CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP026588	Klebsiella pneumoniae strain NUHL30457 plasmid p2, complete sequence	0 crisprs	NA	0	4
NZ_CP026589	Klebsiella pneumoniae strain NUHL30457 plasmid p3, complete sequence	0 crisprs	RT	0	2
NZ_CP026590	Klebsiella pneumoniae strain NUHL30457 plasmid p4, complete sequence	0 crisprs	NA	0	1
NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	0 crisprs	NA	0	2
NZ_CP026586	Klebsiella pneumoniae strain NUHL30457 chromosome, complete genome	1 crisprs	RT,csa3,cas3,DEDDh,DinG,WYL	1	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026586_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026586_1

3962289-3962373

Orphan

Consensus_repeat	Method
TGGCACTTTGTTGGCATTCTGTTGGCACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026586_1

>merge|NZ_CP026586|1|3962289-3962373|CRISPRCasFinder
TGGCACTTTGTTGGCATTCTGTTGGCACAACCTCGCCGGTACGCAGCGTGGTTACTGGGTTTGCGTTGGCACTCTGTTGGCATTC

>NZ_CP026586|1|1|3962289-3962373|CRISPRCasFinder
TGGCACTTTGTTGGCATTCTGTTGGCACAA	CCTCGCCGGTACGCAGCGTGGTTAC
TGGGTTTGCGTTGGCACTCTGTTGGCATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026586.1\|WP_087835226.1\|3966095_3966299_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_012542626.1\|3960165_3960459_-\|protein-ren	unknown	unknown	gnl\|CDD\|238042
NZ_CP026586.1\|WP_104716584.1\|3959373_3959682_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_008807814.1\|3966735_3966942_+\|phage-encoded-cell-division-inhibitor-protein	unknown	unknown	gnl\|CDD\|236900
NZ_CP026586.1\|WP_104716587.1\|3967322_3968168_+\|phage-recombination-protein-Bet	unknown	unknown	gnl\|CDD\|273871
NZ_CP026586.1\|WP_004151298.1\|3962770_3962917_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_016529276.1\|3967022_3967307_+\|host-nuclease-inhibitor-GamL	unknown	unknown	unknown
NZ_CP026586.1\|WP_097403957.1\|3963263_3963482_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP026586.1\|WP_004884220.1\|3957708_3958164_-\|dLP12-prophage	unknown	unknown	gnl\|CDD\|182057
NZ_CP026586.1\|WP_032426208.1\|3956896_3957259_-\|RusA-family-crossover-junction-endodeoxyribonuclease	unknown	unknown	gnl\|CDD\|182075
NZ_CP026586.1\|WP_043875707.1\|3963002_3963224_-\|bacteriophage-CII-family-protein	unknown	unknown	gnl\|CDD\|336083
NZ_CP026586.1\|WP_004191591.1\|3963590_3964250_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP026586.1\|WP_004141687.1\|3957255_3957546_-\|DUF1364-domain-containing-protein	unknown	unknown	gnl\|CDD\|377777
NZ_CP026586.1\|WP_032429601.1\|3956759_3956900_-\|YlcG-family-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_023339691.1\|3959185_3959374_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_104716583.1\|3957538_3957709_-\|NinE-family-protein	unknown	unknown	gnl\|CDD\|182029
NZ_CP026586.1\|WP_162859389.1\|3966584_3966743_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_032452107.1\|3964575_3966018_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379114
NZ_CP026586.1\|WP_104716585.1\|3959788_3960169_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026586.1\|WP_162859394.1\|3960458_3961874_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672

Protein	Function_ID	Function_description	E-value
NZ_CP026586.1\|WP_012542626.1\|3960165_3960459_-\|protein-ren	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	0.000892927
NZ_CP026586.1\|WP_032452107.1\|3964575_3966018_+\|ATP-binding-protein	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	1.13456e-14
NZ_CP026586.1\|WP_004141687.1\|3957255_3957546_-\|DUF1364-domain-containing-protein	gnl\|CDD\|377777	pfam07102, DUF1364, Protein of unknown function (DUF1364). This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.	1.33789e-48
NZ_CP026586.1\|WP_104716587.1\|3967322_3968168_+\|phage-recombination-protein-Bet	gnl\|CDD\|273871	TIGR01913, Uncharacterized_protein_UU154, phage recombination protein Bet. This model represents the phage recombination protein Bet from a number of phage, including phage lambda. All members of this family are found in phage genomes or in putative prophage regions of bacterial genomes. [Mobile and extrachromosomal element functions, Prophage functions].	1.36089e-34
NZ_CP026586.1\|WP_097403957.1\|3963263_3963482_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.3445e-11
NZ_CP026586.1\|WP_004884220.1\|3957708_3958164_-\|dLP12-prophage	gnl\|CDD\|182057	PRK09741, PRK09741, hypothetical protein; Provisional.	1.77097e-78
NZ_CP026586.1\|WP_032426208.1\|3956896_3957259_-\|RusA-family-crossover-junction-endodeoxyribonuclease	gnl\|CDD\|182075	PRK09786, PRK09786, endodeoxyribonuclease RUS; Reviewed.	1.05892e-65
NZ_CP026586.1\|WP_043875707.1\|3963002_3963224_-\|bacteriophage-CII-family-protein	gnl\|CDD\|336083	pfam05269, Phage_CII, Bacteriophage CII protein. This family consists of several phage CII regulatory proteins. CII plays a key role in the lysis-lysogeny decision in bacteriophage lambda and related phages.	3.90482e-09
NZ_CP026586.1\|WP_004191591.1\|3963590_3964250_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	1.60132e-32
NZ_CP026586.1\|WP_008807814.1\|3966735_3966942_+\|phage-encoded-cell-division-inhibitor-protein	gnl\|CDD\|236900	PRK11354, kil, FtsZ inhibitor protein; Reviewed.	1.49968e-15
NZ_CP026586.1\|WP_104716583.1\|3957538_3957709_-\|NinE-family-protein	gnl\|CDD\|182029	PRK09689, PRK09689, prophage protein NinE; Provisional.	1.48885e-20
NZ_CP026586.1\|WP_162859394.1\|3960458_3961874_-\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	1.19933e-158

>NZ_CP026586.1|WP_162859394.1|3960458_3961874_-|AAA-family-ATPase
MTPPHSIEAEQSVLGGLLLDDDSSERTQKVLSILKPESFYSRQHQVIFAEMRQMYRDHKPVDLLTLFDALESKGLTETVGGFAYLAEMSKNTPSAANIVAYAMRVRETAMERYGIEKTTKAIELLYARNGMTAEQKFDAIQGLFTEITDHVKTGRRTGLRTFYDAVTDWSAEFDERLKPDGRSRGLSTGIRSLDELLGVKRIVRGSLFVIGARPKMGKTTLYTQMGINCATVENEPALMFSLEMPEGQMVEKITAQKGRISPNLFYPDMTKEDYGYRGDWNGDLKKATGVMGALIDTNNLLIDDTPGISLVHVVAESRRIKRERGKVGMILVDYLTLMTADKAERNDLAYGLITKGLKTLAKELDCVVVLLTQLNRELEKRTNKRPLPSDSRDTGQIEQDCDYWLAIYREGAYDENANQSDTELLLRLNRHGETGVVYCEQRHGAIYDCDQEAASQRRREKEEKPTKRGGF
>NZ_CP026586.1|WP_012542626.1|3960165_3960459_-|protein-ren
MTGKDAILNYLKTHKTCSSPDVAAASGMTHTCINQAANILAKQGVLVAEARVWRTVYYRLATEEEISGRKSTNQIFNECRQSPAMKRVLAVYGRTSA
>NZ_CP026586.1|WP_104716585.1|3959788_3960169_-|hypothetical-protein
MTITLQAVNELIASLESAGELSIREQKFLKLAKAFKQLAAENVELKQSDRDLDKTCAEEFGQDWVSEFTETPATDRIVAGIKADGVEEFAAKLRIPGDDQFFDALAKGVAIAADDFAKQLREGADK
>NZ_CP026586.1|WP_104716584.1|3959373_3959682_-|hypothetical-protein
MTDITELAQRLKLEVHRAVSNFNPQMNIKTRDLKELVEALEKAQQHIAELESHTITVKMPKLKMLEDYLAEVAFEERKQILVGVKLEFHRALADAGIKVEAE
>NZ_CP026586.1|WP_023339691.1|3959185_3959374_-|hypothetical-protein
MKMGEHMEPVVELLEELNGNNTDAKLKLLALVISEYMLNADVTGFEVTAGKMKVSVDISVEE
>NZ_CP026586.1|WP_004884220.1|3957708_3958164_-|dLP12-prophage
MNIPQCGIKLHSGNFSAIGKILQEQLSDGKCLRLQVKEWREKRSLSQNALSHMWYAEISEYLINSGRTDATPEWVKRNLKKTYLGCEEVTYTDFITGEKTTTWEPRHTSDLDTGEMHIFLTKVEAWCAQFGLALTIPHGCEYQQLQQKQEA
>NZ_CP026586.1|WP_104716583.1|3957538_3957709_-|NinE-family-protein
MNSLLAKVMERGIFRVPARRKRKVEVKPSDIPTFHYTAHLADVRWLRRAARRKSHG
>NZ_CP026586.1|WP_004141687.1|3957255_3957546_-|DUF1364-domain-containing-protein
MADLRKAARGRECQVRIPGVCNGNPETTVLAHIRIAGLCGTGIKPPDLIAAIACSSCHDEIDRRTRLVDAEYAKECALEGMARTQVIWMKEGLIKA
>NZ_CP026586.1|WP_032426208.1|3956896_3957259_-|RusA-family-crossover-junction-endodeoxyribonuclease
MNQYRISLPWPPSNNRYYRHNRGRTHISAEGQAYRDSVARIIKDSMLDIGLATPLKIRIECHMPDRRRRDLDNLQKAAFDALTKSGFWLDDQQVDYYSVKRMPVVKGGRLELTVTEMEAA
>NZ_CP026586.1|WP_032429601.1|3956759_3956900_-|YlcG-family-protein
MSRDVIERIRDRWQKLRLLRSRGTVLVDYRILRNFVRIYQTLGETA
>NZ_CP026586.1|WP_004151298.1|3962770_3962917_-|hypothetical-protein
MPKSNRFYQAQTHKNVTRDRFIRSVNPVVGMKMRAILEELKRKEEGRE
>NZ_CP026586.1|WP_043875707.1|3963002_3963224_-|bacteriophage-CII-family-protein
MESSTTRNKVEARRIESWLHSQIAELGTTTIAKVAGVNKSTVSRWRESLLPNMSLLLAILISNRTGEKGDFEA
>NZ_CP026586.1|WP_097403957.1|3963263_3963482_-|helix-turn-helix-transcriptional-regulator
MNNLSKIRRRAGLTQRQIATELNLTAGAICHYENGKRDLSIEQCRKIVSALNKYGACVSIDDVFPPSKASAA
>NZ_CP026586.1|WP_004191591.1|3963590_3964250_+|helix-turn-helix-domain-containing-protein
MSMKWYDLAKSLMKTKGINQEELAEHLGITKGAVSHWLNARREPSLEDIAKILRFLGKNNFSVGAGGMIIDENIKGDVEYVGPYKRGNEYPVLSSVQAGSWREAIEPYSIKDVDLWLESNAHIQGEAFWLLVEGDSMTSPVGLSIPEGTYVLFDTGREPVNGSLVIAKLSESNEATFKKLIIDGGQKYLKGLNPQWPLVPINGNCRIIGVAVETKLRLV
>NZ_CP026586.1|WP_032452107.1|3964575_3966018_+|ATP-binding-protein
MAISKEMRKLINKWKTGTSWPKRLEWLEIKGIRGWSGQRVDIQFPIVALVGENGSGKSTVLQCAASVYKDKKKRFASFYFPDTPFEKIQSAYIRYSYREGNNSVVKSIRKPTNRWIGNPERPDRRVEYVDLSRLQPVNARLGYLKLLKGGSTEQAHEAFDNERLERLRNIIGKSYTAAGLSTTTIDAKRPVTVISNEGARYSGFHQGAGEITATELIAVDYPKYGLILIDEIETSLHPRAQRRLMRDLANLARERELQILITTHSPYILSELPPEARIYLMNGIEGKTAVSGVSPEFAMTKMDEENHPECDLYVEDVIAKTLVSEVIASSKERELLSRVMIIPFGTASVGMALGQMAHNKRFPRSTVVYLDGDQSPAVGCTILPGDDAPEVVVFNALQEKGWPNVSEKIGREPAETIDALNSSMSNADHHGWPRAAANSLNVGSEILWHAMCSSWAKNCMSEDDLDAVLQPIVDALETER
>NZ_CP026586.1|WP_087835226.1|3966095_3966299_-|hypothetical-protein
MSNEDEFFAEMHPQIAQIIGIAVMQLLVEKREPSREALIEMIQVLWQSDQVDLPVELALDVLMLREE
>NZ_CP026586.1|WP_162859389.1|3966584_3966743_+|hypothetical-protein
MRTDSKRVLPDAWWFSMSRNGLRSLIYCLLICGVIWTALIIKILHVTGVFNG
>NZ_CP026586.1|WP_008807814.1|3966735_3966942_+|phage-encoded-cell-division-inhibitor-protein
MVSHHYGTQTVNRGAVLPGMLVKHRESTWTASANKRGRLYLHRGIERTYTTDLLVEVYLNGLGQGLSR
>NZ_CP026586.1|WP_016529276.1|3967022_3967307_+|host-nuclease-inhibitor-GamL
MNAYRAYDAIEERKWAEQSLTEEKQKWIDDRAQEIIDALPKEPSGLFRFSVPMDKSPYEGLRSDAAGEAYNDLISAVAYAQAEYDWDHRTGCPF
>NZ_CP026586.1|WP_104716587.1|3967322_3968168_+|phage-recombination-protein-Bet
MANELVITASTIAERGIDGATWSALKNSIYPGAKDESVMMALDYCRARNLDPLLKPVHLVPMSVKDSKTGKSEWRDVVMPGIGLYRIQADRSGDYAGAKEPEFGPDVTLTLTGVEVTVPQWCKYTVSKRMPSGEIVEFSAKEYWVENYATAGRDTTAPNAMWKKRPYGQLAKCAEAQALRKAWPEIGQQPTAEEMEGKTLEVDARDVTPRSATEALPLAASGETLQAITDLLTSLNKDWEQDFLPLCSNIFKRDIFQASQLTEEEAQKGFSFLQKKAQVAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP026586_1	1.1\|3962319\|25\|NZ_CP026586\|CRISPRCasFinder	3962319-3962343	25	MK448233	Klebsiella phage ST11-VIM1phi8.1, complete genome	8458-8482	1.0
NZ_CP026586_1	1.1\|3962319\|25\|NZ_CP026586\|CRISPRCasFinder	3962319-3962343	25	MK448235	Klebsiella phage ST512-KPC3phi13.1, complete genome	8458-8482	1.0
NZ_CP026586_1	1.1\|3962319\|25\|NZ_CP026586\|CRISPRCasFinder	3962319-3962343	25	MK448231	Klebsiella phage ST101-KPC2phi6.1, complete genome	11394-11418	1.0

1. spacer 1.1|3962319|25|NZ_CP026586|CRISPRCasFinder matches to MK448233 (Klebsiella phage ST11-VIM1phi8.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttac	CRISPR spacer
cctcgccggtacgcagcgtggttac	Protospacer
*************************

2. spacer 1.1|3962319|25|NZ_CP026586|CRISPRCasFinder matches to MK448235 (Klebsiella phage ST512-KPC3phi13.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttac	CRISPR spacer
cctcgccggtacgcagcgtggttac	Protospacer
*************************

3. spacer 1.1|3962319|25|NZ_CP026586|CRISPRCasFinder matches to MK448231 (Klebsiella phage ST101-KPC2phi6.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttac	CRISPR spacer
cctcgccggtacgcagcgtggttac	Protospacer
*************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1243159 : 1294246

Klebsiella_phage(21.28%)

tail,holin,coat,tRNA,integrase,terminase

attL 1235825:1235841|attR 1297978:1297994

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1235825:1235841	attL	NA	NA	NA	NA
WP_002914079.1\|1243159_1243897_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_004144357.1\|1243881_1245501_-	L-aspartate oxidase	NA	NA	NA	NA
WP_121980491.1\|1245829_1245925_+	rpoE leader peptide RseD	NA	NA	NA	NA
WP_002914074.1\|1245921_1246497_+	RNA polymerase sigma factor RpoE	NA	NA	NA	NA
WP_002914072.1\|1246529_1247180_+	anti-sigma-E factor RseA	NA	NA	NA	NA
WP_002914070.1\|1247179_1248136_+	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
WP_004144354.1\|1248132_1248612_+	SoxR-reducing system protein RseC	NA	NA	NA	NA
WP_104716491.1\|1249043_1250273_+\|integrase	site-specific integrase	H6WRW7	Salmonella_phage	1.5e-237	95.8
WP_023301228.1\|1250250_1250526_-	excisionase Xis	H6WRW8	Salmonella_phage	9.2e-31	72.7
WP_071557557.1\|1250564_1250804_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	3.2e-24	71.8
WP_104716492.1\|1250811_1251120_-	hypothetical protein	I6PD68	Cronobacter_phage	1.2e-23	55.9
WP_104716493.1\|1251116_1251800_-	morphogenetic protein	H2BDG4	Pseudomonas_virus	5.8e-42	44.2
WP_104716494.1\|1251834_1252923_-	recombinase RecT	H6WRX0	Salmonella_phage	1.1e-106	56.0
WP_104716495.1\|1252935_1255974_-	exodeoxyribonuclease	H6WRX1	Salmonella_phage	5.0e-295	57.9
WP_023282477.1\|1256111_1256267_-	hypothetical protein	K7PGY4	Enterobacteria_phage	2.0e-14	71.2
WP_004179600.1\|1256275_1256467_-	YebW family protein	NA	NA	NA	NA
WP_048230998.1\|1256897_1257254_-	hypothetical protein	NA	NA	NA	NA
WP_048230996.1\|1257350_1257614_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_104716496.1\|1257616_1258153_+	hypothetical protein	M9NZI6	Enterobacteria_phage	3.1e-59	67.8
WP_004215886.1\|1258500_1259421_+	hypothetical protein	K7PGZ0	Enterobacteria_phage	1.7e-92	61.3
WP_004215885.1\|1259417_1260161_+	replication protein P	A0A0M3ULE2	Salmonella_phage	3.1e-65	55.2
WP_016946299.1\|1260153_1260489_+	DUF977 family protein	H6WRX9	Salmonella_phage	4.4e-11	43.0
WP_104716497.1\|1260481_1261267_+	hypothetical protein	C7BGF1	Burkholderia_phage	1.8e-63	52.5
WP_048279473.1\|1261263_1261467_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	3.8e-26	83.3
WP_004184518.1\|1261459_1261714_+	hypothetical protein	S5MQM0	Escherichia_phage	5.3e-09	50.7
WP_075995090.1\|1261710_1261947_+	hypothetical protein	S4TVX5	Salmonella_phage	7.4e-13	48.5
WP_104716498.1\|1261939_1262485_+	hypothetical protein	NA	NA	NA	NA
WP_104716499.1\|1263357_1263615_+	hypothetical protein	NA	NA	NA	NA
WP_104716500.1\|1263611_1265579_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.3e-203	55.2
WP_032423783.1\|1265727_1265961_+	DinI-like family protein	K7PM44	Enterobacteria_phage	5.8e-26	70.1
WP_022631486.1\|1266038_1266260_+	hypothetical protein	NA	NA	NA	NA
WP_023328006.1\|1266317_1266917_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	1.3e-90	79.9
WP_004892208.1\|1267125_1267422_+	DUF1364 domain-containing protein	A0A0U2KD41	Escherichia_phage	1.2e-36	72.9
WP_023282412.1\|1267418_1267775_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	1.5e-41	64.1
WP_023287514.1\|1267890_1268712_+	antitermination protein	K7PKS8	Enterobacteria_phage	1.1e-98	67.5
WP_024176410.1\|1268968_1269268_+\|holin	holin	A0A286N2Q5	Klebsiella_phage	4.5e-39	83.8
WP_023301209.1\|1269264_1269804_+	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	7.4e-101	98.3
WP_023320787.1\|1269800_1270148_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.1e-40	81.7
WP_104716501.1\|1270144_1270420_+	hypothetical protein	A0A286N2Q8	Klebsiella_phage	3.5e-06	91.2
WP_104716502.1\|1270370_1270565_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.2e-24	90.2
WP_032427058.1\|1270561_1270822_+	hypothetical protein	G8C7W3	Escherichia_phage	2.1e-21	58.0
WP_073545918.1\|1270926_1271163_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	3.8e-17	62.8
WP_104716504.1\|1271412_1272417_+\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	1.7e-34	43.3
WP_087653572.1\|1272394_1273699_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.7e-144	58.9
WP_087588067.1\|1273702_1275127_+	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	8.3e-192	70.9
WP_104716505.1\|1275110_1276223_+	hypothetical protein	I6PD76	Cronobacter_phage	1.2e-108	54.1
WP_048271641.1\|1276326_1277091_+	hypothetical protein	G8C7P6	Escherichia_phage	1.3e-79	62.2
WP_104716506.1\|1277178_1278315_+\|coat	P22 coat - protein 5 family protein	G8C7P7	Escherichia_phage	1.3e-155	74.6
WP_104716507.1\|1278850_1279261_+	protein singed	A0A0H5AUF0	Pseudomonas_phage	9.3e-11	41.2
WP_074186757.1\|1279262_1279496_+	hypothetical protein	A0A1V0E8A3	Vibrio_phage	2.6e-10	50.8
WP_104716508.1\|1279482_1279866_+	glutamate 5-kinase	A0A0S2SYG4	Pseudomonas_phage	5.4e-21	45.2
WP_064155820.1\|1279867_1280419_+	hypothetical protein	G8C7Q1	Escherichia_phage	1.0e-28	40.4
WP_064155821.1\|1280415_1280808_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_104716509.1\|1280831_1282004_+	Ig domain-containing protein	A0A0D4DBN5	Acinetobacter_phage	9.4e-24	27.0
WP_104716510.1\|1282057_1282540_+	hypothetical protein	NA	NA	NA	NA
WP_072158607.1\|1282677_1282884_+	hypothetical protein	NA	NA	NA	NA
WP_004217333.1\|1282960_1283317_+	hypothetical protein	A0A1V0E5P9	Salmonella_phage	1.1e-44	75.0
WP_057775156.1\|1283366_1283651_+	hypothetical protein	NA	NA	NA	NA
WP_104716511.1\|1283861_1287440_+\|tail	phage tail tape measure protein	K7PMB9	Enterobacterial_phage	7.0e-78	29.4
WP_104716512.1\|1287439_1287904_+	hypothetical protein	A0A286S298	Klebsiella_phage	9.3e-60	69.1
WP_104716513.1\|1288084_1288567_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	3.4e-81	93.8
WP_004190616.1\|1288576_1288957_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	1.5e-55	77.0
WP_104716514.1\|1288953_1292016_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	94.0
WP_043906946.1\|1292092_1294246_+	hypothetical protein	B5TAB2	Burkholderia_phage	9.6e-83	42.7
1297978:1297994	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1360482 : 1375204

Morganella_phage(50.0%)

tail,integrase

attL 1360235:1360255|attR 1380299:1380319

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1360235:1360255	attL	NA	NA	NA	NA
WP_032424540.1\|1360482_1361736_+\|integrase	site-specific integrase	A0A1W6JPG6	Morganella_phage	7.2e-147	60.4
WP_004213158.1\|1361831_1362839_+	hypothetical protein	NA	NA	NA	NA
WP_004213159.1\|1362969_1363188_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_004213160.1\|1363187_1363622_+	hypothetical protein	A0A1W6JPH9	Morganella_phage	2.4e-25	55.3
WP_004213161.1\|1363635_1364238_+	hypothetical protein	A0A1W6JPH8	Morganella_phage	1.2e-54	57.8
WP_004213162.1\|1364237_1364417_+	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_023302683.1\|1364413_1365379_+	ash family protein	A0A291AWU3	Escherichia_phage	3.9e-07	44.3
WP_004213165.1\|1365375_1365879_+	hypothetical protein	NA	NA	NA	NA
WP_004213166.1\|1365875_1366085_+	hypothetical protein	NA	NA	NA	NA
WP_004213167.1\|1366081_1366708_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.6e-25	37.8
WP_004213168.1\|1366717_1367068_+	hypothetical protein	A0A1B5FPL8	Escherichia_phage	3.4e-38	70.0
WP_004213169.1\|1367060_1369823_+	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	2.8e-292	56.1
WP_032424539.1\|1370162_1370609_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_004213171.1\|1370589_1370973_+	PerC family transcriptional regulator	NA	NA	NA	NA
WP_004213172.1\|1370977_1371451_+	hypothetical protein	NA	NA	NA	NA
WP_004213173.1\|1371634_1371805_+	hypothetical protein	NA	NA	NA	NA
WP_004213174.1\|1371804_1372131_+	hypothetical protein	NA	NA	NA	NA
WP_004213175.1\|1372138_1375204_+\|tail	phage tail length tape-measure protein 1	B1GS57	Salmonella_phage	2.0e-94	40.5
1380299:1380319	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1717107 : 1724012

Planktothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004180551.1\|1717107_1717971_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
WP_004214747.1\|1717981_1718755_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-26	36.7
WP_004151134.1\|1718995_1719892_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
WP_004144192.1\|1720134_1721496_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_004201558.1\|1721814_1722537_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004214740.1\|1722533_1724012_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	1.4e-29	28.3

DBSCAN-SWA_4

2687296 : 2696710

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161267581.1\|2687296_2688931_+	DUF4981 domain-containing protein	L0N6M2	Herpes_simplex_virus	4.4e-181	55.5
WP_004176258.1\|2688985_2690251_+	MFS transporter	NA	NA	NA	NA
WP_004209813.1\|2690281_2691370_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	1.0e-210	99.7
WP_004176262.1\|2691456_2691717_-	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_001620095.1\|2692014_2692875_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_004209817.1\|2692895_2693657_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	5.5e-134	99.6
WP_002903955.1\|2693917_2694820_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_004183946.1\|2694831_2696097_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	6.6e-233	99.3
WP_002210516.1\|2696089_2696710_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_5

2731918 : 2811232

Klebsiella_phage(21.43%)

tail,head,holin,protease,capsid,portal,integrase,terminase

attL 2757534:2757550|attR 2790296:2790312

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004209779.1\|2731918_2732731_+\|protease	serine protease	NA	NA	NA	NA
WP_002903685.1\|2732744_2732861_+	hypothetical protein	NA	NA	NA	NA
WP_002903683.1\|2732904_2733234_-	multidrug efflux SMR transporter subunit KpnF	NA	NA	NA	NA
WP_002903681.1\|2733220_2733583_-	multidrug efflux SMR transporter subunit KpnE	NA	NA	NA	NA
WP_002903679.1\|2734025_2735060_+	AI-2E family transporter	NA	NA	NA	NA
WP_002903677.1\|2735284_2736940_+	malonate decarboxylase subunit alpha	NA	NA	NA	NA
WP_004143107.1\|2736939_2737782_+	triphosphoribosyl-dephospho-CoA synthase	NA	NA	NA	NA
WP_002903639.1\|2737799_2738099_+	malonate decarboxylase acyl carrier protein	NA	NA	NA	NA
WP_004143105.1\|2738091_2738925_+	biotin-independent malonate decarboxylase subunit beta	NA	NA	NA	NA
WP_004209782.1\|2738924_2739725_+	biotin-independent malonate decarboxylase subunit gamma	NA	NA	NA	NA
WP_004209783.1\|2739861_2740821_+	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	2.7e-53	90.3
WP_004209784.1\|2740824_2741442_+	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
WP_004209787.1\|2741441_2742344_+	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
WP_004148289.1\|2742333_2743260_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_022615525.1\|2743417_2745073_-	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_004209791.1\|2745337_2746258_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_004179716.1\|2746421_2746778_-	hypothetical protein	NA	NA	NA	NA
WP_004183910.1\|2746933_2748550_+	two-component system sensor histidine kinase DcuS	NA	NA	NA	NA
WP_004176303.1\|2748546_2749266_+	two-component system response regulator DcuR	NA	NA	NA	NA
WP_004209794.1\|2749246_2750197_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_004209796.1\|2750264_2753042_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	6.8e-65	31.0
WP_002903581.1\|2753759_2755196_+	anion permease	NA	NA	NA	NA
WP_004152246.1\|2755250_2756903_+	class I fumarate hydratase	NA	NA	NA	NA
WP_023302609.1\|2757065_2758682_+	mechanosensitive ion channel	NA	NA	NA	NA
2757534:2757550	attL	NA	NA	NA	NA
WP_004143067.1\|2759726_2760116_-	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_004215412.1\|2760108_2760873_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
WP_020316475.1\|2760862_2762215_-	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_004214878.1\|2762224_2763427_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_004176317.1\|2763437_2764094_-	CoA transferase subunit B	NA	NA	NA	NA
WP_002903522.1\|2764104_2764791_-	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_004151560.1\|2764960_2765767_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004143055.1\|2765763_2766327_-	DNA endonuclease SmrA	NA	NA	NA	NA
WP_004148273.1\|2766428_2767337_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004214881.1\|2767503_2768814_+	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_004176321.1\|2768813_2770259_+	amidohydrolase	NA	NA	NA	NA
WP_022615523.1\|2770378_2771497_+	transporter	NA	NA	NA	NA
WP_004214887.1\|2771625_2772726_+\|integrase	site-specific integrase	A0A1W6JP34	Morganella_phage	8.3e-115	56.8
WP_004214894.1\|2773927_2774227_-	hypothetical protein	NA	NA	NA	NA
WP_022615522.1\|2774394_2775039_+	hypothetical protein	NA	NA	NA	NA
WP_022615521.1\|2775094_2775829_-	hypothetical protein	NA	NA	NA	NA
WP_039108567.1\|2775841_2777995_-	hypothetical protein	B5TAB2	Burkholderia_phage	4.8e-90	42.2
WP_016530179.1\|2778067_2781145_-	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	61.5
WP_022615519.1\|2781141_2781522_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	1.6e-57	80.2
WP_004864228.1\|2781534_2782011_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	4.8e-51	65.8
WP_004177132.1\|2781997_2782471_-	hypothetical protein	A0A286S298	Klebsiella_phage	1.4e-55	62.1
WP_039108569.1\|2782491_2785881_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	0.0e+00	60.5
WP_016530182.1\|2785941_2786175_-	hypothetical protein	K7PH16	Enterobacteria_phage	1.9e-08	47.2
WP_016530183.1\|2786248_2786554_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	4.7e-28	64.6
WP_016530184.1\|2786556_2786961_-\|tail	phage tail assembly chaperone	K7PKV6	Enterobacterial_phage	3.2e-32	57.4
WP_016530185.1\|2786991_2787696_-	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	6.6e-81	67.4
WP_016530186.1\|2787752_2788100_-	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	2.8e-32	63.7
WP_016530187.1\|2788096_2788546_-	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	7.4e-62	81.9
WP_016530188.1\|2788542_2788881_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	7.8e-40	70.5
WP_016530189.1\|2788889_2789207_-\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	1.8e-22	51.0
WP_023284978.1\|2789284_2790523_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	1.8e-158	69.4
2790296:2790312	attR	NA	NA	NA	NA
WP_000999827.1\|2790532_2791132_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-90	82.5
WP_016530190.1\|2791124_2792351_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	3.2e-208	85.3
WP_016530191.1\|2792340_2792502_-	hypothetical protein	NA	NA	NA	NA
WP_025108055.1\|2792498_2794250_-\|terminase	terminase large subunit	A0A1P8DTK0	Proteus_phage	4.0e-252	72.5
WP_016530193.1\|2794253_2794751_-\|terminase	phage terminase small subunit P27 family	A0A1W6JP17	Morganella_phage	5.7e-63	73.9
WP_023317581.1\|2794908_2795259_-	HNH endonuclease	A0A1B5FP94	Escherichia_phage	4.6e-51	81.6
WP_039108578.1\|2795360_2795762_-	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_039108580.1\|2795837_2796083_-	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.8e-31	91.4
WP_039108582.1\|2796402_2796594_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	3.4e-24	94.6
WP_039108585.1\|2796544_2796820_-	hypothetical protein	NA	NA	NA	NA
WP_039108587.1\|2796816_2797164_-	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	78.3
WP_039108588.1\|2797160_2797700_-	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	4.8e-100	97.2
WP_024176410.1\|2797696_2797996_-\|holin	holin	A0A286N2Q5	Klebsiella_phage	4.5e-39	83.8
WP_125330507.1\|2798811_2799138_-	hypothetical protein	NA	NA	NA	NA
WP_004886669.1\|2799405_2800227_+	hypothetical protein	NA	NA	NA	NA
WP_004886665.1\|2800251_2800737_+	hypothetical protein	NA	NA	NA	NA
WP_004886660.1\|2800785_2801127_-	antitermination protein from phage origin	A0A0P0ZCW0	Stx2-converting_phage	2.5e-54	84.1
WP_039108593.1\|2801145_2802126_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.1e-134	66.9
WP_000779146.1\|2802138_2802516_-	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.3e-48	73.6
WP_039108595.1\|2802525_2803335_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	5.0e-109	68.5
WP_039108597.1\|2803331_2804270_-	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	2.0e-101	74.2
WP_004184738.1\|2804259_2804439_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.6e-15	75.0
WP_004213338.1\|2804676_2805138_-	hypothetical protein	K7PJS5	Enterobacterial_phage	1.7e-69	88.2
WP_016530206.1\|2805163_2805361_-	hypothetical protein	H9C161	Pectobacterium_phage	2.7e-16	66.1
WP_032408726.1\|2805465_2806113_+	helix-turn-helix domain-containing protein	H9C160	Pectobacterium_phage	9.3e-74	63.0
WP_004213349.1\|2806880_2807180_+	hypothetical protein	K7PJS4	Enterobacterial_phage	9.4e-13	46.7
WP_004213351.1\|2807179_2807965_+	hypothetical protein	C7BGF1	Burkholderia_phage	5.3e-63	52.9
WP_004213355.1\|2808092_2808437_+	hypothetical protein	NA	NA	NA	NA
WP_039108606.1\|2808429_2809092_+	morphogenetic protein	Q71T76	Escherichia_phage	2.2e-54	56.0
WP_039108608.1\|2809088_2809274_+	hypothetical protein	NA	NA	NA	NA
WP_016530209.1\|2809393_2809654_+	hypothetical protein	A0A1L5C290	Pseudoalteromonas_phage	1.5e-11	43.7
WP_002903398.1\|2810265_2810424_-	hypothetical protein	NA	NA	NA	NA
WP_004213367.1\|2810716_2811232_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.0e-23	54.9

DBSCAN-SWA_6

3109110 : 3154112

Enterobacteria_phage(51.43%)

tail,head,capsid,portal,plate,tRNA,integrase,terminase

attL 3114338:3114355|attR 3150379:3150396

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004213129.1\|3109110_3109611_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_002901080.1\|3109727_3110174_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_004140469.1\|3110157_3110952_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020324105.1\|3111059_3112235_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_004140471.1\|3112266_3112959_-	CTP synthase	NA	NA	NA	NA
WP_004176547.1\|3113104_3113614_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_014343000.1\|3113618_3113957_+	DUF488 family protein	NA	NA	NA	NA
WP_004176548.1\|3113946_3114186_-	DUF333 domain-containing protein	NA	NA	NA	NA
3114338:3114355	attL	NA	NA	NA	NA
WP_004213128.1\|3114450_3114702_-	ogr/Delta-like zinc finger family protein	A0A2I8TV89	Erwinia_phage	3.4e-08	49.2
WP_032432765.1\|3114745_3115885_-	phage late control D family protein	B9A7A9	Serratia_phage	1.6e-145	71.0
WP_064146766.1\|3116039_3117212_+\|tail	phage tail sheath family protein	A0A0A7NV69	Enterobacteria_phage	1.1e-157	70.5
WP_064146767.1\|3117211_3117727_+\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	6.3e-57	60.6
WP_004131585.1\|3117772_3118090_+	hypothetical protein	B9A7B2	Serratia_phage	1.0e-17	54.8
WP_071993210.1\|3118110_3118248_+\|tail	GpE family phage tail protein	A0A0A7NQ96	Enterobacteria_phage	5.8e-10	65.9
WP_104716547.1\|3118234_3121210_+\|tail	phage tail tape measure protein	A0A0A7NRZ9	Enterobacteria_phage	4.4e-219	46.6
WP_064146769.1\|3121224_3121698_+\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	1.3e-53	67.6
WP_064146770.1\|3122160_3122823_-	hypothetical protein	NA	NA	NA	NA
WP_077274787.1\|3122840_3124064_-	DUF262 domain-containing protein	A0A1V0S9I8	Catovirus	7.8e-05	27.5
WP_064146771.1\|3124663_3125761_-\|tail	phage tail protein	G4KKN6	Yersinia_phage	5.2e-08	47.8
WP_104716548.1\|3125760_3125973_-	hypothetical protein	NA	NA	NA	NA
WP_064146772.1\|3125969_3128996_-\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	6.4e-24	40.7
WP_060568679.1\|3128985_3129909_-\|plate	baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	5.8e-53	43.6
WP_004131573.1\|3129910_3130261_-\|plate	baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	6.2e-24	59.3
WP_064146773.1\|3130257_3130845_-\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	2.6e-59	60.5
WP_064146774.1\|3130841_3131477_-	phage virion morphogenesis protein	A0A0A7NV60	Enterobacteria_phage	1.6e-57	52.4
WP_064146775.1\|3131473_3131941_-\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	7.0e-47	59.5
WP_158608812.1\|3131941_3132277_-	peptidase	B6SD31	Bacteriophage	4.3e-06	34.4
WP_064146776.1\|3132463_3133009_-	lysozyme	Q1I0Z1	Pasteurella_virus	7.4e-32	44.1
WP_104716549.1\|3133005_3133290_-\|tail	phage tail protein	NA	NA	NA	NA
WP_004131559.1\|3133280_3133481_-\|tail	tail protein	A0A0A7NV57	Enterobacteria_phage	1.6e-16	63.1
WP_047720963.1\|3133480_3133996_-\|head	head completion/stabilization protein	A0A0A7NPU2	Enterobacteria_phage	4.1e-40	49.4
WP_064146777.1\|3134108_3134966_-\|terminase	terminase	A0A0A7NPX9	Enterobacteria_phage	2.8e-70	58.5
WP_048299350.1\|3135015_3136050_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	8.1e-96	50.0
WP_048299349.1\|3136059_3136899_-\|capsid	GPO family capsid scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	1.2e-94	66.3
WP_104716550.1\|3137055_3138783_+	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	3.1e-233	68.3
WP_104716551.1\|3138776_3139838_+\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	4.1e-143	69.6
WP_151433774.1\|3140429_3141956_-	hypothetical protein	NA	NA	NA	NA
WP_064146780.1\|3142590_3142857_-	hypothetical protein	NA	NA	NA	NA
WP_064146781.1\|3142853_3145481_-	replication protein	A0A0M4RTM8	Salmonella_phage	7.1e-189	51.8
WP_064146782.1\|3145498_3146455_-	DNA adenine methylase	A0A0M4QWR0	Salmonella_phage	1.9e-83	54.1
WP_162859387.1\|3146451_3146643_-	hypothetical protein	A0A286S1P6	Klebsiella_phage	2.7e-05	41.8
WP_064146784.1\|3146689_3147256_-	3'-5' exoribonuclease	D4HTX2	Vibrio_phage	5.5e-14	32.6
WP_004213098.1\|3147252_3147477_-	hypothetical protein	NA	NA	NA	NA
WP_004216855.1\|3147545_3147818_-	hypothetical protein	NA	NA	NA	NA
WP_040181449.1\|3147833_3148211_-	hypothetical protein	NA	NA	NA	NA
WP_004216643.1\|3148226_3148445_-	hypothetical protein	A0A0M5M1I3	Salmonella_phage	3.6e-06	49.1
WP_020806130.1\|3148465_3148744_-	regulatory protein Cox	Q1JS60	Enterobacteria_phage	6.2e-43	88.9
WP_004213095.1\|3148864_3149164_+	helix-turn-helix transcriptional regulator	Q1JS61	Enterobacteria_phage	6.5e-38	77.8
WP_004216842.1\|3149279_3150263_+\|integrase	tyrosine-type recombinase/integrase	Q83VS6	Escherichia_phage	6.4e-151	80.1
WP_004176549.1\|3150527_3151541_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.9e-12	29.0
3150379:3150396	attR	NA	NA	NA	NA
WP_004150782.1\|3151598_3151700_+	YoaK family small membrane protein	NA	NA	NA	NA
WP_004213093.1\|3151699_3151774_+	protein YoaJ	NA	NA	NA	NA
WP_004140488.1\|3151891_3152017_+	hypothetical protein	NA	NA	NA	NA
WP_004140489.1\|3152075_3152339_-	DUF2534 family protein	NA	NA	NA	NA
WP_004150783.1\|3152469_3153108_-	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004148038.1\|3153197_3154112_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4

DBSCAN-SWA_7

3436537 : 3446001

Brazilian_cedratvirus(16.67%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004209699.1\|3436537_3438259_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
WP_004141853.1\|3438285_3439005_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_001040187.1\|3439358_3439577_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_002896522.1\|3439697_3441977_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_002896520.1\|3442007_3442325_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896516.1\|3442650_3442872_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_023302553.1\|3442948_3444889_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.2e-36	40.1
WP_002896440.1\|3444885_3446001_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7

DBSCAN-SWA_8

3928525 : 3976176

Enterobacteria_phage(20.75%)

head,coat,tRNA,integrase,terminase

attL 3927340:3927386|attR 3973247:3973293

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3927340:3927386	attL	NA	NA	NA	NA
WP_104716567.1\|3928525_3930709_-	hypothetical protein	B5TAB2	Burkholderia_phage	1.3e-82	42.7
WP_104716568.1\|3930795_3933273_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	8.8e-197	45.5
WP_023341837.1\|3933259_3933655_-	hypothetical protein	F1C5F2	Cronobacter_phage	2.1e-36	56.3
WP_023341838.1\|3933651_3934122_-	hypothetical protein	R9TPR6	Aeromonas_phage	9.6e-28	40.4
WP_023283377.1\|3934121_3934598_-	hypothetical protein	A0A2P1MXB5	Escherichia_phage	3.0e-37	49.0
WP_048987939.1\|3934660_3935284_-	hypothetical protein	NA	NA	NA	NA
WP_104716569.1\|3935306_3938612_-	tape measure protein	R9TMK1	Aeromonas_phage	1.4e-213	53.9
WP_162859393.1\|3938684_3939623_-	hypothetical protein	A5VW58	Enterobacteria_phage	1.3e-81	73.3
WP_064484068.1\|3939729_3939897_-	Arc family DNA-binding protein	G9L6D7	Escherichia_phage	7.3e-15	69.8
WP_077254637.1\|3940022_3940376_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_063443022.1\|3940416_3940851_-	hypothetical protein	NA	NA	NA	NA
WP_019724823.1\|3940925_3941180_-	hypothetical protein	K7PM89	Enterobacteria_phage	2.3e-20	74.6
WP_050008822.1\|3941182_3941938_-	DNA-binding protein	K7PGT4	Enterobacteria_phage	2.1e-61	51.8
WP_104716570.1\|3942116_3942794_-	hypothetical protein	F1C5E8	Cronobacter_phage	2.2e-73	57.9
WP_004151263.1\|3942846_3943599_-	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	5.8e-43	42.1
WP_032442345.1\|3943667_3944060_-	hypothetical protein	G0ZNE4	Cronobacter_phage	9.7e-34	51.2
WP_104716571.1\|3944056_3944482_-	hypothetical protein	R9TPP7	Aeromonas_phage	6.6e-28	47.9
WP_016528891.1\|3944484_3944847_-	hypothetical protein	A0A0M3LSC9	Mannheimia_phage	2.5e-20	49.2
WP_096834996.1\|3944846_3945020_-	50S ribosomal protein L13	I6R0P9	Salmonella_phage	5.4e-13	54.4
WP_104716572.1\|3945019_3945403_-	hypothetical protein	F1C5E2	Cronobacter_phage	8.0e-49	77.2
WP_104716573.1\|3945405_3945645_-	hypothetical protein	NA	NA	NA	NA
WP_104716574.1\|3945677_3946733_-\|coat	phage coat protein	A0A291AXD4	Shigella_phage	3.5e-102	53.2
WP_101739635.1\|3946729_3947191_-	hypothetical protein	B1GS72	Salmonella_phage	1.7e-29	51.0
WP_104716575.1\|3947190_3948546_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	5.1e-130	52.9
WP_104716576.1\|3948611_3949292_-	HNH endonuclease	S5M802	Pseudoalteromonas_phage	1.5e-37	38.7
WP_104716577.1\|3949393_3950398_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	2.1e-112	68.0
WP_104716578.1\|3950324_3951794_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	6.9e-149	56.3
WP_104716579.1\|3951806_3953279_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	2.0e-249	82.7
WP_104716580.1\|3953278_3953881_-	hypothetical protein	G8C7P2	Escherichia_phage	2.9e-77	81.5
WP_104716582.1\|3954406_3954790_-	DUF2570 domain-containing protein	M9NYX9	Enterobacteria_phage	2.1e-09	51.2
WP_043906736.1\|3954786_3955290_-	lysozyme	A0A1V0E5Q7	Salmonella_phage	8.5e-75	79.0
WP_004146347.1\|3955292_3955607_-	hypothetical protein	H6WRZ3	Salmonella_phage	6.3e-44	86.1
WP_050485953.1\|3956121_3956577_-	hypothetical protein	Q8HA89	Salmonella_phage	3.6e-24	39.4
WP_032429601.1\|3956759_3956900_-	YlcG family protein	NA	NA	NA	NA
WP_032426208.1\|3956896_3957259_-	RusA family crossover junction endodeoxyribonuclease	K7PM48	Enterobacteria_phage	3.3e-52	82.4
WP_004141687.1\|3957255_3957546_-	DUF1364 domain-containing protein	K7PGZ6	Enterobacteria_phage	5.3e-45	88.5
WP_104716583.1\|3957538_3957709_-	NinE family protein	K7P7K0	Enterobacteria_phage	1.6e-09	63.6
WP_004884220.1\|3957708_3958164_-	dLP12 prophage	K7P7B8	Enterobacteria_phage	1.0e-55	69.5
WP_023339691.1\|3959185_3959374_-	hypothetical protein	A0A192Y8X2	Salmonella_phage	3.7e-23	88.7
WP_104716584.1\|3959373_3959682_-	hypothetical protein	NA	NA	NA	NA
WP_104716585.1\|3959788_3960169_-	hypothetical protein	R9TME7	Aeromonas_phage	9.2e-13	40.3
WP_012542626.1\|3960165_3960459_-	protein ren	O48423	Enterobacteria_phage	2.5e-26	65.6
WP_162859394.1\|3960458_3961874_-	AAA family ATPase	Q9MCT4	Escherichia_phage	1.1e-183	67.5
WP_073545955.1\|3961878_3962730_-	DNA replication protein	F1C5C3	Cronobacter_phage	6.9e-85	56.3
WP_004151298.1\|3962770_3962917_-	hypothetical protein	NA	NA	NA	NA
WP_043875707.1\|3963002_3963224_-	bacteriophage CII family protein	NA	NA	NA	NA
WP_097403957.1\|3963263_3963482_-	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	1.1e-13	50.7
WP_004191591.1\|3963590_3964250_+	helix-turn-helix domain-containing protein	K7P7K3	Enterobacteria_phage	8.3e-70	62.4
WP_032452107.1\|3964575_3966018_+	ATP-binding protein	NA	NA	NA	NA
WP_087835226.1\|3966095_3966299_-	hypothetical protein	A0A192Y6Q5	Salmonella_phage	3.5e-19	70.1
WP_162859389.1\|3966584_3966743_+	hypothetical protein	NA	NA	NA	NA
WP_008807814.1\|3966735_3966942_+	phage encoded cell division inhibitor protein	A0A0M4S6W3	Salmonella_phage	1.4e-31	94.1
WP_016529276.1\|3967022_3967307_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	8.6e-40	79.8
WP_104716587.1\|3967322_3968168_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	4.5e-68	58.0
WP_004223153.1\|3968164_3968845_+	YqaJ viral recombinase family protein	A0A0M3ULE0	Salmonella_phage	2.3e-123	92.9
WP_004178787.1\|3968841_3969270_+	hypothetical protein	M9NYX4	Enterobacteria_phage	7.5e-64	81.0
WP_104716588.1\|3969266_3969920_+	DNA methyltransferase	G8C7S6	Escherichia_phage	3.3e-111	87.0
WP_074182332.1\|3969916_3970375_+	HNH endonuclease	G9FH70	Rhodococcus_phage	2.1e-24	42.1
WP_004146321.1\|3971420_3971639_+	hypothetical protein	A0A1I9LJM7	Stx_converting_phage	2.1e-09	47.2
WP_101839117.1\|3971640_3971856_+	TraR/DksA family transcriptional regulator	A0A0K2FI84	Escherichia_phage	1.2e-14	57.1
WP_004151317.1\|3971857_3972193_+	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_104716589.1\|3972069_3973233_+\|integrase	site-specific integrase	G8C7S0	Escherichia_phage	2.9e-203	87.1
WP_004143017.1\|3973664_3974531_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
3973247:3973293	attR	NA	NA	NA	NA
WP_004143016.1\|3974532_3974745_+	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_004143010.1\|3974790_3976176_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026588

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12940

Escherichia_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006788217.1\|1244_1424_-	hypothetical protein	NA	NA	NA	NA
WP_004197649.1\|1543_2170_-	ParA family plasmid-partitioning AAA ATPase	A0A222YXS3	Escherichia_phage	2.9e-40	43.6
WP_004098982.1\|2834_3710_-	RepB family plasmid replication initiator protein	Q71TL8	Escherichia_phage	5.6e-82	56.4
WP_004197646.1\|4121_5393_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	5.2e-153	64.0
WP_001568036.1\|5392_5824_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
WP_001568038.1\|6057_7029_+	hypothetical protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
WP_015345000.1\|7031_7703_+	mediator of plasmid stability	NA	NA	NA	NA
WP_001568040.1\|7766_7997_+	hypothetical protein	NA	NA	NA	NA
WP_014343518.1\|8115_8232_+	hypothetical protein	NA	NA	NA	NA
WP_001568041.1\|8433_9135_+	DNA methylase	A0A2I7RE86	Vibrio_phage	1.6e-26	36.2
WP_001568042.1\|9134_9356_+	hypothetical protein	NA	NA	NA	NA
WP_001568043.1\|9365_9785_+	DUF1380 domain-containing protein	NA	NA	NA	NA
WP_013214013.1\|9838_10606_+	hypothetical protein	NA	NA	NA	NA
WP_015344998.1\|10678_11035_+	hypothetical protein	NA	NA	NA	NA
WP_015060021.1\|11049_11715_+	DUF1472 domain-containing protein	NA	NA	NA	NA
WP_013214014.1\|11757_12264_+	antirestriction protein	G9FHQ1	Rhodococcus_virus	1.2e-07	31.4
WP_001568047.1\|12306_12498_+	hypothetical protein	NA	NA	NA	NA
WP_011977779.1\|12685_12940_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	4.0e-12	48.8

DBSCAN-SWA_2

15978 : 20338

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152756.1\|15978_16542_+	methyltransferase	M4M9L8	Vibrio_phage	1.7e-18	42.0
WP_015344995.1\|16913_17255_+	hypothetical protein	NA	NA	NA	NA
WP_015344994.1\|17371_17914_+	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	4.6e-50	76.7
WP_001568055.1\|17962_18211_+	DUF905 domain-containing protein	NA	NA	NA	NA
WP_013023805.1\|18280_20338_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	1.2e-21	25.4

DBSCAN-SWA_3

26264 : 31185

Klebsiella_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013023814.1\|26264_26621_+	hypothetical protein	A0A248SL90	Klebsiella_phage	2.6e-25	58.1
WP_013023815.1\|26681_26894_+	hypothetical protein	NA	NA	NA	NA
WP_004152719.1\|26904_27129_+	hypothetical protein	NA	NA	NA	NA
WP_004152720.1\|27209_27530_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	6.8e-09	39.5
WP_004152721.1\|27519_27798_+	helix-turn-helix transcriptional regulator	O64356	Escherichia_phage	2.5e-07	39.4
WP_013023817.1\|27798_28212_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015344990.1\|28347_29556_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.8e-47	46.3
WP_074421342.1\|29883_30060_+	hypothetical protein	NA	NA	NA	NA
WP_004152492.1\|30363_31185_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.2e-44	40.1

DBSCAN-SWA_4

65741 : 108539

Escherichia_phage(25.0%)

transposase,integrase

attL 91743:91802|attR 105959:106779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013023834.1\|65741_66467_+	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	1.2e-05	28.3
WP_013609537.1\|66538_67132_+	fertility inhibition protein FinO	NA	NA	NA	NA
WP_013023836.1\|67292_67895_+	hypothetical protein	NA	NA	NA	NA
WP_014343481.1\|67944_68589_+	hypothetical protein	NA	NA	NA	NA
WP_014343480.1\|68644_69295_+	DUF2726 domain-containing protein	NA	NA	NA	NA
WP_004152383.1\|69291_69600_+	hypothetical protein	K7PKY8	Enterobacterial_phage	1.1e-08	31.7
WP_001067858.1\|69787_70492_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_048337415.1\|70525_70783_-	hypothetical protein	NA	NA	NA	NA
WP_000493286.1\|71018_71348_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000780222.1\|71328_71610_+	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_077256884.1\|71756_72332_-	DUF4113 domain-containing protein	F1C5A5	Cronobacter_phage	1.6e-45	59.3
WP_012477564.1\|72382_72973_+	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_001493762.1\|73109_73682_+	recombinase family protein	M9Q1K0	Clostridium_phage	3.4e-19	39.4
WP_001493761.1\|73718_75110_+\|transposase	ISKra4-like element ISKpn19 family transposase	NA	NA	NA	NA
WP_001516695.1\|75391_76048_+	quinolone resistance pentapeptide repeat protein QnrS1	NA	NA	NA	NA
WP_011091028.1\|80012_80888_+	class A extended-spectrum beta-lactamase CTX-M-3	A0A1B0VBP7	Salmonella_phage	5.4e-125	82.1
WP_013023839.1\|80934_81411_-	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
WP_000027057.1\|81669_82530_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|82712_83270_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_001143759.1\|83433_86439_+\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	99.8
WP_094545105.1\|86440_87169_+	DUF3363 domain-containing protein	NA	NA	NA	NA
WP_000214121.1\|87385_88600_+	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	8.0e-18	28.3
WP_001255015.1\|88627_88933_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000804063.1\|89199_90399_-	tetracycline efflux MFS transporter Tet(A)	NA	NA	NA	NA
WP_000164043.1\|90504_91155_+	tetracycline resistance transcriptional repressor TetR(A)	NA	NA	NA	NA
WP_000844627.1\|91186_91429_-\|transposase	transposase	NA	NA	NA	NA
91743:91802	attL	NA	NA	NA	NA
WP_001067855.1\|91805_92510_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000219391.1\|92631_93537_+	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_000004159.1\|93533_94772_+	MFS transporter	NA	NA	NA	NA
WP_001137892.1\|94771_95356_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001389365.1\|95848_96613_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_000050481.1\|97496_99038_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|99442_100282_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|100275_100623_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001749984.1\|100739_101585_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA16	NA	NA	NA	NA
WP_001749985.1\|101765_102239_-	trimethoprim-resistant dihydrofolate reductase DfrA27	G3MBI7	Bacillus_virus	1.4e-15	29.1
WP_001749986.1\|102371_102824_-	NAD(+)--rifampin ADP-ribosyltransferase Arr-3	NA	NA	NA	NA
WP_063840321.1\|102920_103475_-	fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5	NA	NA	NA	NA
WP_000845048.1\|103766_104780_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001067855.1\|105250_105955_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001323889.1\|106278_107856_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	1.2e-95	99.4
105959:106779	attR	NA	NA	NA	NA
WP_014343478.1\|108059_108539_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	2.7e-17	31.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP026590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11561 : 18429

Escherichia_phage(33.33%)

integrase,transposase

attL 12247:12261|attR 22131:22145

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|11561_12266_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
12247:12261	attL	NA	NA	NA	NA
WP_000845048.1\|12480_13494_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004201280.1\|13649_14123_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
WP_001144737.1\|14343_14610_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_001389365.1\|14752_15517_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_004098817.1\|15777_16992_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_072094655.1\|17025_18429_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	9.0e-106	50.6
22131:22145	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP026587

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

44378 : 93564

Bacillus_phage(27.78%)

integrase,transposase

attL 34840:34854|attR 80501:80515

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
34840:34854	attL	NA	NA	NA	NA
WP_004213592.1\|44378_47348_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.3
WP_004213590.1\|47350_47908_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	2.6e-48	81.3
WP_000118563.1\|48037_49114_-	signal peptidase II	NA	NA	NA	NA
WP_104716610.1\|49110_51516_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-141	46.1
WP_000405672.1\|51601_52036_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_004152084.1\|52331_53732_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	4.1e-18	26.3
WP_001188930.1\|53728_54409_-	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4
WP_004213583.1\|54463_55393_-	copper resistance inner membrane protein PcoD	NA	NA	NA	NA
WP_000025662.1\|55397_55778_-	copper resistance system metallochaperone PcoC	NA	NA	NA	NA
WP_011251290.1\|55817_56714_-	copper resistance outer membrane transporter PcoB	NA	NA	NA	NA
WP_004213580.1\|56713_58531_-	multicopper oxidase PcoA	NA	NA	NA	NA
WP_001023257.1\|58764_59214_+	copper resistance protein	NA	NA	NA	NA
WP_004118669.1\|59502_60240_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
WP_000843497.1\|60273_60471_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_004098955.1\|60511_62959_-	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	7.6e-84	35.8
WP_000758228.1\|63085_63526_-	hypothetical protein	NA	NA	NA	NA
WP_004098958.1\|63612_66759_-	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	S5VTK5	Leptospira_phage	4.0e-61	22.5
WP_004213579.1\|66769_68062_-	Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB	NA	NA	NA	NA
WP_004213578.1\|68175_68538_-	cation efflux system protein CusF	NA	NA	NA	NA
WP_004213577.1\|68566_69952_-	Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC	NA	NA	NA	NA
WP_004213574.1\|70141_70822_+	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	1.3e-30	35.7
WP_000555737.1\|70814_72290_+	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.0e-27	30.1
WP_023302802.1\|72540_72972_+	silver-binding protein SilE	NA	NA	NA	NA
WP_004213569.1\|73115_73466_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.2e-20	53.3
WP_023302803.1\|73852_74761_-	HNH endonuclease	NA	NA	NA	NA
WP_004213565.1\|75397_76372_+	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
WP_077250520.1\|77304_78117_+	hypothetical protein	NA	NA	NA	NA
WP_004213560.1\|78113_78893_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	6.0e-51	89.4
WP_004213558.1\|79037_79967_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.6e-72	52.4
WP_077250517.1\|80279_80438_+	hypothetical protein	A0A0U2RK18	Escherichia_phage	2.2e-05	69.7
WP_011154535.1\|80552_81521_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.1e-171	91.0
80501:80515	attR	NA	NA	NA	NA
WP_023302792.1\|81561_82416_+	nucleotide-binding protein	NA	NA	NA	NA
WP_004215174.1\|82464_84690_-	exclusion suppressor FxsA	NA	NA	NA	NA
WP_004215173.1\|84691_85594_-	hypothetical protein	NA	NA	NA	NA
WP_004225020.1\|85677_85860_+	hypothetical protein	NA	NA	NA	NA
WP_004215188.1\|85878_86340_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_004215186.1\|86455_87403_+	DMT family transporter	NA	NA	NA	NA
WP_004225018.1\|87738_88734_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	3.1e-20	28.7
WP_004210218.1\|88939_89953_-	NAD(P)-dependent alcohol dehydrogenase	M1PHA2	Moumouvirus	5.8e-06	26.0
WP_004210220.1\|90065_90593_+	cupin domain-containing protein	NA	NA	NA	NA
WP_077250518.1\|90606_93564_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	2.3e-50	22.8

DBSCAN-SWA_2

137373 : 213005

Salmonella_phage(17.65%)

integrase,transposase

attL 136826:136844|attR 197114:197132

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
136826:136844	attL	NA	NA	NA	NA
WP_004213833.1\|137373_138510_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_004213829.1\|138575_138893_-	hypothetical protein	NA	NA	NA	NA
WP_004197568.1\|139044_139368_-	hypothetical protein	NA	NA	NA	NA
WP_011154511.1\|140119_141079_-	hypothetical protein	NA	NA	NA	NA
WP_004186937.1\|141121_141529_-	hypothetical protein	NA	NA	NA	NA
WP_004213821.1\|141538_141982_-	hypothetical protein	NA	NA	NA	NA
WP_004213807.1\|143245_144214_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	7.3e-14	28.8
WP_023302784.1\|144541_146134_-\|transposase	IS66-like element ISKox1 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.2e-176	61.8
WP_104716613.1\|146164_146515_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.5e-38	62.9
WP_004215130.1\|146511_146952_-	IS66 family insertion sequence hypothetical protein	Q6H9S5	Enterobacteria_phage	4.4e-19	53.8
WP_004902307.1\|147148_147331_+	DUF4113 domain-containing protein	A0A1W6JNT0	Morganella_phage	9.1e-11	57.1
WP_023302806.1\|148579_149551_-	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	6.6e-156	89.7
WP_004211841.1\|149550_150717_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	2.0e-223	97.4
WP_004211839.1\|151446_152457_+	replication initiation protein	J9Q7H0	Salmonella_phage	1.1e-86	53.5
WP_004211835.1\|154776_155313_-	hypothetical protein	NA	NA	NA	NA
WP_004214667.1\|158063_158846_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	3.0e-135	96.1
WP_004902343.1\|161192_161630_-	hypothetical protein	NA	NA	NA	NA
WP_004902347.1\|161629_162661_-	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	2.9e-08	26.1
WP_011251296.1\|162660_163527_-	ParA family protein	NA	NA	NA	NA
WP_011154535.1\|166198_167167_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.1e-171	91.0
WP_004213078.1\|167257_167548_-	hypothetical protein	NA	NA	NA	NA
WP_004213077.1\|167899_168106_+	hypothetical protein	NA	NA	NA	NA
WP_004213076.1\|168095_168389_-	hypothetical protein	NA	NA	NA	NA
WP_004213075.1\|168404_169538_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_004213073.1\|170145_170376_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004213072.1\|170372_170816_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_032488580.1\|171959_172598_+	RmpA2	NA	NA	NA	NA
WP_004213934.1\|173609_174530_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_011251327.1\|174578_175070_-	DM13 domain-containing protein	NA	NA	NA	NA
WP_004213932.1\|175132_175408_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_004902152.1\|175491_175920_-	DUF417 family protein	NA	NA	NA	NA
WP_004213927.1\|175957_176518_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004213925.1\|176559_176820_-	DUF1471 domain-containing protein	A0A1B2IE60	Erwinia_phage	1.1e-06	51.0
WP_004213924.1\|177486_179688_-	ferric aerobactin receptor IutA	NA	NA	NA	NA
WP_104716614.1\|179769_181047_-	NADPH-dependent L-lysine N(6)-monooxygenase	NA	NA	NA	NA
WP_004213922.1\|181050_182784_-	aerobactin synthase IucC	NA	NA	NA	NA
WP_004213921.1\|182783_183731_-	N(6)-hydroxylysine O-acetyltransferase	NA	NA	NA	NA
WP_004213920.1\|183731_185456_-	aerobactin synthase IucA	NA	NA	NA	NA
WP_023302795.1\|185612_186812_+	MFS transporter	NA	NA	NA	NA
WP_004213918.1\|187509_187704_+	hypothetical protein	NA	NA	NA	NA
WP_004145290.1\|188564_189074_+	peptide deformylase	E3SLL2	Synechococcus_phage	8.8e-19	41.9
WP_004213915.1\|189623_189941_-	c-type lysozyme inhibitor	NA	NA	NA	NA
WP_004902159.1\|190177_190564_-	hypothetical protein	NA	NA	NA	NA
WP_004902162.1\|190661_191861_+	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
WP_004213424.1\|192267_192975_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_032412871.1\|193637_194636_-	iron ABC transporter permease	NA	NA	NA	NA
WP_004213250.1\|194641_195598_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004213252.1\|195619_196447_-	ABC transporter ATP-binding protein	M1HV27	Acanthocystis_turfacea_Chlorella_virus	2.2e-11	28.4
WP_011154535.1\|197146_198115_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.1e-171	91.0
197114:197132	attR	NA	NA	NA	NA
WP_004902375.1\|198221_198545_+	hypothetical protein	NA	NA	NA	NA
WP_023302796.1\|199728_200382_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004213611.1\|201939_202491_+	response regulator transcription factor	NA	NA	NA	NA
WP_004213613.1\|202563_203466_+	DMT family transporter	NA	NA	NA	NA
WP_004213615.1\|203608_203830_-	hypothetical protein	NA	NA	NA	NA
WP_004213617.1\|203891_206066_-	siderophore salmochelin receptor IroN	A0A0P0I887	Acinetobacter_phage	2.8e-05	30.6
WP_004902400.1\|206525_207755_-	esterase family protein	NA	NA	NA	NA
WP_023302798.1\|207859_211504_-	salmochelin/enterobactin export ABC transporter IroC	W8CYL7	Bacillus_phage	3.2e-46	29.7
WP_004213623.1\|211646_212762_-	salmochelin biosynthesis C-glycosyltransferase IroB	NA	NA	NA	NA
WP_074160420.1\|212777_213005_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP026589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2356 : 57722

Escherichia_phage(32.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000616807.1\|2356_3010_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000557619.1\|3102_3360_+	type II toxin-antitoxin system antitoxin PemI	NA	NA	NA	NA
WP_001398199.1\|3292_3694_+	type II toxin-antitoxin system toxin endoribonuclease PemK	NA	NA	NA	NA
WP_001067855.1\|5004_5709_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_014342101.1\|6117_6240_-	hypothetical protein	NA	NA	NA	NA
WP_013188475.1\|6219_7095_+	class A extended-spectrum beta-lactamase CTX-M-65	A0A1B0VBP7	Salmonella_phage	6.8e-152	98.9
WP_013362812.1\|7129_8098_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.6e-186	100.0
WP_001067855.1\|9848_10553_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001067855.1\|11663_12368_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_014839979.1\|12433_12952_+	hypothetical protein	NA	NA	NA	NA
WP_104716615.1\|12956_13373_-	FosA3/FosA4 family fosfomycin resistance glutathione transferase	Q2LI91	Bacillus_phage	2.0e-08	35.6
WP_001067855.1\|13758_14463_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000957857.1\|15140_15329_-	hypothetical protein	NA	NA	NA	NA
WP_064441864.1\|15420_15957_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.8e-84	100.0
WP_000027057.1\|16139_17000_+	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_012372818.1\|17169_17925_+	16S rRNA (guanine(1405)-N(7))-methyltransferase RmtB1	NA	NA	NA	NA
WP_001067858.1\|18374_19079_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_071557810.1\|19069_19210_+	hypothetical protein	NA	NA	NA	NA
WP_001333089.1\|21020_21302_+	hypothetical protein	NA	NA	NA	NA
WP_000361389.1\|21424_21775_-	protein stbB	NA	NA	NA	NA
WP_000959884.1\|21777_22740_-	plasmid segregation protein ParM	A0A222YXF2	Escherichia_phage	4.1e-94	53.9
WP_032146011.1\|22886_23180_+	hypothetical protein	NA	NA	NA	NA
WP_000085883.1\|23256_23940_+	DNA methylase	A0A2I7RE86	Vibrio_phage	5.6e-29	37.4
WP_001104881.1\|23940_24162_+	hypothetical protein	NA	NA	NA	NA
WP_000274503.1\|24175_24610_+	DUF1380 domain-containing protein	NA	NA	NA	NA
WP_001198928.1\|25849_26275_+	antirestriction protein	NA	NA	NA	NA
WP_000271762.1\|26321_26744_+	DUF1380 family protein	NA	NA	NA	NA
WP_104716616.1\|26740_26923_+	hypothetical protein	NA	NA	NA	NA
WP_012372796.1\|27236_28904_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-164	53.3
WP_000218642.1\|30303_30534_+	hypothetical protein	NA	NA	NA	NA
WP_000170695.1\|30585_31947_+	DUF3560 domain-containing protein	NA	NA	NA	NA
WP_015059007.1\|31993_32557_+	class I SAM-dependent methyltransferase	A8HNV9	Thalassomonas_phage	6.1e-21	37.3
WP_021537720.1\|32556_32805_+	hypothetical protein	NA	NA	NA	NA
WP_000290834.1\|33399_33927_+	single-stranded DNA-binding protein	I3PGW4	Xanthomonas_phage	6.0e-47	74.4
WP_000006003.1\|33984_34218_+	DUF905 family protein	NA	NA	NA	NA
WP_000845953.1\|36370_36805_+	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_001276217.1\|36801_37521_+	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_001312861.1\|37800_37959_+	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_012881134.1\|38574_38811_-	hypothetical protein	NA	NA	NA	NA
WP_001272251.1\|38873_39170_+	hypothetical protein	NA	NA	NA	NA
WP_001234445.1\|39280_40102_+	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	3.4e-44	38.2
WP_104716617.1\|40398_41046_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_000124981.1\|41322_41706_+	relaxosome protein TraM	NA	NA	NA	NA
WP_015059009.1\|41896_42583_+	PAS domain-containing protein	NA	NA	NA	NA
WP_001254386.1\|42676_42904_+	conjugal transfer relaxosome protein TraY	NA	NA	NA	NA
WP_021519752.1\|42937_43303_+	type IV conjugative transfer system pilin TraA	NA	NA	NA	NA
WP_000012106.1\|43317_43629_+	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_000399794.1\|43650_44217_+	type IV conjugative transfer system protein TraE	NA	NA	NA	NA
WP_072095570.1\|44227_44932_+	type-F conjugative transfer system secretin TraK	NA	NA	NA	NA
WP_032297072.1\|44931_46359_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_000002778.1\|46348_46939_+	conjugal transfer protein TraP	NA	NA	NA	NA
WP_001352845.1\|46892_47123_+	conjugal transfer protein TrbD	NA	NA	NA	NA
WP_001038341.1\|47134_47386_+	conjugal transfer protein TrbG	NA	NA	NA	NA
WP_062955122.1\|47382_47898_+	type IV conjugative transfer system lipoprotein TraV	NA	NA	NA	NA
WP_001278692.1\|48032_48254_+	conjugal transfer protein TraR	A2I309	Vibrio_virus	4.4e-07	39.4
WP_001067855.1\|49069_49774_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_013213989.1\|50089_50515_+	antirestriction protein	A0A2D0W8Z5	Bordetella_virus	5.3e-17	37.3
WP_013213988.1\|50642_50798_+	hypothetical protein	NA	NA	NA	NA
WP_013213987.1\|50843_51140_+	transcriptional regulator	NA	NA	NA	NA
WP_004199234.1\|52374_53256_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_014343469.1\|53272_53419_+	hypothetical protein	NA	NA	NA	NA
WP_013213985.1\|53531_54512_-\|transposase	IS481-like element ISKpn27 family transposase	A8RHK4	Spiroplasma_virus	2.9e-10	27.4
WP_014343468.1\|54634_55108_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	3.3e-76	99.3
WP_001067855.1\|55147_55852_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_008324180.1\|55977_56352_-	hypothetical protein	A0A248SL90	Klebsiella_phage	2.2e-27	62.7
WP_015493069.1\|56977_57337_-	hypothetical protein	NA	NA	NA	NA
WP_008324183.1\|57398_57722_-	hypothetical protein	I3UM57	Rhodobacter_phage	6.0e-13	38.1

DBSCAN-SWA_2

62205 : 76011

Enterobacteria_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015493072.1\|62205_62460_-	hypothetical protein	H9C187	Pectobacterium_phage	5.2e-12	46.2
WP_015493073.1\|62652_62844_-	hypothetical protein	NA	NA	NA	NA
WP_015493074.1\|62886_63393_-	antirestriction protein ArdA	A0A1I9S7Y0	Rhodococcus_phage	4.8e-09	31.8
WP_015493075.1\|63797_64577_-	hypothetical protein	NA	NA	NA	NA
WP_015493076.1\|64630_65050_-	DUF1380 domain-containing protein	NA	NA	NA	NA
WP_015493077.1\|65060_65282_-	hypothetical protein	NA	NA	NA	NA
WP_002211749.1\|65281_65959_-	DNA methylase	A0A2I7RE86	Vibrio_phage	1.6e-28	36.9
WP_015493079.1\|66317_66989_+	Gifsy-2 prophage protein	A0A2H4J5W2	uncultured_Caudovirales_phage	5.1e-83	61.7
WP_015493080.1\|67168_67591_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.1e-30	51.5
WP_015493081.1\|67590_68862_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	6.1e-154	63.0
WP_016479949.1\|68997_69969_-	ParB/RepB/Spo0J family partition protein	Q1MVJ4	Enterobacteria_phage	1.4e-113	68.9
WP_015493083.1\|69965_71171_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	1.1e-205	89.2
WP_022652286.1\|71533_72166_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.5e-07	31.9
WP_040219232.1\|72219_72420_+	hypothetical protein	NA	NA	NA	NA
WP_015493085.1\|72566_73517_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	6.6e-76	55.6
WP_015493086.1\|73513_74125_-	DUF2913 family protein	NA	NA	NA	NA
WP_015493087.1\|74121_74517_-	hypothetical protein	NA	NA	NA	NA
WP_000019445.1\|75030_76011_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026586

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP026588

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP026590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP026587

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. NZ_CP026589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection