CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP026926	Agrobacterium tumefaciens strain 1D1609 plasmid pTi1D1609, complete sequence	0 crisprs	NA	0	1
NZ_CP026925	Agrobacterium tumefaciens strain 1D1609 chromosome II, complete sequence	0 crisprs	DEDDh,csa3	0	1
NZ_CP026927	Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609a, complete sequence	0 crisprs	NA	0	0
NZ_CP026924	Agrobacterium tumefaciens strain 1D1609 chromosome I, complete sequence	1 crisprs	cas3,WYL,csa3,DEDDh	1	8
NZ_CP026928	Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609b, complete sequence	0 crisprs	csa3	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6051 : 56526

Salmonella_phage(22.22%)

transposase,integrase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046205722.1\|6051_7089_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_010892456.1\|7135_7537_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_040132270.1\|7536_7791_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_104680305.1\|8093_11069_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.6e-191	37.6
WP_010892487.1\|13044_13764_+	type IV secretion system lytic transglycosylase VirB1	NA	NA	NA	NA
WP_010892488.1\|13778_14144_+	pilin major subunit VirB2	NA	NA	NA	NA
WP_010892489.1\|14143_14470_+	type IV secretion system protein VirB3	NA	NA	NA	NA
WP_010892490.1\|14469_16839_+	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_010892491.1\|16853_17516_+	pilin minor subunit VirB5	NA	NA	NA	NA
WP_010892492.1\|17612_18500_+	type IV secretion system protein	NA	NA	NA	NA
WP_010892493.1\|18533_18701_+	type IV secretion system lipoprotein VirB7	NA	NA	NA	NA
WP_032489857.1\|18687_19401_+	type IV secretion system protein VirB8	NA	NA	NA	NA
WP_010892495.1\|19397_20279_+	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_010892496.1\|20275_21409_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_010892497.1\|21448_22480_+	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_032488325.1\|22611_23415_+	response regulator	NA	NA	NA	NA
WP_153463909.1\|23473_23857_+	hypothetical protein	NA	NA	NA	NA
WP_104680308.1\|24239_25895_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.6e-101	46.8
WP_003517427.1\|25940_26288_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.8e-36	61.7
WP_104680309.1\|26284_26692_-\|transposase	transposase	NA	NA	NA	NA
WP_104680310.1\|27008_28127_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_158662954.1\|29207_29411_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_104680311.1\|29601_30831_+\|integrase	tyrosine-type recombinase/integrase	A0A142K830	Mycobacterium_phage	1.3e-12	29.5
WP_104680312.1\|30824_31739_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_104680313.1\|31735_32725_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	2.7e-08	29.1
WP_104680314.1\|32874_33267_-\|transposase	transposase	NA	NA	NA	NA
WP_010892499.1\|33392_34001_-	conjugal transfer protein VirC2	NA	NA	NA	NA
WP_010892500.1\|34003_34699_-	conjugal transfer ATPase VirC1	A0A0A8IL09	Aurantimonas_phage	7.8e-10	28.4
WP_010892501.1\|34967_35411_+	T-DNA border endonuclease VirD1	NA	NA	NA	NA
WP_104680315.1\|35444_36719_+	T-DNA border endonuclease VirD2	NA	NA	NA	NA
WP_010892504.1\|37372_39343_+	type IV secretion system ATPase VirD4	NA	NA	NA	NA
WP_010892505.1\|39434_41936_+	hypothetical protein	NA	NA	NA	NA
WP_104680318.1\|42388_42586_+	type IV secretion system effector chaperone VirE1	NA	NA	NA	NA
WP_010892507.1\|42590_44192_+	type IV secretion system single-stranded DNA binding effector VirE2	NA	NA	NA	NA
WP_104680319.1\|44257_46276_+	virA/G regulated protein	NA	NA	NA	NA
WP_153463892.1\|46559_46718_+	hypothetical protein	NA	NA	NA	NA
WP_010892509.1\|46887_47196_+	integration host factor subunit beta	E1XTB6	Salmonella_phage	3.2e-08	37.2
WP_046205727.1\|47246_47612_+	hypothetical protein	NA	NA	NA	NA
WP_010892510.1\|47625_47928_+	cold shock domain-containing protein	A0A218MMZ6	uncultured_virus	8.3e-09	44.6
WP_010892511.1\|50438_50969_+	conjugative transfer signal peptidase TraF	NA	NA	NA	NA
WP_010892512.1\|51487_52096_+	protein VirF	NA	NA	NA	NA
WP_051489788.1\|53687_54311_+	HAD family hydrolase	NA	NA	NA	NA
WP_104680321.1\|55012_55504_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_104680322.1\|55587_56526_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.2e-07	26.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026924

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026924_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026924_1

1715080-1715159

Orphan

Consensus_repeat	Method
TTCTTGGCCGGAGCCTTCTTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026924_1

>merge|NZ_CP026924|1|1715080-1715159|CRISPRCasFinder
TTCTTGGCCGGAGCCTTCTTCTTCGGAGCGGCTTCTTCGCCTTCAGCGGCGTCGTCAGCCTTGGCAGCGGCCTTTTTCTT

>NZ_CP026924|1|1|1715080-1715159|CRISPRCasFinder
TTCTTGGCCGGAGCCTTCTTCTT	CGGAGCGGCTTCTTCGCCTTCAGCGGCGTCGTCA
GCCTTGGCAGCGGCCTTTTTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026924.1\|WP_065655968.1\|1721933_1722500_-\|pilus-assembly-protein-TadE	unknown	unknown	gnl\|CDD\|227296
NZ_CP026924.1\|WP_065656130.1\|1707165_1708845_-\|NAD+-synthase	unknown	unknown	gnl\|CDD\|237577
NZ_CP026924.1\|WP_065656128.1\|1711123_1711657_+\|DUF1003-domain-containing-protein	unknown	unknown	gnl\|CDD\|226844
NZ_CP026924.1\|WP_065655967.1\|1721334_1721937_-\|pilus-assembly-protein-TadG	unknown	unknown	gnl\|CDD\|227296
NZ_CP026924.1\|WP_104679408.1\|1718510_1719575_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|377531
NZ_CP026924.1\|WP_003495735.1\|1718144_1718288_+\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP026924.1\|WP_065655971.1\|1726405_1726669_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|223314
NZ_CP026924.1\|WP_081307894.1\|1719897_1721328_+\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	unknown	unknown	gnl\|CDD\|235416
NZ_CP026924.1\|WP_065656131.1\|1706542_1706920_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319937
NZ_CP026924.1\|WP_104679409.1\|1725445_1726300_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026924.1\|WP_065656133.1\|1704479_1705196_-\|5,6-dimethylbenzimidazole-synthase	unknown	unknown	gnl\|CDD\|380321
NZ_CP026924.1\|WP_065655969.1\|1722501_1723716_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
NZ_CP026924.1\|WP_081307905.1\|1709214_1711008_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP026924.1\|WP_065656145.1\|1712411_1713815_+\|Si-specific-NAD(P)(+)-transhydrogenase	unknown	unknown	gnl\|CDD\|235373
NZ_CP026924.1\|WP_065657049.1\|1703298_1704363_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|377531
NZ_CP026924.1\|WP_081307906.1\|1701953_1703039_+\|DUF2865-domain-containing-protein	unknown	unknown	gnl\|CDD\|371363
NZ_CP026924.1\|WP_065656132.1\|1705520_1706351_-\|TolB-family-protein	unknown	unknown	gnl\|CDD\|223893
NZ_CP026924.1\|WP_004433052.1\|1717516_1717663_+\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP026924.1\|WP_003525152.1\|1724144_1725272_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP026924.1\|WP_065656127.1\|1714065_1714716_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026924.1\|WP_065655968.1\|1721933_1722500_-\|pilus-assembly-protein-TadE	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	8.64106e-07
NZ_CP026924.1\|WP_065656130.1\|1707165_1708845_-\|NAD+-synthase	gnl\|CDD\|237577	PRK13981, PRK13981, NAD synthetase; Provisional.	0
NZ_CP026924.1\|WP_065656128.1\|1711123_1711657_+\|DUF1003-domain-containing-protein	gnl\|CDD\|226844	COG4420, COG4420, Predicted membrane protein [Function unknown].	8.35591e-74
NZ_CP026924.1\|WP_065655967.1\|1721334_1721937_-\|pilus-assembly-protein-TadG	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	9.19134e-08
NZ_CP026924.1\|WP_104679408.1\|1718510_1719575_+\|IS5-family-transposase	gnl\|CDD\|377531	pfam05598, DUF772, Transposase domain (DUF772). This presumed domain is found at the N-terminus of many proteins found in transposons.	6.6062e-28
NZ_CP026924.1\|WP_003495735.1\|1718144_1718288_+\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	2.25674e-13
NZ_CP026924.1\|WP_065655971.1\|1726405_1726669_+\|acyl-carrier-protein	gnl\|CDD\|223314	COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	2.32468e-06
NZ_CP026924.1\|WP_081307894.1\|1719897_1721328_+\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	gnl\|CDD\|235416	PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed.	0
NZ_CP026924.1\|WP_065656131.1\|1706542_1706920_+\|glyoxalase	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	3.76382e-24
NZ_CP026924.1\|WP_065656133.1\|1704479_1705196_-\|5,6-dimethylbenzimidazole-synthase	gnl\|CDD\|380321	cd02145, BluB, 5,6-dimethylbenzimidazole synthase. BluB catalyzes the O2-dependent conversion of FMNH2 to 5,6-dimethylbenzimidazole (DMB), a component of vitamin B12; is is a subfamily of the nitroreductase family; nitroreductases typically reduce their substrates by using NAD(P)H as electron donor and often use FMN as a cofactor.	2.57643e-111
NZ_CP026924.1\|WP_065655969.1\|1722501_1723716_-\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	7.51764e-09
NZ_CP026924.1\|WP_081307905.1\|1709214_1711008_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	5.13115e-126
NZ_CP026924.1\|WP_065656145.1\|1712411_1713815_+\|Si-specific-NAD(P)(+)-transhydrogenase	gnl\|CDD\|235373	PRK05249, PRK05249, Si-specific NAD(P)(+) transhydrogenase.	0
NZ_CP026924.1\|WP_065657049.1\|1703298_1704363_-\|IS5-family-transposase	gnl\|CDD\|377531	pfam05598, DUF772, Transposase domain (DUF772). This presumed domain is found at the N-terminus of many proteins found in transposons.	5.77864e-28
NZ_CP026924.1\|WP_081307906.1\|1701953_1703039_+\|DUF2865-domain-containing-protein	gnl\|CDD\|371363	pfam11064, DUF2865, Protein of unknown function (DUF2865). This bacterial family of proteins has no known function.	4.3681e-30
NZ_CP026924.1\|WP_065656132.1\|1705520_1706351_-\|TolB-family-protein	gnl\|CDD\|223893	COG0823, TolB, Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion].	1.06663e-58
NZ_CP026924.1\|WP_004433052.1\|1717516_1717663_+\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	1.48472e-10
NZ_CP026924.1\|WP_003525152.1\|1724144_1725272_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0

>NZ_CP026924.1|WP_065656127.1|1714065_1714716_-|hypothetical-protein
MSPRTGFTLLLSLFTAAGTAAHADEAGLIWKPVKNSDRSYTARIGAKLPVDTPIRAGLEMGMSASKTGQVVDAPVRVWGNVTLLAEQLPGVSLARDVGVIFNALTGSSSVSVTSQQKRIVTPELDIEANRNFTVRYDGTAQQWNGVDVSQSLRLSRSETGTAFVLTGASRNSFNEFSSGVAVEQKIGDNLTVRGTLDQGYADHFRPGVSARYSIRW
>NZ_CP026924.1|WP_065656145.1|1712411_1713815_+|Si-specific-NAD(P)(+)-transhydrogenase
MHQFDLIVVGSGPAGRRAAIQAAKLEKRVLVIEKGSRVGGVSVHTGTIPSKTLRETALNLTGWRERGFYGRAYRVKQEIDAEDLRRRLLITLDHEVEVLEHQFARNRVQHIRGTASFIDANTMKVVKSDGEIMTVTGTSILLTIGTRPYRPPHIPFDGEAVLDSDEILEIKELPRSMVVVGAGVIGIEYATIFSALDTQVTVVEPRETMLEFIDKEIVEDFAYQLRDRNMKLIFGQKAEKVERDESGKCLVSLGNGRVLKAETVLFAAGRVGATDTLNLSACGLEADSRGRLKVDPETFQTSVPNIYAAGDIIGFPSLASTSMEQGRIAARHAVGAPAGEPPQFFPYGIYAVPEISTCGLTEEEVIERGIPYECGIAHFRETSRGHIMGLDSGLLKMIFSLKTRRLLGVHIVGEGATELVHIGQAVLNLKGTVEYFVENTFNYPTLAEAYKIAGLDAWNRMGEIKKD
>NZ_CP026924.1|WP_065656128.1|1711123_1711657_+|DUF1003-domain-containing-protein
MSDISDYIVSHFKRSSREIGEVERRILELSHQKKLISSDTNAEFSAGASFGDRLADNIAKVGGSWGFILGFCFFLIFWAVINTIILTTGAFDPYPFIFLNLLLSMLAAIQAPIIMMSQNRQAARDRFEAAKDYEVNLKAELEVLSLHEKIDVKVLAELAALRQDLAALHRHVTRKED
>NZ_CP026924.1|WP_081307905.1|1709214_1711008_+|LTA-synthase-family-protein
MALEWIARGSLTDVGAFLTSSARPGMTTIAAVLALLVALDALLGRRYLSLIALAPLCALTGLISAQKQTYLSDPLYPSDLLFGRQILELLPTMLKAQPMTAALVALGICATIAALTGLWLLARRHSPGLSLRERAAGLAMALPLLAGLASLMDYSHYSWVRDRLNIIPMMWDQQENYRHNGFLMAFAFNIPMANVSAPQGYGENTIADLTSEPAAFAPNKGDYPDVIMLMSESLWDPTRLENVNLSADPMPTIRAKQSGNVFSPEFGGMTANVEFEALTGFSNAFLPYGSIPYQQYIRRPVPSLASFFRGEGYSAIAMHPFQEWFWNRKQVYKNFGFEEFRSEETLPTMEKRGNFASDDALMDEIMATAEKAQNPLFLFAVTLQGHGPYEATRYAENTIGVEGDLSASASQALATYSQGVAEADEALLKLMRWAKKRDRETIVVLFGDHLPPLGQTFVESGYMPGMVASRRAPLEVMKKEHETPLVVWSSKQGVRKNIGTISPALLPYHVLKTAGFSDPFYTGTLGDVQQAFSVIDRHMLVATDGKALPDWSIAPNAVPDVVRDYRLLQFDMMFGQQYGRERFFPGFNWLHEGAPSV
>NZ_CP026924.1|WP_065656130.1|1707165_1708845_-|NAD+-synthase
MSDRHDIENHLRIAVGQFNPTVGDVAGNLAKAREARADAATQGADLLLLTELFISGYPPEDLVLKPAFLKACLKAVEELAAETADGGPGIVIGFPRQGETGRHNSVALLDGGKIIALRDKIDLPNYGEFDEKRVFSEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLAESGAEILLVPNGSPYYRGKLDVRHQVALRQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMSQFEATLAVTDWKRTADGWHCDSGPFSKIPEGEEADYRACMLGFRDYVNKNGFKSVVLGLSGGIDSAICAALAVDALGEERVRCIMLPYRYTSEESLKDAADCAKALGCRYDIVPIVEPVEGFLSALSDLFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDLYKMQVYAISSWRNAHVPPGALGPSGEVIPANIISKAPSAELRPNQTDQDSLPPYPVLDDILECLVEKEMSVEEILARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRFRDR
>NZ_CP026924.1|WP_065656131.1|1706542_1706920_+|glyoxalase
MNTIADHGIRFGRIAAMLPVKNIEKAHDFYVGVLGFEKTFENGNPVGFMILKQGNAELHLTLQPTHKAAPFNVAHMMVSDVDALHALCKSQGLRIIKGLQDKDYGLRAFVFEDPDGNRIDVGQVI
>NZ_CP026924.1|WP_065656132.1|1705520_1706351_-|TolB-family-protein
MRSSIEIFNIRTRQMRVVWQTPDLFEAPNWSPDGKYLLLNSEGLLYRLSLAGDIAPEKVDTGFATLCNNDHGISPDGSLYAISDKVEFGKSAIYLIASTGGAPRLMTKNLPSYWHGWSPDGKGFAYCGIRDQVFDIYSMDITSGVETRLTHGEGRNDGPDYSPDGEWIYFNSSRTGRMQIWRVRVDGSAVERITDSPYGDWFPHPSPKGDKVVFISYDGDVFDHPRDLDVRVRLMDMDGGNAETLFELFGGQGTMNSPNWSPDGDEFAYVRYFPVE
>NZ_CP026924.1|WP_065656133.1|1704479_1705196_-|5,6-dimethylbenzimidazole-synthase
MPADSSVNNPPGASSFDHALSPARPFSGEEREAIYRAIETRRDVRDQFLPDPLPDDLVERLLKAAHSAPSVGFMQPWNFTLVTDGAIRQAAFVAFSRANEEAAAMFTGEQQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPRTDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDIRTILDIPDHIEIVAWLCLGRVDALYNEPELAVKGWRQRVPLEELVFRNRWGGV
>NZ_CP026924.1|WP_065657049.1|1703298_1704363_-|IS5-family-transposase
MSVRDNRQFSFVEALMPQAKGSGRLERLSSVVKWYRFEKLLSRLRDDKGAGRPAYKPLVMFKALLLQSLYGLSDMELEEALGDRLSFKRFVGLTLEEAVPDHSTLCRFRNLLIDAGLLEKLFGELDRQLDAAGLILRRGTMLDATIIETTAARPPSGRNGDLDAGAGFADGRKPENPDHPGSAGCGEQAVDPDARFVRHAGKHGSSYGYKAHVGVDEGSGMIRKIITTPANVNDTVVADRLIVGDEACVLADGAYHTHMREKALKAKGIKPRLMRRPNRHHRVLSPRLARLNLLISKRRAAVETTFATLKNRMGLGVIRYRGLIKASAQVLLAAMAFNMRRWVTLTTPTRPHRA
>NZ_CP026924.1|WP_081307906.1|1701953_1703039_+|DUF2865-domain-containing-protein
MLPLVFIAPAAAFADQVCDTLYAQLREPPRVIGNTAEVRRYANALARQNIVIRKIRNDLRGYGCSSGSVIVYGNPNAGICAEIGDALAEAESERDAIIRDRDDAMAAARDNDGDIRRQRILAALDANGCNTLPQTETQLPPPPDVTLYPDAFRQNGPQNGDEPGQAGLSPYPNAAAEGGLRTLCVRTCDGSFFPIASNASPLDFRAQAEQCEKMCPGTETELYFHSMTDQETADMVSAETGKPYRDLPTAFAYRNATAKAPGCACNMAAYHKEMQKQEEAARPQPEKPYSGITTIPSPQGDKAEKPTEQRQAAKPPEQPVPERDYDPNDSRVRVIGPKFLPDQTGRIDLKNPALKGIQPQQ
>NZ_CP026924.1|WP_004433052.1|1717516_1717663_+|DUF1127-domain-containing-protein
MNIARSLTNWRKYRQTVTELGRMTDRELSDLGIGRQDIRRVAKTAVGF
>NZ_CP026924.1|WP_003495735.1|1718144_1718288_+|DUF1127-domain-containing-protein
MNPIRIAKNWISYRRTINELGSLSNQALSDIGLTRYDIRNVAARSFR
>NZ_CP026924.1|WP_104679408.1|1718510_1719575_+|IS5-family-transposase
MSVRDNRQFSFVEALMPQAKGSGRLERLSSVVKWYRFEKLLSRLRDDKGAGRPAYKPLVMFKALLLQSLYGLSDMELEEALGDRLSFKRFVGLTLEEAVPDHSTLCRFRNLLIDAGLLEKLFGELDRQLDAAGLILRRGTMLDATIIETTAARPPSGRNGDLDAGAGFADGRKPENPDHPGSAGCGEQAVDPDARFVRHAGKHGSSYGYKAHVGVDEGSGMIRKIITTPANVNDTVVADRLIVGDEACVLADGAYHTHMREKALKAKGIKPRLMRRLNRHHRVLSPRLARLNLLISKRRAAVETTFATLKNRMGLGVIRYRGLIKASAQVLLAAMAFNMRRWVTLTTPTRPHRA
>NZ_CP026924.1|WP_081307894.1|1719897_1721328_+|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO
MQDKTTSPIHVVGGGLAGSEAAWQIAQSGVPVILHEMRGVRGTDAHKGDTLAELVCSNSFRSDDATANAVGVIHAEMRLAGSLIMACADRHQVPAGGALAVDRDGFSEAVTKELESHPLVTIIREEVNGLPPKEWGNSIIATGPLTSPDLAAAIQVETGEDALAFFDAIAPIVHRDSINMDICWYQSRYDKVGPGGTGKDYINCPLNEEQYNAFIDALIAGDTVGFKEWEGTPYFDGCLPIEIMAERGRETLRHGPMKPMGLTNAHNPTVKAYAVVQLRQDNALGTLYNMVGFQTKLKYGVQADVFRMIPGLENAEFARLGGLHRNTYIDSPILLDRSLKLKSRRDLRFAGQITGCEGYVESASVGLLAGRFAAAEQKGESPSLPPATTALGSLLNHITGGHLSSDDEPGKRSFQPMNINFGLFPELEPGSIVKPEGVKRFRGKDKTIMKRQLIAARALRDCAAWLGESQAETEAV
>NZ_CP026924.1|WP_065655967.1|1721334_1721937_-|pilus-assembly-protein-TadG
MKKTTWFLRLAGFGRCRSGAAALEMGLLAPLLVLMLAVIIEVGRGWLSYDRFMTIVDDSARWAARFPEFEERVRTGVPSFVVLSGSGILQTGKLDLTLRSVKLVDKVARLQFPAHNFLGSAEDVPWEKTVIANGFVAQDAIIVVSGRYSYRPLIAAVADITLKFEYVAAVNPFFSQRYPYQSGKSDFAKWNLKRSPFKPN
>NZ_CP026924.1|WP_065655968.1|1721933_1722500_-|pilus-assembly-protein-TadE
MKSLLSPRQDKSRGGPSRCRVAHAKCYRLLGDRKAATAVETALLLPLFFALIFGTLEIGLLMLYYLYLSFASNAGIEYLRKAASDGKPATEIALRKAIASNFIGGTDETTLKIALLPIPDDDIAEAKVPIPIVNDFRPPADTAGQYILAIGYNWNFLMPTTRFLVPDTGGIHQLRNISLAITAVRVTE
>NZ_CP026924.1|WP_065655969.1|1722501_1723716_-|pilus-assembly-protein
MTSRRIKKAAWKRSLFSSLLRDRAGTFAIMTALLLPVSIILLGLLFEGGRALAYYNQSKRVMAMACERATKPTRTYTLLDTVRRDNVTAAFDAMIQSTKQKVLSRDVQVKWTETKINAEFSYGLIFSEMFNLEKLKYRLAYSCEGIPPYPEDDAVIIDNMFESNALGVERVLKNGVTKETPGGCWGVYPYSEIGWDGGTGPGVELQDWSSPCCRRNHNWQGYPAGMQSKKLNEAPTANDKACTLKEVDKAKTTDKIEIDKDPGTELSLPTRYVMELDSDWGPPAPGKKKNIEANSSIYKDVELHPGIYKIMVWYNGRRAVEDVEKTNGIKISLQQLLPDLKPQQRVWELTQDKNSIAWTPRDYSFRVKAYSIYRVTIEATGLSDSFGGIITGFQLIYVDRMEEG
>NZ_CP026924.1|WP_003525152.1|1724144_1725272_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MDVRAAVAIQAGKPLEVMTVQLEGPRAGEVLVEVKATGICHTDDFTLSGADPEGLFPAILGHEGAGVVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRATQGQGVMPDGTSRFSIGKDKIHHYMGCSTFSNYTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVINTAKVEIGSTAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNPKEVGDDIVPYLVNMTKRNGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQEISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMEGKIQIDPMITHTMPLEDINKGFDLMHKGESIRGVVVY
>NZ_CP026924.1|WP_104679409.1|1725445_1726300_+|hypothetical-protein
MRRATLKIVPIDNGNRVAAVALLAKGFPEKTAAFWSRGLSLVSEHHERRELGPIGQLLMKGDDAAGVLLTIKSRLPQTGRIVVNLSSWYVEPSCRWFAPRMLQMASSNEDEIFTDLTPSPEACKLNERLGFATVTDCTLFYPLPFAALRPASARLRPPGEIKPEILSAEMRDMLEDHARLGCIVAVMEAENRHYPLVFLKTTTKRLPSARLIHCEDRQVAQRHISAIARHLLGHGRLALTMAAMGAERKAGGLAAHKSAPIQVKGAWNPRFINEAYSELVLLPP
>NZ_CP026924.1|WP_065655971.1|1726405_1726669_+|acyl-carrier-protein
MLAAKKSEIDVADTIYSYLSDRFPAYAPFAADTQLLEGGVIDSLGFLELMIFLGESFGIILDDEHFTPDNLGTPADLIAFVLRERRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	HQ331142	Salmonella phage S16, complete genome	92743-92776	8	0.765
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1761529-1761562	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1224348-1224381	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	110083-110116	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	JX181825	Salmonella phage STML-198, complete genome	134228-134261	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	KJ000058	Salmonella phage STP4-a, complete genome	93822-93855	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NC_042044	Salmonella phage Melville, complete genome	94122-94155	9	0.735
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1248601-1248634	10	0.706
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	850917-850950	10	0.706
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1160346-1160379	10	0.706
NZ_CP026924_1	1.1\|1715103\|34\|NZ_CP026924\|CRISPRCasFinder	1715103-1715136	34	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	670407-670440	10	0.706

1. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to HQ331142 (Salmonella phage S16, complete genome) position: , mismatch: 8, identity: 0.765

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctcatcttcgtcatcgccttcatcggcgtcgtca	Protospacer
*  * *  * ** ********* ***********

2. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.735

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctttactacttcttcgccttcggcggcttcgtcg	Protospacer
*   .* .*************.***** *****.

3. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctctactacttcttcgccttcggcggcttcgtcg	Protospacer
*   .* .*************.***** *****.

4. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 9, identity: 0.735

cggagcggct--tcttcgccttcagcggcgtcgtca	CRISPR spacer
--caccagtcgatcttcgccttccgcggcgccgtca	Protospacer
   * *.*..  *********** ******.*****

5. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to JX181825 (Salmonella phage STML-198, complete genome) position: , mismatch: 9, identity: 0.735

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ttcatcttcgtcatcgccttcatcggcgtcgtca	Protospacer
.  * *  * ** ********* ***********

6. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 9, identity: 0.735

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ttcatcttcgtcatcgccttcatcggcgtcgtca	Protospacer
.  * *  * ** ********* ***********

7. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NC_042044 (Salmonella phage Melville, complete genome) position: , mismatch: 9, identity: 0.735

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ttcatcttcgtcatcgccttcatcggcgtcgtca	Protospacer
.  * *  * ** ********* ***********

8. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.706

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctctactatttcttcgccttcggcggcttcgtcg	Protospacer
*   .* ..************.***** *****.

9. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 10, identity: 0.706

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctctactatttcttcgccttcggcggcttcgtcg	Protospacer
*   .* ..************.***** *****.

10. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.706

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctctactatttcttcgccttcggcggcttcgtcg	Protospacer
*   .* ..************.***** *****.

11. spacer 1.1|1715103|34|NZ_CP026924|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 10, identity: 0.706

cggagcggcttcttcgccttcagcggcgtcgtca	CRISPR spacer
ctctactatttcttcgccttcggcggcttcgtcg	Protospacer
*   .* ..************.***** *****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

561064 : 566747

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104679610.1\|561064_561439_+	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	9.3e-26	49.1
WP_104679275.1\|562096_562597_-	hypothetical protein	R9TS95	Rhizobium_phage	5.6e-42	55.7
WP_104679276.1\|562599_562926_-	cell wall anchor protein	R9TN87	Rhizobium_phage	2.9e-39	83.3
WP_104679277.1\|562948_563626_-	TIGR02594 family protein	R9TRQ2	Rhizobium_phage	5.1e-123	94.2
WP_104679279.1\|564485_565451_-	hypothetical protein	Q8HA60	Vibrio_phage	4.9e-10	34.1
WP_104679280.1\|565447_565792_-	hypothetical protein	NA	NA	NA	NA
WP_104679281.1\|565793_566747_-	hypothetical protein	V5YTB8	Pseudomonas_phage	1.9e-14	39.7

DBSCAN-SWA_2

1006251 : 1013583

Geobacillus_phage(33.33%)

protease,head,portal,capsid,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065654191.1\|1006251_1007418_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	6.6e-62	38.0
WP_003521211.1\|1007613_1007934_+	hypothetical protein	NA	NA	NA	NA
WP_065654190.1\|1007962_1008535_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	8.9e-28	44.5
WP_065654189.1\|1008565_1009834_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	3.0e-76	42.4
WP_065654188.1\|1010012_1010582_+	hypothetical protein	NA	NA	NA	NA
WP_065654187.1\|1010585_1010921_+\|head	phage head closure protein	NA	NA	NA	NA
WP_065654186.1\|1010917_1011313_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_081307740.1\|1011320_1012430_-	MFS transporter	NA	NA	NA	NA
WP_065654184.1\|1012610_1013018_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_065654183.1\|1013017_1013377_+	gene transfer agent family protein	NA	NA	NA	NA
WP_065654182.1\|1013373_1013583_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA

DBSCAN-SWA_3

1525764 : 1541860

Streptococcus_phage(20.0%)

protease,integrase,head,capsid,portal,terminase,tRNA,tail

attL 1528145:1528161|attR 1546772:1546788

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065655430.1\|1525764_1527315_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	9.0e-107	39.9
WP_065655431.1\|1527619_1528645_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.0e-05	31.7
1528145:1528161	attL	NA	NA	NA	NA
WP_065655460.1\|1528637_1529312_-	dTMP kinase	M1PSC7	Streptococcus_phage	5.0e-38	43.7
WP_065655432.1\|1529448_1530621_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_065655433.1\|1530696_1531785_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	7.1e-18	50.0
WP_003523701.1\|1532103_1532442_+	hypothetical protein	NA	NA	NA	NA
WP_104679384.1\|1532690_1533833_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.4e-59	37.3
WP_104679385.1\|1534105_1534309_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_104679386.1\|1534311_1535409_+	AAA family ATPase	NA	NA	NA	NA
WP_104679387.1\|1535596_1535854_+	hypothetical protein	NA	NA	NA	NA
WP_104679389.1\|1536467_1538132_+\|terminase	terminase large subunit	Q9MCV7	Escherichia_phage	2.0e-91	41.6
WP_158662895.1\|1538679_1539846_+\|capsid	phage major capsid protein	K7XS73	uncultured_Mediterranean_phage	2.1e-39	34.1
WP_051674137.1\|1539847_1540126_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	5.1e-05	34.4
WP_104679392.1\|1540122_1540668_+\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	4.2e-27	45.2
WP_104679393.1\|1540651_1541860_+\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	4.3e-56	36.1
1546772:1546788	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1726665 : 1734957

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065655972.1\|1726665_1728198_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	1.7e-20	23.4
WP_081307895.1\|1728277_1729459_+	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_065655974.1\|1729664_1730822_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.1e-43	45.6
WP_065655975.1\|1730859_1731990_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.4e-104	52.7
WP_065655976.1\|1731989_1733072_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_065655977.1\|1733316_1733826_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	6.5e-46	59.4
WP_004442095.1\|1733863_1734433_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-47	53.8
WP_059760169.1\|1734462_1734957_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.2e-27	39.0

DBSCAN-SWA_5

1751359 : 1759912

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081307892.1\|1751359_1752970_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	1.1e-11	30.4
WP_078053081.1\|1753270_1753912_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.0e-11	35.1
WP_065655992.1\|1753920_1754691_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.6e-24	30.3
WP_065655993.1\|1754897_1756181_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.4e-97	45.8
WP_065655994.1\|1756282_1757086_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.9e-41	39.9
WP_065655995.1\|1757082_1757847_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003509722.1\|1758004_1758211_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.1e-08	69.8
WP_065655996.1\|1758339_1759074_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.3e-39	47.6
WP_003522723.1\|1759063_1759912_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-34	34.2

DBSCAN-SWA_6

1779324 : 1807326

Rhizobium_phage(65.38%)

terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104679415.1\|1779324_1779582_-	hypothetical protein	W6E8L8	Rhizobium_phage	1.3e-15	48.1
WP_104679416.1\|1779578_1780658_-	DUF3380 domain-containing protein	W8EHB5	Pseudomonas_phage	3.1e-29	41.0
WP_104679417.1\|1780750_1781995_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_158662897.1\|1782074_1783943_-	hypothetical protein	B4UTR2	Rhizobium_phage	5.0e-11	44.6
WP_158662898.1\|1784016_1784385_-	hypothetical protein	NA	NA	NA	NA
WP_104679420.1\|1784395_1785307_-	hypothetical protein	R9U0V1	Rhizobium_phage	2.1e-15	55.8
WP_104679421.1\|1785318_1786149_-	DUF2612 domain-containing protein	L7TKX3	Rhizobium_phage	2.1e-49	36.2
WP_104679422.1\|1786150_1787050_-	hypothetical protein	L7TN06	Rhizobium_phage	3.5e-71	46.7
WP_104679423.1\|1787046_1787412_-	hypothetical protein	L7TJM2	Rhizobium_phage	1.9e-31	59.1
WP_104679424.1\|1787408_1788065_-	hypothetical protein	L7TMF3	Rhizobium_phage	8.9e-32	42.4
WP_104679425.1\|1788064_1788946_-	hypothetical protein	L7TRC2	Rhizobium_phage	1.9e-101	60.1
WP_104679426.1\|1788926_1789250_-	hypothetical protein	L7TKW4	Rhizobium_phage	8.0e-34	62.9
WP_104679427.1\|1789254_1789818_-	hypothetical protein	L7TN02	Rhizobium_phage	9.7e-43	53.1
WP_104679428.1\|1789817_1791455_-\|tail	phage tail tape measure protein	A0A068C997	Rhizobium_phage	6.4e-103	57.6
WP_104679429.1\|1791621_1792080_-	hypothetical protein	NA	NA	NA	NA
WP_104679430.1\|1792152_1792587_-	DUF3277 family protein	L7TRB4	Rhizobium_phage	6.1e-37	54.5
WP_104679431.1\|1792598_1793741_-	DUF3383 family protein	L7TKV9	Rhizobium_phage	5.1e-115	56.9
WP_104679432.1\|1793767_1794250_-	hypothetical protein	L7TMZ9	Rhizobium_phage	8.3e-35	53.6
WP_104679433.1\|1794246_1794579_-	hypothetical protein	NA	NA	NA	NA
WP_104679434.1\|1794575_1795040_-	hypothetical protein	L7TME2	Rhizobium_phage	3.4e-46	63.0
WP_104679435.1\|1795039_1795429_-	DUF4054 domain-containing protein	L7TRB1	Rhizobium_phage	3.3e-26	50.4
WP_158662899.1\|1795428_1795620_-	hypothetical protein	NA	NA	NA	NA
WP_104679437.1\|1795676_1796138_-	hypothetical protein	NA	NA	NA	NA
WP_104679438.1\|1796149_1797118_-	DUF2184 domain-containing protein	A0A2H4J526	uncultured_Caudovirales_phage	4.4e-136	74.1
WP_104679439.1\|1797121_1797601_-	hypothetical protein	A0A2H4J1G1	uncultured_Caudovirales_phage	1.6e-46	65.2
WP_104679440.1\|1797613_1798765_-	DUF2213 domain-containing protein	A0A059VF71	Pseudomonas_phage	2.7e-47	39.1
WP_104679442.1\|1799619_1799814_+	hypothetical protein	NA	NA	NA	NA
WP_104679443.1\|1800549_1801374_-	hypothetical protein	L7TMD0	Rhizobium_phage	5.9e-65	48.9
WP_104679444.1\|1801370_1802726_-	DUF1073 domain-containing protein	A0A2H4J4I9	uncultured_Caudovirales_phage	4.0e-111	49.4
WP_157951643.1\|1802713_1802866_-	hypothetical protein	NA	NA	NA	NA
WP_104679445.1\|1802869_1804354_-\|terminase	phage terminase large subunit	A0A1P8VVI4	Erythrobacter_phage	2.8e-97	43.6
WP_104679446.1\|1804310_1804685_-	hypothetical protein	NA	NA	NA	NA
WP_104679447.1\|1804779_1804962_+	hypothetical protein	NA	NA	NA	NA
WP_104679294.1\|1804998_1805259_-	hypothetical protein	NA	NA	NA	NA
WP_104679295.1\|1805289_1805625_-	DUF3307 domain-containing protein	A0A088F6V5	Sulfitobacter_phage	1.6e-16	42.2
WP_104679448.1\|1806124_1806895_-	hypothetical protein	A0A141GF38	Brucella_phage	1.3e-45	41.0
WP_104679449.1\|1806891_1807326_-	hypothetical protein	A0A141GF37	Brucella_phage	1.7e-55	70.6

DBSCAN-SWA_7

1819544 : 1827262

Agrobacterium_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158662905.1\|1819544_1819685_+	hypothetical protein	A0A2L0UZW2	Agrobacterium_phage	1.1e-13	68.8
WP_158662906.1\|1819729_1820104_+	hypothetical protein	NA	NA	NA	NA
WP_158662907.1\|1820109_1820496_+	hypothetical protein	NA	NA	NA	NA
WP_104679471.1\|1820533_1820812_+	hypothetical protein	V5YSV5	Pseudomonas_phage	2.3e-05	63.2
WP_104679472.1\|1820813_1821059_+	hypothetical protein	NA	NA	NA	NA
WP_104679473.1\|1821109_1821433_+	hypothetical protein	Q6J1P0	Burkholderia_virus	1.2e-21	52.0
WP_158662908.1\|1821434_1821824_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_104679474.1\|1821876_1822203_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_158662909.1\|1822199_1822421_+	hypothetical protein	NA	NA	NA	NA
WP_104679476.1\|1822408_1823506_+	hypothetical protein	A0A2I7RPX6	Vibrio_phage	5.4e-05	30.0
WP_104679477.1\|1823507_1823714_+	hypothetical protein	NA	NA	NA	NA
WP_104679478.1\|1823710_1824829_+	hypothetical protein	G9L6A2	Escherichia_phage	1.7e-27	36.9
WP_104679479.1\|1824821_1825019_+	hypothetical protein	NA	NA	NA	NA
WP_104679480.1\|1825015_1825258_+	hypothetical protein	NA	NA	NA	NA
WP_158662910.1\|1825254_1825419_+	hypothetical protein	NA	NA	NA	NA
WP_158662917.1\|1825463_1825814_+	HNH endonuclease	A0A076G6E7	Sinorhizobium_phage	9.9e-22	51.8
WP_157951596.1\|1825810_1825963_+	hypothetical protein	NA	NA	NA	NA
WP_104679482.1\|1825959_1826568_+	hypothetical protein	NA	NA	NA	NA
WP_104679483.1\|1826557_1827262_+	hypothetical protein	R9TQI2	Rhizobium_phage	9.0e-06	39.7

DBSCAN-SWA_8

1916119 : 1937476

Morganella_phage(33.33%)

head,terminase,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035263562.1\|1916119_1916845_-\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_104679500.1\|1917054_1918263_+	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_065655176.1\|1918246_1919185_-	AEC family transporter	NA	NA	NA	NA
WP_003523449.1\|1919219_1919966_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_081307812.1\|1920587_1921745_-	DUF882 domain-containing protein	NA	NA	NA	NA
WP_065655178.1\|1922009_1922450_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_004442353.1\|1922642_1923221_+	cold shock domain-containing protein	A0A1W6JNX5	Morganella_phage	5.1e-07	42.4
WP_081307809.1\|1923256_1923703_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_003522642.1\|1923763_1924012_-	BON domain-containing protein	NA	NA	NA	NA
WP_003522644.1\|1924225_1924495_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_065655214.1\|1924708_1925851_+	glycosyltransferase	NA	NA	NA	NA
WP_104679501.1\|1926142_1926592_-	hypothetical protein	NA	NA	NA	NA
WP_158662914.1\|1926598_1927717_-	hypothetical protein	NA	NA	NA	NA
WP_104679503.1\|1927860_1928187_-	succinoglycan biosynthesis protein exoi	NA	NA	NA	NA
WP_104679504.1\|1928293_1928482_-	hypothetical protein	NA	NA	NA	NA
WP_104679505.1\|1928481_1928937_-	hypothetical protein	NA	NA	NA	NA
WP_104679506.1\|1929037_1929592_-	hypothetical protein	NA	NA	NA	NA
WP_104679507.1\|1929789_1930296_-	hypothetical protein	NA	NA	NA	NA
WP_104679508.1\|1930610_1931042_-	hypothetical protein	NA	NA	NA	NA
WP_104679509.1\|1931265_1933971_-\|tail	phage tail protein	A0A291AUM6	Sinorhizobium_phage	6.0e-58	44.7
WP_104679510.1\|1933982_1935617_-\|terminase	terminase	A0A286S1M9	Klebsiella_phage	5.1e-36	30.1
WP_104679511.1\|1935609_1936020_-\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA
WP_104679512.1\|1936016_1936334_-\|head	phage head closure protein	NA	NA	NA	NA
WP_104679513.1\|1936330_1936783_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_104679514.1\|1936758_1937184_-	hypothetical protein	NA	NA	NA	NA
WP_104679515.1\|1937173_1937476_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP026925

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

659880 : 668523

Salmonella_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065656775.1\|659880_661785_-	cobaltochelatase subunit CobT	J9Q7G6	Salmonella_phage	4.3e-18	30.3
WP_004445672.1\|661892_662882_-	cobaltochelatase subunit CobS	L7TKP0	Rhizobium_phage	4.9e-42	32.5
WP_059755848.1\|662950_663586_-	DnaJ domain-containing protein	A0A2P1ELC3	Moumouvirus	4.0e-05	42.9
WP_065656776.1\|663700_663982_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_065657049.1\|664094_665159_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	4.4e-28	30.4
WP_065656307.1\|665451_666585_-	3-dehydroquinate synthase	A9YVT7	Ostreococcus_tauri_virus	2.6e-26	30.2
WP_065656308.1\|666590_667172_-	shikimate kinase	NA	NA	NA	NA
WP_104680242.1\|667168_667327_-	hypothetical protein	NA	NA	NA	NA
WP_035239639.1\|667360_667534_+	hypothetical protein	NA	NA	NA	NA
WP_065656309.1\|667530_668523_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.8e-36	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP026928

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82773 : 141704

Stx2-converting_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104680658.1\|82773_84375_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.4e-101	46.7
WP_104680586.1\|84474_84822_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.2e-36	60.7
WP_104680587.1\|84818_85217_-\|transposase	transposase	NA	NA	NA	NA
WP_104680310.1\|85533_86652_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_104680305.1\|87360_90336_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.6e-191	37.6
WP_158662980.1\|90351_90735_+	hypothetical protein	NA	NA	NA	NA
WP_034499648.1\|91370_91658_-	hypothetical protein	NA	NA	NA	NA
WP_078053795.1\|91961_92297_+	hypothetical protein	NA	NA	NA	NA
WP_078053794.1\|92451_92733_+	hypothetical protein	NA	NA	NA	NA
WP_034499653.1\|92879_93245_+	hypothetical protein	NA	NA	NA	NA
WP_104680588.1\|94023_94947_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_104680660.1\|95275_96385_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_104680661.1\|96527_97514_+	ABC transporter permease	NA	NA	NA	NA
WP_104680589.1\|97513_98308_+	ABC transporter permease	NA	NA	NA	NA
WP_104680590.1\|98307_99393_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-31	37.1
WP_104680591.1\|99471_100554_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_104680592.1\|100585_101788_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	1.4e-38	30.9
WP_104680593.1\|101784_102759_+	NAD-dependent epimerase/dehydratase family protein	C7U045	Ostreococcus_tauri_virus	2.5e-06	29.8
WP_104680594.1\|102808_103039_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_158662981.1\|103031_103583_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_158662982.1\|103798_106882_+	calcium-binding protein	NA	NA	NA	NA
WP_104680662.1\|107156_108866_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.6e-22	30.0
WP_104680596.1\|108862_110173_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_104680597.1\|110463_111471_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_104680598.1\|111518_112757_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_104680599.1\|112839_113757_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_104680600.1\|113753_114632_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_104680601.1\|114646_116602_+	glycoside hydrolase family 127 protein	NA	NA	NA	NA
WP_104680663.1\|116625_117738_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	8.9e-24	33.7
WP_104680602.1\|118341_119319_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104680603.1\|119630_121553_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-15	35.1
WP_104680604.1\|121552_122035_+	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_104680605.1\|122186_123119_+	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_158662983.1\|124133_124322_+	hypothetical protein	NA	NA	NA	NA
WP_158662984.1\|125054_125981_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_104680664.1\|126161_127100_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_104680608.1\|127342_127849_+	flavin reductase family protein	NA	NA	NA	NA
WP_104680609.1\|127969_129316_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_104680665.1\|129373_130714_+	MFS transporter	Q6JIH2	Burkholderia_virus	5.3e-39	28.2
WP_104680610.1\|130823_132293_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_104680611.1\|132294_133197_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_104680612.1\|133277_134456_+	MFS transporter	NA	NA	NA	NA
WP_104680613.1\|134504_135158_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.5e-50	50.7
WP_104680614.1\|135841_136573_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_104680615.1\|137286_138144_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_104680616.1\|138231_138609_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104680666.1\|138714_139683_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_104680617.1\|139785_140328_+	cysteine hydrolase	NA	NA	NA	NA
WP_104680667.1\|140450_141224_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_158662985.1\|141449_141704_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026926

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP026924

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP026925

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP026928

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection