage	3.0e-25	39.6
WP_023339053.1\|3402_4071_-	AAA family ATPase	G9L667	Escherichia_phage	1.1e-48	44.3
WP_032748402.1\|4072_4732_-	exodeoxyribonuclease X	A0A1W5PTR6	Pseudoalteromonas_phage	6.0e-20	33.3
WP_032748404.1\|4862_5258_-	hypothetical protein	NA	NA	NA	NA
WP_064353467.1\|5337_5544_-	cell division inhibitor protein	A0A0M4S6W3	Salmonella_phage	5.3e-31	92.6
WP_158656795.1\|5784_6414_-	hypothetical protein	K7PKU5	Enterobacteria_phage	1.4e-53	50.2
WP_021312733.1\|6703_7363_-	helix-turn-helix domain-containing protein	K7P7K3	Enterobacteria_phage	1.9e-69	61.5
WP_004191589.1\|7471_7690_+	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	1.4e-13	50.7
WP_047684216.1\|7730_7952_+	bacteriophage CII family protein	A2SY75	Escherichia_phage	1.4e-05	52.0
WP_047684223.1\|8177_9077_+	hypothetical protein	F1C5C3	Cronobacter_phage	1.6e-87	54.9
WP_103468623.1\|9066_10497_+	AAA family ATPase	Q9MCT4	Escherichia_phage	3.8e-184	66.9
WP_103468624.1\|10496_10802_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_103468625.1\|10798_11284_+	hypothetical protein	R9TME7	Aeromonas_phage	1.8e-13	35.3
WP_103468626.1\|11280_11487_+	hypothetical protein	R9TRD3	Aeromonas_phage	8.1e-32	97.1
WP_103468627.1\|11483_11969_+	hypothetical protein	NA	NA	NA	NA
WP_103468628.1\|11968_12181_+	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	6.2e-11	45.5
WP_103468644.1\|13032_13530_+	DUF551 domain-containing protein	A0A1I9LJU9	Stx_converting_phage	2.0e-15	54.1
WP_101857254.1\|13522_13753_+	hypothetical protein	G8C7S3	Escherichia_phage	1.7e-09	53.4
WP_009652643.1\|14011_14461_+	recombination protein NinB	Q8VNP6	Enterobacteria_phage	2.2e-37	51.7
WP_103468629.1\|14453_14624_+	hypothetical protein	G8C7V4	Escherichia_phage	5.7e-15	71.4
WP_103468630.1\|14616_15255_+	hypothetical protein	H6WRY9	Salmonella_phage	7.0e-74	68.9
WP_103468631.1\|15251_15482_+	hypothetical protein	NA	NA	NA	NA
WP_103468632.1\|15478_15619_+	YlcG family protein	NA	NA	NA	NA
WP_103468633.1\|15615_16425_+	antitermination protein	M9NZB0	Enterobacteria_phage	5.3e-119	75.8
WP_048252288.1\|17413_18271_+	site-specific DNA-methyltransferase	H2EQJ0	Salmonella_phage	3.3e-50	69.5
WP_032748430.1\|18323_18605_+	hypothetical protein	NA	NA	NA	NA
WP_064367594.1\|18762_18987_+\|lysis	lysis protein	M9NZI9	Enterobacteria_phage	6.3e-30	87.8
WP_103468634.1\|18964_19459_+	lysozyme	M9P0E5	Enterobacteria_phage	2.4e-82	89.0
WP_103468635.1\|19547_20015_+\|lysis	lysis protein	Q76H63	Enterobacteria_phage	7.5e-57	74.2

DBSCAN-SWA_2

23380 : 43755

Cronobacter_phage(45.45%)

head,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032748444.1\|23380_24850_+	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	4.5e-148	56.9
WP_032748446.1\|24776_25784_+\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	4.9e-114	68.1
WP_103468636.1\|25905_27267_+	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	3.1e-127	52.2
WP_016529582.1\|27266_27728_+	hypothetical protein	B1GS72	Salmonella_phage	5.0e-29	50.3
WP_032748452.1\|27724_28780_+\|coat	phage coat protein	B1GS73	Salmonella_phage	3.8e-101	53.1
WP_103468637.1\|28812_29076_+	hypothetical protein	NA	NA	NA	NA
WP_103468638.1\|29078_29459_+	hypothetical protein	F1C5E2	Cronobacter_phage	9.1e-29	54.5
WP_032710897.1\|29458_29632_+	hypothetical protein	Q5G8X7	Enterobacteria_phage	5.4e-13	53.6
WP_043906744.1\|29631_29994_+	hypothetical protein	G0ZNE2	Cronobacter_phage	4.3e-28	52.5
WP_004151265.1\|29996_30422_+	hypothetical protein	R9TPP7	Aeromonas_phage	5.1e-28	47.9
WP_004178853.1\|30418_30811_+	hypothetical protein	G0ZNE4	Cronobacter_phage	3.3e-34	51.9
WP_004151263.1\|30879_31632_+	Ig domain-containing protein	F1C5E5	Cronobacter_phage	3.2e-33	44.9
WP_029884068.1\|31684_32362_+	hypothetical protein	F1C5E8	Cronobacter_phage	9.7e-74	58.4
WP_004151261.1\|32537_33293_+	DNA-binding protein	K7PGT4	Enterobacteria_phage	2.4e-60	51.0
WP_004151260.1\|33295_33550_+	hypothetical protein	K7PM89	Enterobacteria_phage	6.7e-20	73.0
WP_023328739.1\|33970_34291_+	hypothetical protein	NA	NA	NA	NA
WP_047684316.1\|34342_34777_-	hypothetical protein	NA	NA	NA	NA
WP_047685272.1\|34781_35030_-	Arc family DNA-binding protein	E7C9U8	Salmonella_phage	8.0e-26	72.8
WP_049594418.1\|35117_35279_+	Arc family DNA-binding protein	I6S1K8	Salmonella_phage	1.6e-11	63.3
WP_064371272.1\|35347_36289_+	antirepressor protein Ant	I6S627	Salmonella_phage	1.5e-77	68.0
WP_103468639.1\|36388_39913_+	tape measure protein	R9TMK1	Aeromonas_phage	2.8e-297	67.1
WP_103468646.1\|40012_40432_+	hypothetical protein	A0A2P1MXB5	Escherichia_phage	4.1e-30	47.1
WP_103468640.1\|40431_40902_+	hypothetical protein	R9TPR6	Aeromonas_phage	2.4e-26	39.7
WP_103468641.1\|40898_41294_+	hypothetical protein	F1C5F2	Cronobacter_phage	6.1e-36	54.8
WP_103468642.1\|41280_43755_+	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	3.8e-200	45.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP026282

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 55863

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197677.1\|702_2136_-	glycogen synthase GlgA	NA	NA	NA	NA
WP_015632388.1\|2225_3509_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_004099052.1\|3638_5831_-	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
WP_001118616.1\|6248_7172_+\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	1.1e-176	99.3
WP_022631502.1\|7472_7673_+	hypothetical protein	NA	NA	NA	NA
WP_032425568.1\|8934_9939_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_000509966.1\|12521_13127_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_016241527.1\|13516_16204_-	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.2e-71	27.5
WP_016241528.1\|16254_16686_-	universal stress protein	A0A1W6JNV4	Morganella_phage	2.0e-24	44.1
WP_016241530.1\|17210_18296_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_103468656.1\|18295_21352_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.9e-52	22.0
WP_016241532.1\|21502_22468_+	acyltransferase family protein	NA	NA	NA	NA
WP_045270086.1\|22475_23051_-	phospholipid:lipid A palmitoyltransferase	NA	NA	NA	NA
WP_001166628.1\|23099_23555_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_031623830.1\|23626_23977_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000732275.1\|23992_24268_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_000522996.1\|24295_24721_+	organomercurial transporter MerC	NA	NA	NA	NA
WP_000209296.1\|24759_26445_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_001277466.1\|26462_26828_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_001087807.1\|26824_27061_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001446012.1\|27044_27164_-	hypothetical protein	NA	NA	NA	NA
WP_000993245.1\|27126_27339_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001162010.1\|27468_28026_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	3.4e-48	81.3
WP_004118358.1\|28110_28815_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.6e-138	99.6
WP_001752509.1\|29135_29636_-	non-heme ferritin-like protein	NA	NA	NA	NA
WP_004118358.1\|29962_30667_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.6e-138	99.6
WP_016947617.1\|30786_31767_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	6.8e-185	98.8
WP_000780222.1\|32044_32326_-	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_000493286.1\|32306_32636_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_001572362.1\|33682_34705_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_001067855.1\|37667_38372_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_156174661.1\|38411_38588_+	hypothetical protein	NA	NA	NA	NA
WP_085954994.1\|38614_39741_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.4e-48	40.8
WP_103468657.1\|43322_45980_+	conjugal transfer mating pair stabilization protein TraN	NA	NA	NA	NA
WP_007372251.1\|46024_46795_-	hypothetical protein	NA	NA	NA	NA
WP_007372252.1\|46922_47453_-	transcriptional activator	NA	NA	NA	NA
WP_016241572.1\|47455_47986_-	hypothetical protein	NA	NA	NA	NA
WP_016241571.1\|47978_48539_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_016241570.1\|48568_49099_-	hypothetical protein	NA	NA	NA	NA
WP_007372253.1\|49113_50136_-	ParM/StbA family protein	NA	NA	NA	NA
WP_001310555.1\|51459_52476_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_007372284.1\|53392_53599_+	hypothetical protein	NA	NA	NA	NA
WP_007372285.1\|53737_53977_+	type II toxin-antitoxin system CcdA family antitoxin	NA	NA	NA	NA
WP_007372286.1\|53979_54288_+	CcdB family protein	NA	NA	NA	NA
WP_007372288.1\|54621_55176_+	hypothetical protein	NA	NA	NA	NA
WP_007372289.1\|55245_55863_+	hypothetical protein	A0A076G6Q2	Escherichia_phage	4.1e-63	53.4

DBSCAN-SWA_2

65059 : 65902

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372307.1\|65059_65902_+	HNH endonuclease	G0X580	Salmonella_phage	1.8e-16	39.5

DBSCAN-SWA_3

69782 : 79222

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372313.1\|69782_70787_+	peptide transporter	A0A1B0V750	Salmonella_phage	3.0e-18	27.2
WP_008786583.1\|70910_71312_+	hypothetical protein	NA	NA	NA	NA
WP_007372314.1\|71283_72984_+	AAA family ATPase	A0A172JHZ0	Bacillus_phage	3.5e-96	36.7
WP_007372316.1\|73625_73943_+	hypothetical protein	NA	NA	NA	NA
WP_007372317.1\|73944_74694_+	hypothetical protein	NA	NA	NA	NA
WP_016241554.1\|74714_75401_+	hypothetical protein	NA	NA	NA	NA
WP_007372318.1\|75559_76735_+	ParB/RepB/Spo0J family partition protein	A0A088FQX6	Escherichia_phage	6.5e-17	31.3
WP_103468658.1\|76908_77430_+	hypothetical protein	NA	NA	NA	NA
WP_007372320.1\|77426_77795_+	hypothetical protein	NA	NA	NA	NA
WP_008786580.1\|77803_79222_+	replicative DNA helicase	O80281	Escherichia_phage	4.3e-188	73.6

DBSCAN-SWA_4

82961 : 126707

Salmonella_phage(41.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085950818.1\|82961_84082_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_008786575.1\|84195_84543_+	hypothetical protein	NA	NA	NA	NA
WP_007372327.1\|84793_85144_+	hypothetical protein	NA	NA	NA	NA
WP_016241553.1\|85176_85476_+	hypothetical protein	NA	NA	NA	NA
WP_032425568.1\|86367_87372_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016809495.1\|87450_90435_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.4e-302	54.4
WP_016809496.1\|90489_91113_-	recombinase family protein	NA	NA	NA	NA
WP_016809498.1\|91537_93016_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.1e-197	74.0
WP_016809499.1\|93033_93861_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	9.8e-52	40.2
WP_032425568.1\|95263_96268_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_007372332.1\|99696_100020_-	hypothetical protein	NA	NA	NA	NA
WP_007372333.1\|100111_100303_-	hypothetical protein	NA	NA	NA	NA
WP_016241551.1\|100446_100971_+	hypothetical protein	NA	NA	NA	NA
WP_007372335.1\|101042_101588_+	hypothetical protein	NA	NA	NA	NA
WP_007372336.1\|101724_102027_+	hypothetical protein	NA	NA	NA	NA
WP_016241550.1\|102138_102564_+	hypothetical protein	A0A0K1YBA5	Cronobacter_phage	1.6e-26	42.8
WP_007372337.1\|102717_103437_+	HNH endonuclease	G0X580	Salmonella_phage	2.2e-07	39.5
WP_007372338.1\|104965_106048_-	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	1.1e-79	56.5
WP_016241546.1\|107009_107258_+	hypothetical protein	NA	NA	NA	NA
WP_008786567.1\|107830_108697_+	hypothetical protein	J9Q7H0	Salmonella_phage	8.4e-46	37.2
WP_007372340.1\|109107_109593_+	hypothetical protein	NA	NA	NA	NA
WP_009651680.1\|109680_109998_+	hypothetical protein	NA	NA	NA	NA
WP_016241545.1\|110019_110418_+	hypothetical protein	NA	NA	NA	NA
WP_007372341.1\|110736_110964_+	hypothetical protein	NA	NA	NA	NA
WP_007372342.1\|111144_112068_+	hypothetical protein	NA	NA	NA	NA
WP_007372343.1\|112103_112427_-	hypothetical protein	NA	NA	NA	NA
WP_007372345.1\|112709_112928_+	hypothetical protein	NA	NA	NA	NA
WP_071602877.1\|113188_113425_+	hypothetical protein	NA	NA	NA	NA
WP_007372347.1\|113985_115599_+	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	2.2e-07	37.0
WP_024196077.1\|115714_116014_-	hypothetical protein	NA	NA	NA	NA
WP_032951190.1\|116428_116635_+	hypothetical protein	NA	NA	NA	NA
WP_007372348.1\|116735_116987_+	hypothetical protein	NA	NA	NA	NA
WP_016241538.1\|117023_117521_-	hypothetical protein	NA	NA	NA	NA
WP_004098991.1\|118025_120092_-	ATP-binding protein	NA	NA	NA	NA
WP_004098990.1\|120088_121480_-	hypothetical protein	NA	NA	NA	NA
WP_012579081.1\|121641_122565_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	2.2e-177	99.7
WP_001067855.1\|123636_124341_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001515736.1\|124399_124651_+	hypothetical protein	NA	NA	NA	NA
WP_001325018.1\|124764_125910_+	ABC transporter permease	NA	NA	NA	NA
WP_001446567.1\|125906_126707_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.8e-10	27.7

DBSCAN-SWA_5

132937 : 231362

114

Salmonella_phage(21.74%)

integrase,transposase

attL 137163:137222|attR 184716:185936

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001254932.1\|132937_134089_+\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
WP_046092923.1\|135571_136603_+\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_099531012.1\|136741_137017_-	hypothetical protein	NA	NA	NA	NA
137163:137222	attL	NA	NA	NA	NA
WP_085950818.1\|137233_138353_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_009652923.1\|138528_138843_-	hypothetical protein	NA	NA	NA	NA
WP_001567368.1\|139057_140461_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|140489_141122_-	hypothetical protein	NA	NA	NA	NA
WP_007372199.1\|143499_144462_+	plasmid stabilization protein	A0A222YXF2	Escherichia_phage	9.6e-59	41.1
WP_009652914.1\|144475_144862_+	plasmid stability protein	NA	NA	NA	NA
WP_007372197.1\|144888_145293_-	FCD domain-containing protein	NA	NA	NA	NA
WP_006812012.1\|145494_145836_-	toxin	NA	NA	NA	NA
WP_006812013.1\|145856_146174_-	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
WP_001548171.1\|146193_146415_-	DUF987 domain-containing protein	A0A142F0X9	Klebsiella_phage	3.1e-05	38.9
WP_000811693.1\|146423_146900_-	RadC family protein	NA	NA	NA	NA
WP_000211838.1\|146915_147374_-	antirestriction protein	NA	NA	NA	NA
WP_000194654.1\|147471_147711_-	DUF905 domain-containing protein	NA	NA	NA	NA
WP_032200803.1\|147787_148255_-	hypothetical protein	NA	NA	NA	NA
WP_103468661.1\|148280_148721_-	hypothetical protein	NA	NA	NA	NA
WP_103468662.1\|148720_148960_-	hypothetical protein	NA	NA	NA	NA
WP_001548933.1\|148996_149698_-	WYL domain-containing protein	NA	NA	NA	NA
WP_001548934.1\|149914_150736_-	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	4.7e-46	38.7
WP_016154552.1\|150827_151691_-	GTPase family protein	NA	NA	NA	NA
WP_001310555.1\|151993_153010_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_102016203.1\|153227_153386_+	hypothetical protein	NA	NA	NA	NA
WP_103468668.1\|153382_153937_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_103468663.1\|154001_155318_-\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	6.6e-34	29.5
WP_024196074.1\|155556_155886_+	acid-activated periplasmic chaperone HdeB	NA	NA	NA	NA
WP_032655135.1\|155937_156741_-	aquaporin	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	1.6e-14	31.5
WP_007372194.1\|156794_158606_-	diol dehydratase reactivase subunit alpha	NA	NA	NA	NA
WP_007372193.1\|158616_159045_-	diol dehydratase small subunit	NA	NA	NA	NA
WP_009652918.1\|159047_159632_-	propanediol/glycerol family dehydratase medium subunit	NA	NA	NA	NA
WP_016241522.1\|159643_161311_-	propanediol/glycerol family dehydratase large subunit	NA	NA	NA	NA
WP_007372190.1\|161702_162131_+	heme-binding protein	NA	NA	NA	NA
WP_048218660.1\|162153_163317_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_048218661.1\|163333_163687_+	hypothetical protein	NA	NA	NA	NA
WP_048218663.1\|163687_164218_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_003828512.1\|164195_166121_-	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_103468664.1\|166212_167310_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_007372180.1\|167866_168937_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_007372179.1\|168947_169580_+	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_103468665.1\|169590_171009_+	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_007372177.1\|171083_172733_+	glycerone kinase	NA	NA	NA	NA
WP_007372176.1\|172836_173607_-	siderophore-interacting protein	NA	NA	NA	NA
WP_007372175.1\|173813_174011_-	hypothetical protein	NA	NA	NA	NA
WP_075206739.1\|173989_174655_+	DNA methylase	NA	NA	NA	NA
WP_043016716.1\|174651_177225_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_082138494.1\|177315_177942_-	inovirus Gp2 family protein	NA	NA	NA	NA
WP_000019445.1\|177923_178904_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_103468666.1\|178999_179155_+	hypothetical protein	NA	NA	NA	NA
WP_103468669.1\|179151_179706_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_025798965.1\|179770_181087_-\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	4.6e-35	30.0
WP_103468667.1\|181231_181597_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_043016718.1\|181928_182534_-	hypothetical protein	NA	NA	NA	NA
WP_043016719.1\|182544_182967_-	hypothetical protein	NA	NA	NA	NA
WP_085950818.1\|183583_184704_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_127649449.1\|184960_185275_-	hypothetical protein	NA	NA	NA	NA
WP_007372161.1\|185302_185983_-	hypothetical protein	NA	NA	NA	NA
184716:185936	attR	NA	NA	NA	NA
WP_154050669.1\|186260_186614_-	hypothetical protein	NA	NA	NA	NA
WP_008786804.1\|186669_187227_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_046092923.1\|187864_188896_-\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_007372157.1\|189317_189770_-	hypothetical protein	NA	NA	NA	NA
WP_032941601.1\|189782_190088_-	hypothetical protein	NA	NA	NA	NA
WP_007372155.1\|190093_190621_-	hypothetical protein	NA	NA	NA	NA
WP_007372154.1\|190700_191585_-	hypothetical protein	NA	NA	NA	NA
WP_020996135.1\|191784_192186_-	hypothetical protein	NA	NA	NA	NA
WP_009653863.1\|192276_192738_-	hypothetical protein	NA	NA	NA	NA
WP_008786801.1\|193121_193457_-	PerC family transcriptional regulator	NA	NA	NA	NA
WP_007372153.1\|193465_193777_-	hypothetical protein	NA	NA	NA	NA
WP_007372151.1\|193892_194963_-	phosphoadenosine phosphosulfate reductase family protein	H7BVI4	unidentified_phage	6.5e-40	28.4
WP_020996132.1\|194955_195279_-	hypothetical protein	NA	NA	NA	NA
WP_007372150.1\|195401_196391_+	hypothetical protein	NA	NA	NA	NA
WP_008786799.1\|196417_196822_-	hypothetical protein	NA	NA	NA	NA
WP_007372149.1\|197148_197700_-	hypothetical protein	NA	NA	NA	NA
WP_007372148.1\|197729_197966_-	hypothetical protein	NA	NA	NA	NA
WP_007372147.1\|198043_198334_-	hypothetical protein	NA	NA	NA	NA
WP_008786797.1\|198519_198921_-	hypothetical protein	Q1MVE8	Enterobacteria_phage	3.5e-47	69.9
WP_007372145.1\|199469_199961_+	hypothetical protein	NA	NA	NA	NA
WP_000217395.1\|200046_200538_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001333498.1\|200708_200966_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	8.3e-18	65.7
WP_127649377.1\|201254_201635_-	hypothetical protein	NA	NA	NA	NA
WP_007372144.1\|201947_202838_-	DNA replication protein	NA	NA	NA	NA
WP_009652912.1\|202987_204253_-	translesion error-prone DNA polymerase V subunit UmuC	A0A1W6JNT0	Morganella_phage	9.8e-144	60.6
WP_008786793.1\|204252_204669_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.0e-36	54.7
WP_007372141.1\|204922_205426_+	hypothetical protein	NA	NA	NA	NA
WP_075552836.1\|205409_205682_+	hypothetical protein	NA	NA	NA	NA
WP_001572362.1\|205782_206805_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_045269834.1\|206828_209867_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.0e-295	53.5
WP_045269835.1\|210034_210676_+	recombinase family protein	NA	NA	NA	NA
WP_025760366.1\|210939_212598_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000928911.1\|212758_213109_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000043177.1\|213413_213890_-	DNA starvation/stationary phase protection protein	G0X506	Salmonella_phage	6.7e-05	28.7
WP_016241611.1\|214004_214442_-	PaaI family thioesterase	NA	NA	NA	NA
WP_000626969.1\|214602_215064_-	hypothetical protein	NA	NA	NA	NA
WP_001137910.1\|215038_215359_-	DUF134 domain-containing protein	NA	NA	NA	NA
WP_000427614.1\|215818_216823_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_045269836.1\|216901_218299_-	DUF4158 domain-containing protein	A0A1B0V7H9	Salmonella_phage	1.3e-117	32.1
WP_001162010.1\|218301_218859_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	3.4e-48	81.3
WP_000993245.1\|218988_219201_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001446012.1\|219163_219283_+	hypothetical protein	NA	NA	NA	NA
WP_001087807.1\|219266_219503_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001277466.1\|219499_219865_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000209296.1\|219882_221568_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_000522996.1\|221606_222032_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|222059_222335_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294653.1\|222350_222746_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|222817_223273_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_012561145.1\|223730_224891_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_012561144.1\|224932_225928_+	Flp pilus assembly complex ATPase component	NA	NA	NA	NA
WP_000792636.1\|225927_226461_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	5.8e-21	33.9
WP_000091613.1\|226633_226948_-	hypothetical protein	NA	NA	NA	NA
WP_000215515.1\|227202_227559_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001293886.1\|227548_227950_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_001247892.1\|227946_228237_-	nucleotidyltransferase	NA	NA	NA	NA
WP_032640605.1\|228395_231362_+\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1

DBSCAN-SWA_6

247844 : 256341

uncultured_Caudovirales_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012817690.1\|247844_250853_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	64.5
WP_001556711.1\|251016_251589_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-83	89.0
WP_004118313.1\|251597_252002_+	arsenic transporter ATPase	NA	NA	NA	NA
WP_000065758.1\|252032_252458_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.2e-50	70.7
WP_000922630.1\|252470_253760_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.5e-171	73.5
WP_001556710.1\|253808_255560_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_000783215.1\|255577_255940_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_001114073.1\|255987_256341_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-23	50.0

DBSCAN-SWA_7

259343 : 260987

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197675.1\|259343_260987_-	alpha-D-glucose phosphate-specific phosphoglucomutase	A0A1X9I671	Streptococcus_phage	1.5e-22	25.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_CP026284

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15328 : 104889

102

Escherichia_phage(27.78%)

integrase,transposase,tRNA

attL 86067:86085|attR 99806:99824

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|15328_16033_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000624775.1\|16057_16291_+	hypothetical protein	NA	NA	NA	NA
WP_000046891.1\|16906_17242_-	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	2.8e-05	35.7
WP_001515734.1\|17484_18048_+\|transposase	transposase	NA	NA	NA	NA
WP_001348195.1\|18112_18487_+	cupin domain-containing protein	NA	NA	NA	NA
WP_001097412.1\|18510_19074_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|20455_21160_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_033488203.1\|21421_23083_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_001067855.1\|23402_24107_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_021242989.1\|24319_27304_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.8e-306	54.3
WP_047721751.1\|27382_28387_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_001567383.1\|28761_29028_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567382.1\|29124_29682_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001567381.1\|29894_30155_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567380.1\|30185_30692_+	DUF417 family protein	NA	NA	NA	NA
WP_021243015.1\|30926_31388_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_021243016.1\|31377_31872_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_001567368.1\|32412_33816_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|33844_34477_-	hypothetical protein	NA	NA	NA	NA
WP_014542884.1\|34829_35108_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_015059150.1\|35095_35407_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_048234297.1\|35777_36209_+	hypothetical protein	NA	NA	NA	NA
WP_032634148.1\|36315_36531_-	MbeD family mobilization/exclusion protein	NA	NA	NA	NA
WP_015059161.1\|36537_37029_-	hypothetical protein	NA	NA	NA	NA
WP_000509966.1\|37313_37919_-	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_103468678.1\|38013_40911_+\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	7.9e-181	37.7
WP_004099020.1\|41550_41922_+	hypothetical protein	NA	NA	NA	NA
WP_011191342.1\|42239_43508_+\|transposase	IS4-like element ISApu1 family transposase	NA	NA	NA	NA
WP_003464965.1\|45826_46270_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_003464967.1\|46271_46811_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003464969.1\|46951_47656_+	glutathione S-transferase	NA	NA	NA	NA
WP_003464971.1\|47652_48621_+	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_002118279.1\|49068_50082_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_005006001.1\|50154_50586_+	heme-binding protein	NA	NA	NA	NA
WP_010591688.1\|50644_50938_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_010591687.1\|50934_51132_+	hypothetical protein	NA	NA	NA	NA
WP_003464979.1\|51263_51734_-	hypothetical protein	NA	NA	NA	NA
WP_003464980.1\|52201_52804_+	sulfite oxidase-like oxidoreductase	NA	NA	NA	NA
WP_002118292.1\|52796_53543_+	oxidoreductase	NA	NA	NA	NA
WP_005005995.1\|53996_54269_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	7.5e-09	41.9
WP_003464986.1\|54336_54618_+	DUF427 domain-containing protein	NA	NA	NA	NA
WP_003464988.1\|54787_55054_+	hypothetical protein	NA	NA	NA	NA
WP_005005993.1\|55914_56289_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_003464991.1\|57019_57538_+	DUF417 family protein	NA	NA	NA	NA
WP_003464995.1\|57567_58413_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_001067855.1\|59627_60332_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001067855.1\|60633_61338_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000108589.1\|61999_62557_+	OsmC family protein	NA	NA	NA	NA
WP_020277920.1\|62698_63280_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021242988.1\|63284_63623_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_021242987.1\|63652_63982_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	7.4e-11	34.7
WP_021242986.1\|64195_65302_+	alkene reductase	NA	NA	NA	NA
WP_001194072.1\|65367_66069_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_004729618.1\|66134_66908_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_023287190.1\|67093_68317_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001567390.1\|68450_69320_-	DMT family transporter	NA	NA	NA	NA
WP_004729622.1\|69560_70313_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_107835450.1\|70506_70668_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_000427623.1\|70752_71757_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_103468679.1\|72119_72734_+	DUF2913 family protein	NA	NA	NA	NA
WP_158656805.1\|72868_73006_+	hypothetical protein	NA	NA	NA	NA
WP_149888860.1\|73046_73289_-	hypothetical protein	NA	NA	NA	NA
WP_103468680.1\|73285_74455_-	MFS transporter	NA	NA	NA	NA
WP_103468681.1\|74432_75878_-\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_103468682.1\|75877_77182_-	KamA family radical SAM protein	NA	NA	NA	NA
WP_103468683.1\|77243_78662_-	hypothetical protein	NA	NA	NA	NA
WP_097311113.1\|78904_80111_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.6e-103	64.0
WP_158656807.1\|80394_81564_+	putative C-S lyase	NA	NA	NA	NA
WP_032440553.1\|81886_82096_-	hypothetical protein	NA	NA	NA	NA
WP_103468685.1\|82088_83147_-	hypothetical protein	NA	NA	NA	NA
WP_103468686.1\|83729_84035_+	hypothetical protein	NA	NA	NA	NA
WP_103468687.1\|84049_84322_+	hypothetical protein	NA	NA	NA	NA
WP_103468688.1\|84327_84906_+	hypothetical protein	NA	NA	NA	NA
WP_103468689.1\|84907_85315_+	hypothetical protein	NA	NA	NA	NA
WP_103468690.1\|85467_86013_-	hypothetical protein	NA	NA	NA	NA
86067:86085	attL	NA	NA	NA	NA
WP_103468691.1\|86153_86615_+	hypothetical protein	NA	NA	NA	NA
WP_103468692.1\|86611_86860_+	helix-turn-helix transcriptional regulator	A0A248SLB9	Klebsiella_phage	1.6e-10	56.9
WP_103468693.1\|86852_87440_+	restriction endonuclease	NA	NA	NA	NA
WP_103468694.1\|87436_87922_+	hypothetical protein	NA	NA	NA	NA
WP_103468695.1\|88189_88930_+\|integrase	tyrosine-type recombinase/integrase	I3WFA4	Macacine_betaherpesvirus	3.3e-22	51.6
WP_103468696.1\|89170_90145_+	recombinase	A0A0A7NPX4	Enterobacteria_phage	1.9e-86	52.3
WP_103468697.1\|90147_90591_+	plasmid stability family protein	NA	NA	NA	NA
WP_103468723.1\|91113_91359_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_103468698.1\|91351_91831_+	hypothetical protein	NA	NA	NA	NA
WP_103468699.1\|91975_92239_+	hypothetical protein	NA	NA	NA	NA
WP_103468700.1\|92742_93192_+	DNA repair protein RadC	NA	NA	NA	NA
WP_020805667.1\|93236_93503_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_103468701.1\|93566_94850_+	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	3.3e-62	41.2
WP_103468702.1\|95456_95636_+	cobalamin biosynthesis protein CbiX	NA	NA	NA	NA
WP_103468703.1\|95708_96569_+	DUF4942 domain-containing protein	I6RTT5	Marinomonas_phage	7.4e-18	30.4
WP_011091056.1\|96759_97098_+	hypothetical protein	NA	NA	NA	NA
WP_004187345.1\|97195_97426_+	hypothetical protein	NA	NA	NA	NA
WP_103468705.1\|98043_98454_+	DUF1380 family protein	NA	NA	NA	NA
WP_103468706.1\|98515_98821_+	hypothetical protein	NA	NA	NA	NA
WP_040027871.1\|99021_99462_+	antirestriction protein	NA	NA	NA	NA
WP_103468707.1\|99505_99790_+	hypothetical protein	NA	NA	NA	NA
WP_032440567.1\|99947_100181_+	hypothetical protein	NA	NA	NA	NA
99806:99824	attR	NA	NA	NA	NA
WP_032440568.1\|100234_100555_+	hypothetical protein	NA	NA	NA	NA
WP_103468724.1\|100845_101157_-	MobC	NA	NA	NA	NA
WP_103468708.1\|101554_101866_+	mobilization protein	NA	NA	NA	NA
WP_103468709.1\|101868_103797_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_103468710.1\|103947_104889_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.4e-73	50.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_CP026280

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3547 : 47152

Escherichia_phage(41.67%)

transposase,integrase

attL 9544:9559|attR 50398:50413

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427614.1\|3547_4552_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_023302490.1\|5670_5886_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|6000_6705_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_020277920.1\|7273_7855_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020277919.1\|7859_8198_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002431133.1\|8227_8557_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.3e-10	34.7
WP_006687059.1\|8770_9877_+	alkene reductase	NA	NA	NA	NA
9544:9559	attL	NA	NA	NA	NA
WP_020277918.1\|9942_10644_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_020277917.1\|10709_11483_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_020277915.1\|12944_13913_-	AAA family ATPase	NA	NA	NA	NA
WP_033488203.1\|13902_15564_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_021242984.1\|15547_16108_-	recombinase family protein	A0A1W5LU24	Ralstonia_phage	1.9e-30	41.8
WP_001567386.1\|16446_16923_-	DM13 domain-containing protein	NA	NA	NA	NA
WP_001567387.1\|17015_17282_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567388.1\|17422_18043_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001567390.1\|18503_19373_-	DMT family transporter	NA	NA	NA	NA
WP_004729622.1\|19613_20366_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_001567384.1\|20805_21810_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_000427614.1\|23936_24941_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_001567377.1\|25661_26156_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_001567378.1\|26145_26607_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_021243014.1\|26630_26768_-	hypothetical protein	NA	NA	NA	NA
WP_001567380.1\|26841_27348_-	DUF417 family protein	NA	NA	NA	NA
WP_001567381.1\|27378_27639_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567382.1\|27851_28409_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001567383.1\|28505_28772_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_000427623.1\|29145_30150_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001067855.1\|31203_31908_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001348075.1\|31954_32191_-	AAA family ATPase	NA	NA	NA	NA
WP_001044770.1\|32264_32681_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001261282.1\|32677_32908_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001568025.1\|33495_33714_+	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_004197633.1\|33715_34021_+	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_025380813.1\|34225_34585_+	hypothetical protein	NA	NA	NA	NA
WP_053389906.1\|34611_34926_+	hypothetical protein	NA	NA	NA	NA
WP_017899884.1\|34936_35953_+	hypothetical protein	NA	NA	NA	NA
WP_004197635.1\|36150_36945_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.5e-52	88.7
WP_077253981.1\|37384_37564_-	Par-like protein	NA	NA	NA	NA
WP_004197649.1\|37683_38310_-	ParA family plasmid-partitioning AAA ATPase	A0A222YXS3	Escherichia_phage	2.9e-40	43.6
WP_004098982.1\|38942_39818_-	RepB family plasmid replication initiator protein	Q71TL8	Escherichia_phage	5.6e-82	56.4
WP_004197646.1\|40229_41501_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	5.2e-153	64.0
WP_001568036.1\|41500_41932_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
WP_004152765.1\|42341_43826_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_001568038.1\|44074_45046_+	hypothetical protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
WP_032736798.1\|45048_45720_+	Mediator of plasmid stability	NA	NA	NA	NA
WP_001568040.1\|45783_46014_+	hypothetical protein	NA	NA	NA	NA
WP_032736797.1\|46450_47152_+	DNA methylase	A0A2I7RE86	Vibrio_phage	3.2e-27	36.7
50398:50413	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage