CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP026748	Acinetobacter baumannii strain WCHAB005133 plasmid p1_005133, complete sequence	0 crisprs	NA	0	0
NZ_CP026750	Acinetobacter baumannii strain WCHAB005133 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3,RT	0	7
NZ_CP026749	Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence	1 crisprs	NA	1	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026750_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026750_1

2324563-2324648

Orphan

Consensus_repeat	Method
CCAGCTTCACGAGCCTCTTCTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026750_1

>merge|NZ_CP026750|1|2324563-2324648|CRISPRCasFinder
CCAGCTTCACGAGCCTCTTCTGAGGTAAATTCATGTGCGTTACCACTGGCATGTGCAGCACGGCCAGCTTCACGAGCTTCTTCTGA

>NZ_CP026750|1|1|2324563-2324648|CRISPRCasFinder
CCAGCTTCACGAGCCTCTTCTGA	GGTAAATTCATGTGCGTTACCACTGGCATGTGCAGCACGG
CCAGCTTCACGAGCTTCTTCTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026750.1\|WP_000498477.1\|2332186_2332408_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_001136759.1\|2332495_2332924_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_000482091.1\|2330693_2331173_+\|damage-inducible-protein-CinA	unknown	unknown	gnl\|CDD\|224463
NZ_CP026750.1\|WP_001145693.1\|2328968_2330378_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP026750.1\|WP_000376215.1\|2321137_2321593_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP026750.1\|WP_001984002.1\|2334306_2334597_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_000937460.1\|2313471_2314107_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP026750.1\|WP_000115408.1\|2315802_2319267_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP026750.1\|WP_000107128.1\|2314846_2315806_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|381147
NZ_CP026750.1\|WP_001990041.1\|2326769_2328914_-\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP026750.1\|WP_002017921.1\|2314195_2314309_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_000108365.1\|2331457_2331679_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP026750.1\|WP_001124846.1\|2322431_2323043_-\|DNA-polymerase-V	unknown	unknown	gnl\|CDD\|182350
NZ_CP026750.1\|WP_000432330.1\|2325834_2326713_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187613
NZ_CP026750.1\|WP_000983628.1\|2325279_2325693_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_000132044.1\|2331784_2332102_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_001990047.1\|2319432_2321079_+\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374
NZ_CP026750.1\|WP_000885229.1\|2321749_2322361_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP026750.1\|WP_000795915.1\|2323325_2323562_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026750.1\|WP_001025680.1\|2314418_2314703_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642

Protein	Function_ID	Function_description	E-value
NZ_CP026750.1\|WP_000482091.1\|2330693_2331173_+\|damage-inducible-protein-CinA	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP026750.1\|WP_000376215.1\|2321137_2321593_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	8.76675e-40
NZ_CP026750.1\|WP_000937460.1\|2313471_2314107_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.9036e-64
NZ_CP026750.1\|WP_000115408.1\|2315802_2319267_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	3.64852e-57
NZ_CP026750.1\|WP_000107128.1\|2314846_2315806_-\|DNA-binding-response-regulator	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	6.21476e-55
NZ_CP026750.1\|WP_001990041.1\|2326769_2328914_-\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP026750.1\|WP_000432330.1\|2325834_2326713_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.69173e-160
NZ_CP026750.1\|WP_000108365.1\|2331457_2331679_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	5.30417e-06
NZ_CP026750.1\|WP_001124846.1\|2322431_2323043_-\|DNA-polymerase-V	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	2.36027e-39
NZ_CP026750.1\|WP_001145693.1\|2328968_2330378_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.51279e-18
NZ_CP026750.1\|WP_001990047.1\|2319432_2321079_+\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	9.5172e-23
NZ_CP026750.1\|WP_000885229.1\|2321749_2322361_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.70108e-23
NZ_CP026750.1\|WP_001025680.1\|2314418_2314703_-\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	1.0722e-24

>NZ_CP026750.1|WP_000795915.1|2323325_2323562_+|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP026750.1|WP_001124846.1|2322431_2323043_-|DNA-polymerase-V
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTNNQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFHPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP026750.1|WP_000885229.1|2321749_2322361_+|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLLTPPTPNESGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIGQI
>NZ_CP026750.1|WP_000376215.1|2321137_2321593_-|Lrp/AsnC-family-transcriptional-regulator
MDRTDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNLVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVARDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG
>NZ_CP026750.1|WP_001990047.1|2319432_2321079_+|allantoin-permease
MTENDWEIDVMSVSEHPNLDTVQGADSQKAVNETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGASIGMSYGTTNAVFSILFAAIIIFLTGIPLAYYAARYNIDLDLITRGAGFGYIGSVLTSIIFASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLISTVMVIPLVIYGMKALSKLQVWTTPLWLVLMIGPVAYLIYQEPTLVSQFATFTGHEGFAPVDMAAIMLGAGICLSLIMQIGEQIDYLRFMPAKTKENSKAWWAAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPGVNSTEPVQQFNAAFHDMLPGWAALTLAVILVVISQIKINVTNAYSGSLAWTSAYTRISKHYPGRIVFVIVNLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDISINKYVLKLSPKEPEYRRDMLYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPIIALVLAFVLTPIMGLLTKGKYYIKSHDDGVKEPRYDAEGTPVATVYHCRVCEQGYERPDIMFSHKHNGTICSLCKTLDA
>NZ_CP026750.1|WP_000115408.1|2315802_2319267_-|hybrid-sensor-histidine-kinase/response-regulator
MSVMPDTSRPQQAPQRVIKTRREYNIWVADESIEDYALRYAPTSVRKWSPWTVTNTAISTVSFLAMEAIGATMLWQYGFSNALWAAIVVCTIIFLTSWPISYYAAKYNVDVDLLTRGAGFGYIGSTITSLIYASFTFILLAFEAAIMAMALELALGIPQVIGYLISALVILPLVVKGIGFINKVQAVTQPIWLLLLLLPWFFVLWKQPQILSSSLHFVGAVSNSTDFNLYYFGAACTLIFSFVIQIGEQADYLRFLPQKEKNRTAWRFAVFLGGPSWIIFGFLKVLMGMLLMVLAFQLFIPVSELDNPTYLYWVAYQQFIPNPQLALILTLALVCLAQIKINMTNAYAGSLAWSNFFARLTHSHPGRIVWLLFNVFIAIVLMEMGISHAVERILGLYSNIALAWIGAVVADLIICKPLGLSPKGIEFRRAYLYDINPVGVGALLIASVLSMLSYLGFFGLMAKGLASFIALGSAVLCVPVIAYLTTGKYYIARQPEKIQATLVANCVVCERDYELADMAGCPAYNGTICSLCCSLEARCHDLCKPDARWSVQLKKAIWHYLPERWASRLNSRVSLYLLLTLGLSIVLAVSLSLVYIQEKTYLETINAAAVPQLFTLFVKIYTILFLLMSVAAWWLVLNDESRRNAEIETHQQTALLIDEIAAHEVTSKDLQDARIAAERANDAKSRYVIGISHELRTPLNSILGYSQLLQKQEQLSEQGKMALGVISRSGQHLTSLIDGLLDLARIETGKISLNVVDVHFPNFIEQIIQMFQPQFEQKNLQFVYEIGENLPHYVRTDKKRLEQVLINLLGNALKFTTSGTITLKVEYRFQTAYFEIRDTGCGIAEADLERIFNPFERGSNVVQGGFTGIGLGLPIVKLLVDLLGGQLSVTSQLNQGSQFKIKFYLPSKEVVHPISNVYSNQITGYQGERKRILVVDNEAVDRGLVANFLKPLGFMIEEAESGIDCLRRVPIFQPNLILMDLNMPLMGGWETARLLRQNNITNVPILIISANAGEREVNPQDAVLSEDFMLKPIDLNLLLSKIGDKLGLVWIDSKSETLLENNEVQALDLNIYKQEQVAVHTLIQQPENNELLDFPQSLQQLNDLIGQGYIRGIQQTLTQCRQNFPKHNELWEQLEQAIQKFDLKHAQRLIQDKQ
>NZ_CP026750.1|WP_000107128.1|2314846_2315806_-|DNA-binding-response-regulator
MSTQHVSFQQASPNEQAVILIVDDVPENLGLLHESLDQAGYRVLVTTDGLSAIEIAHRCLPDMILLDGNMPHMDGFESCIQLKASPITQFIPVIFMTGLSETEHIVRGFQVGGVDYVTKPLNIEEVLARVKTHLAHAKLLQQQKQVIDATETAILALDVHGKIVWKTQKASDLLNQYLPELEGFEAGLKAWFSDLEHEKDPKKLTSCSYSTPSQQLQLLLLTPWETEPSVAKNYLIQIKTSTPALEMADILKYCPQLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAHINSLVQEFH
>NZ_CP026750.1|WP_001025680.1|2314418_2314703_-|N-acetyltransferase
MNIQQKDDTKHGSFSLLDGETVAGEMTYTWAGESMLIIDATDVNENYRGQGVGRQLLDALVAFVREKDVKVIPLCPYAKSVFDKDPSIGDVLRK
>NZ_CP026750.1|WP_002017921.1|2314195_2314309_+|hypothetical-protein
MCNKFIFFPIGLKLFLLDKLFYKFDKFDLAIENLQIS
>NZ_CP026750.1|WP_000937460.1|2313471_2314107_-|amino-acid-ABC-transporter-permease
MLPQFFSATLTTLKISIISIILAIIVGLICSILITYHVRVLNRIAQFYIELSRNTPLLIQLFFLYYGLPKLGIKIDGFACGVIGLTFLGGSYMAEAFRAGLQSVAKGQIDSAKSIGLKPTQIFRYVIFPQALAISIPAIGANCLFLIKESSVVSAIAVVELLFVTKDLIGMDYKTTEALFLLIMAYLIILLPVSILTSYLEHRSRKVSHGT
>NZ_CP026750.1|WP_000983628.1|2325279_2325693_+|hypothetical-protein
MMQPTHTHSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKILDNIVVKNSKNKDDLKNIVEAETVIKEILDLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP026750.1|WP_000432330.1|2325834_2326713_+|NAD(P)-dependent-oxidoreductase
MENTTNQYPSEVPAQVQPHQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLKEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFTMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP026750.1|WP_001990041.1|2326769_2328914_-|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEHGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLSYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP026750.1|WP_001145693.1|2328968_2330378_-|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKEKKARDFLVKEIDKLEMKEIDFPSDINLIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNQYRDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTEHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSSFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSSDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP026750.1|WP_000482091.1|2330693_2331173_+|damage-inducible-protein-CinA
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP026750.1|WP_000108365.1|2331457_2331679_+|hypothetical-protein
MSTTNNQANQRNNQQQQQQQNDNRNQQQHGNQQQNDQQQQNNQQQQQNDNRGQQQGSNQKDSGQQNSNNNQQR
>NZ_CP026750.1|WP_000132044.1|2331784_2332102_+|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDI
>NZ_CP026750.1|WP_000498477.1|2332186_2332408_-|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATTPSVQFKKEVFDDPNLANQYLSHNFNMPPFF
>NZ_CP026750.1|WP_001136759.1|2332495_2332924_-|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP026750.1|WP_001984002.1|2334306_2334597_+|hypothetical-protein
MFFLYRFVLVSLLTIGVLNLMGCRPMSKNEFNTRCVWAGHDLSACNCIYNSLEQHYSPQFVESLPKLSLQNIDAKMNFVETMNQTMQQCQLSASKH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

996196 : 1041556

Acinetobacter_phage(66.67%)

tail,integrase,holin,head

attL 1025876:1025890|attR 1051421:1051435

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000108908.1\|996196_996523_+	hypothetical protein	A0A0P0I444	Acinetobacter_phage	3.2e-06	36.0
WP_000612880.1\|996519_997374_+	phosphoadenosine phosphosulfate reductase	NA	NA	NA	NA
WP_000049976.1\|997370_998474_+	hypothetical protein	A0A0P0IKQ2	Acinetobacter_phage	1.4e-29	56.1
WP_000631609.1\|998470_998929_+	hypothetical protein	NA	NA	NA	NA
WP_000755976.1\|998925_999792_+	hypothetical protein	A0A2H4J5Y9	uncultured_Caudovirales_phage	1.4e-72	43.7
WP_000779000.1\|999803_1000202_+	HNH endonuclease	K7P7B7	Enterobacteria_phage	1.5e-26	48.5
WP_001039747.1\|1000198_1000381_+	hypothetical protein	NA	NA	NA	NA
WP_001293626.1\|1000367_1000769_+	hypothetical protein	NA	NA	NA	NA
WP_000203140.1\|1000765_1001173_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	4.0e-22	51.8
WP_001279874.1\|1001182_1001467_+	hypothetical protein	NA	NA	NA	NA
WP_000214487.1\|1001488_1002052_+	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	3.2e-46	52.5
WP_001989822.1\|1002232_1002463_+	hypothetical protein	NA	NA	NA	NA
WP_000837652.1\|1002648_1003419_+	restriction endonuclease subunit M	Q8W6S4	Burkholderia_virus	1.4e-89	60.8
WP_002016982.1\|1003520_1003724_+	hypothetical protein	NA	NA	NA	NA
WP_000377939.1\|1003896_1004364_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	4.4e-65	76.8
WP_000372127.1\|1004332_1004974_+	hypothetical protein	J7I4N9	Acinetobacter_phage	4.4e-124	97.2
WP_000729373.1\|1005032_1005503_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	2.6e-73	89.7
WP_000102065.1\|1005492_1006920_+	hypothetical protein	A0A0D4DCE6	Acinetobacter_phage	1.2e-251	88.4
WP_001286349.1\|1006916_1008368_+	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	1.2e-259	90.2
WP_000741600.1\|1008369_1009473_+\|head	head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	5.9e-177	83.4
WP_000166323.1\|1009765_1010278_+	hypothetical protein	NA	NA	NA	NA
WP_000159880.1\|1010346_1010661_+	hypothetical protein	A0A0S3UFT8	Pseudomonas_phage	3.4e-13	48.5
WP_000770060.1\|1010774_1011542_+	hypothetical protein	J7I0W4	Acinetobacter_phage	8.1e-117	94.1
WP_000214195.1\|1011569_1012526_+	hypothetical protein	A0A0D4DBM4	Acinetobacter_phage	5.6e-168	93.7
WP_000767881.1\|1012590_1013256_+	stress-responsive nuclear envelope protein	J7I4P7	Acinetobacter_phage	5.2e-72	67.4
WP_000008492.1\|1013260_1013650_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	9.5e-66	98.4
WP_001197735.1\|1013606_1014020_+	hypothetical protein	J7I467	Acinetobacter_phage	5.6e-56	76.6
WP_000248324.1\|1014028_1014433_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	4.9e-65	92.5
WP_000539752.1\|1014404_1014773_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	4.8e-51	80.3
WP_001132270.1\|1014774_1015173_+	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	4.0e-51	71.2
WP_000121166.1\|1015174_1015387_+	hypothetical protein	A0A0D4DC29	Acinetobacter_phage	1.3e-21	75.4
WP_000094300.1\|1015494_1016424_+	hypothetical protein	A0A059VG08	Pseudomonas_phage	5.3e-54	40.8
WP_001185622.1\|1016468_1017002_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	6.3e-44	59.9
WP_000838146.1\|1017333_1017516_+	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
WP_000966689.1\|1017580_1017985_+	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	1.0e-62	88.8
WP_000720591.1\|1018065_1018467_+	hypothetical protein	NA	NA	NA	NA
WP_000191304.1\|1018527_1022493_+	replication protein	A0A0D4DC37	Acinetobacter_phage	3.7e-165	44.7
WP_001281459.1\|1022610_1022952_+\|tail	phage tail protein	NA	NA	NA	NA
WP_000985763.1\|1023006_1023357_+	hypothetical protein	NA	NA	NA	NA
WP_000175075.1\|1023366_1024065_+\|tail	phage minor tail protein L	A0A0R6PIG8	Moraxella_phage	4.8e-92	68.1
WP_000778488.1\|1024071_1024827_+\|tail	tail protein	A0A0R6PIM4	Moraxella_phage	4.5e-88	57.4
WP_000920736.1\|1024810_1025482_+\|tail	tail assembly protein	A0A0R6PIW1	Moraxella_phage	1.2e-39	46.8
WP_001018917.1\|1025548_1035568_+\|tail	tail protein	A0A0R6PIC9	Moraxella_phage	1.6e-10	37.2
1025876:1025890	attL	NA	NA	NA	NA
WP_001141976.1\|1035568_1035892_+	hypothetical protein	NA	NA	NA	NA
WP_000371015.1\|1035891_1036617_+	hypothetical protein	NA	NA	NA	NA
WP_000999700.1\|1036685_1036979_+\|holin	holin	NA	NA	NA	NA
WP_000200151.1\|1036959_1037184_+	hypothetical protein	NA	NA	NA	NA
WP_001019749.1\|1037242_1037788_+	hypothetical protein	A0A0B5KTG8	Acinetobacter_phage	1.1e-91	89.4
WP_000189398.1\|1037788_1038106_+	hypothetical protein	A0A1W5PUJ8	Salmonella_phage	9.6e-24	58.5
WP_002016874.1\|1038277_1038508_-	hypothetical protein	NA	NA	NA	NA
WP_000958559.1\|1038528_1038858_-	hypothetical protein	NA	NA	NA	NA
WP_000566934.1\|1039105_1039696_-	hypothetical protein	NA	NA	NA	NA
WP_000200051.1\|1039757_1039949_+	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	4.4e-24	83.9
WP_000537617.1\|1039951_1041556_-\|integrase	site-specific integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	1.4e-91	46.1
1051421:1051435	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1204717 : 1219523

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000062631.1\|1204717_1205272_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.7e-98	100.0
WP_000893683.1\|1205528_1207028_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	6.1e-286	100.0
WP_001076817.1\|1207029_1209405_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	100.0
WP_001164226.1\|1209411_1210395_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.0e-189	100.0
WP_000066126.1\|1210405_1211101_-	hypothetical protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_000608304.1\|1211110_1211917_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	7.9e-147	100.0
WP_001982145.1\|1211926_1212976_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
WP_000281127.1\|1213331_1216064_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	99.9
WP_000960548.1\|1216143_1218843_+	M1 family peptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	100.0
WP_000925673.1\|1218938_1219523_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.7e-111	100.0

DBSCAN-SWA_3

1606354 : 1644945

Bacillus_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000992582.1\|1606354_1607710_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002016574.1\|1607747_1610273_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_001037943.1\|1610314_1610818_+	membrane protein	NA	NA	NA	NA
WP_000868104.1\|1610822_1611893_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_000140523.1\|1611899_1612385_+	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
WP_000064875.1\|1612381_1613170_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_001178068.1\|1613223_1614108_-	hypothetical protein	NA	NA	NA	NA
WP_000476756.1\|1614535_1615018_-	regulatory protein RecX	NA	NA	NA	NA
WP_000344169.1\|1615071_1616121_-	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	5.7e-113	59.4
WP_000040959.1\|1616266_1616707_-	RNA-binding protein	NA	NA	NA	NA
WP_000349155.1\|1616690_1617353_-	haloacid dehalogenase	NA	NA	NA	NA
WP_000798360.1\|1617548_1617908_+	hypothetical protein	NA	NA	NA	NA
WP_000525041.1\|1618006_1618243_+	hypothetical protein	NA	NA	NA	NA
WP_000689660.1\|1618357_1618651_+	hypothetical protein	NA	NA	NA	NA
WP_000573222.1\|1618702_1619239_-	N-acetyltransferase	NA	NA	NA	NA
WP_001099948.1\|1619283_1619733_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_000632796.1\|1619879_1621130_+	kynureninase	NA	NA	NA	NA
WP_000093788.1\|1621170_1622577_+	amino acid permease	NA	NA	NA	NA
WP_001233774.1\|1622584_1623331_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_001026393.1\|1624559_1625738_+\|protease	serine protease	A0A2K9L570	Tupanvirus	3.2e-32	40.6
WP_000957160.1\|1625785_1627240_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.0e-181	69.3
WP_001067858.1\|1627857_1628562_+\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_000679427.1\|1628730_1629078_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|1629071_1629911_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000050481.1\|1630315_1631857_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001100753.1\|1632215_1633142_+	class A extended-spectrum beta-lactamase PER-1	NA	NA	NA	NA
WP_001176353.1\|1633215_1633791_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_032495614.1\|1633829_1635671_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-32	26.6
WP_032495674.1\|1636041_1636743_+	hypothetical protein	NA	NA	NA	NA
WP_033917513.1\|1636715_1637045_-	hypothetical protein	NA	NA	NA	NA
WP_033917514.1\|1637038_1637533_-	hypothetical protein	NA	NA	NA	NA
WP_032495677.1\|1637543_1637774_-	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|1638087_1638927_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000050481.1\|1639331_1640873_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000359986.1\|1642271_1643045_+	ArmA family 16S rRNA (guanine(1405)-N(7))-methyltransferase	NA	NA	NA	NA
WP_077252464.1\|1643025_1643307_-	hypothetical protein	NA	NA	NA	NA
WP_002026779.1\|1643526_1643712_-	hypothetical protein	NA	NA	NA	NA
WP_002001451.1\|1643760_1644945_+\|transposase	IS4 family transposase ISEc29	A0A0F7LAS3	uncultured_marine_virus	4.5e-50	35.4

DBSCAN-SWA_4

2584906 : 2641071

Escherichia_phage(29.41%)

tRNA,transposase,integrase

attL 2627768:2627827|attR 2638161:2638986

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000020858.1\|2584906_2585623_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_000912930.1\|2585793_2586420_+	glutathione S-transferase	NA	NA	NA	NA
WP_000703552.1\|2586430_2587210_-	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_000026482.1\|2587296_2588712_-	OmpA family protein	NA	NA	NA	NA
WP_001987632.1\|2588925_2590170_-	aspartate carbamoyltransferase	NA	NA	NA	NA
WP_000546639.1\|2590173_2591190_-	aspartate carbamoyltransferase	NA	NA	NA	NA
WP_000654268.1\|2591313_2591658_-	hypothetical protein	NA	NA	NA	NA
WP_000498918.1\|2591875_2594101_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_001060738.1\|2594126_2594543_-	hypothetical protein	NA	NA	NA	NA
WP_000941316.1\|2594811_2595300_+	CinA family protein	A0A218MNG4	uncultured_virus	4.0e-29	43.3
WP_001210050.1\|2595356_2597936_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.3e-123	32.4
WP_001237344.1\|2598237_2599044_+	M23 family peptidase	G9BW84	Planktothrix_phage	9.0e-18	35.9
WP_001026230.1\|2599040_2599466_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001195082.1\|2599557_2599980_-	OsmC family protein	NA	NA	NA	NA
WP_000203217.1\|2600418_2601126_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_001159802.1\|2601286_2602336_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_000928919.1\|2602395_2603181_-	M48 family peptidase	NA	NA	NA	NA
WP_000776215.1\|2603291_2603609_-	hypothetical protein	NA	NA	NA	NA
WP_000517792.1\|2603731_2605051_-	adenylosuccinate synthase	A0A2P1EKE7	Megavirus	4.8e-69	36.0
WP_000155680.1\|2605115_2606282_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_001188823.1\|2606557_2607583_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_000199457.1\|2607852_2610489_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.8e-75	38.6
WP_001185176.1\|2610554_2611835_+	aspartate kinase	NA	NA	NA	NA
WP_000906487.1\|2612081_2612336_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
WP_000495836.1\|2612405_2612972_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	1.8e-25	42.4
WP_000735756.1\|2613037_2613427_-	hypothetical protein	NA	NA	NA	NA
WP_001111760.1\|2613665_2614223_+	cytochrome b	NA	NA	NA	NA
WP_001077405.1\|2614266_2615265_-	adenosine deaminase	NA	NA	NA	NA
WP_000729980.1\|2615376_2616696_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.8e-59	35.8
WP_000608973.1\|2617018_2617246_-	hypothetical protein	NA	NA	NA	NA
WP_000256760.1\|2617614_2619165_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000599996.1\|2619188_2620019_-	KR domain-containing protein	NA	NA	NA	NA
WP_000226456.1\|2620084_2621047_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_001067855.1\|2621143_2621848_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000107496.1\|2622675_2623299_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000626177.1\|2623823_2624783_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_000600025.1\|2624845_2625679_+	KR domain-containing protein	NA	NA	NA	NA
WP_001067855.1\|2626511_2627216_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
2627768:2627827	attL	NA	NA	NA	NA
WP_001067855.1\|2627836_2628541_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001297012.1\|2628761_2628875_+	hypothetical protein	NA	NA	NA	NA
WP_000376623.1\|2629180_2629681_-	N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|2629699_2629879_+	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|2629808_2630648_-	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000679427.1\|2630641_2630989_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001206316.1\|2631152_2631944_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000995519.1\|2632035_2632341_-	hypothetical protein	NA	NA	NA	NA
WP_001102919.1\|2632356_2632869_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002016612.1\|2632894_2633554_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002089484.1\|2633525_2633990_-	AAC(3)-I family aminoglycoside 3-N-acetyltransferase	NA	NA	NA	NA
WP_000845054.1\|2634160_2635174_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
WP_004193519.1\|2635112_2635727_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000147567.1\|2635852_2636413_+\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
WP_001067855.1\|2637446_2638151_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018326.1\|2638280_2639096_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.3e-161	98.5
2638161:2638986	attR	NA	NA	NA	NA
WP_000902128.1\|2639249_2639429_-	hypothetical protein	NA	NA	NA	NA
WP_001067858.1\|2639695_2640400_-\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_000904905.1\|2640411_2641071_-	recombinase family protein	E5FFF9	Burkholderia_phage	2.4e-37	48.6

DBSCAN-SWA_5

2721869 : 2750543

Acinetobacter_phage(93.75%)

head,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001019739.1\|2721869_2722415_-	hypothetical protein	A0A0B5L5G7	Acinetobacter_phage	4.7e-103	100.0
WP_000433907.1\|2722456_2722846_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
WP_000598554.1\|2722913_2726339_-	hypothetical protein	A0A0P0HSH9	Acinetobacter_phage	0.0e+00	94.2
WP_000835160.1\|2726331_2726694_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	8.1e-51	79.2
WP_000368388.1\|2726690_2727197_-	DUF1833 domain-containing protein	J7HXQ5	Acinetobacter_phage	1.5e-90	97.0
WP_000277448.1\|2727196_2727595_-	hypothetical protein	J7I0X8	Acinetobacter_phage	4.1e-72	97.7
WP_000721057.1\|2727687_2728275_-	hypothetical protein	NA	NA	NA	NA
WP_000046573.1\|2728365_2732676_-\|tail	phage tail tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	98.3
WP_001275792.1\|2732803_2733067_-	hypothetical protein	NA	NA	NA	NA
WP_000721572.1\|2733068_2733749_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
WP_000274931.1\|2733853_2734312_-	transcriptional regulator	A0A0P0IRJ4	Acinetobacter_phage	1.1e-84	100.0
WP_033918531.1\|2734320_2734620_-	DUF4258 domain-containing protein	A0A0P0IE58	Acinetobacter_phage	2.8e-49	99.0
WP_000424822.1\|2734865_2735195_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	4.5e-24	55.1
WP_001185585.1\|2735122_2735638_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.5e-77	96.6
WP_000094278.1\|2735707_2736625_-	hypothetical protein	J7HXP7	Acinetobacter_phage	2.0e-170	100.0
WP_000002408.1\|2736677_2737856_-	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-103	66.3
WP_000064593.1\|2737855_2738209_-	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	3.3e-57	96.6
WP_000749909.1\|2738305_2738827_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_001277696.1\|2738935_2739154_-	hypothetical protein	A0A0P0I8C2	Acinetobacter_phage	1.2e-28	94.2
WP_001984404.1\|2739155_2739599_-	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	2.0e-75	94.6
WP_000539749.1\|2739555_2739924_-	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	2.0e-52	82.8
WP_000248411.1\|2739895_2740306_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	7.7e-50	73.3
WP_000235282.1\|2740357_2740651_-	hypothetical protein	NA	NA	NA	NA
WP_000540685.1\|2740658_2740856_-	hypothetical protein	NA	NA	NA	NA
WP_000524257.1\|2740924_2741293_-	hypothetical protein	J7I467	Acinetobacter_phage	8.7e-61	92.6
WP_000008459.1\|2741293_2741674_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	6.9e-53	84.9
WP_000524488.1\|2741677_2742013_-	hypothetical protein	A0A0N7IRE4	Acinetobacter_phage	2.7e-53	100.0
WP_000852265.1\|2742057_2743008_-	hypothetical protein	A0A0P0HSG2	Acinetobacter_phage	3.7e-172	94.9
WP_000056390.1\|2743021_2743813_-	hypothetical protein	A0A0P0J090	Acinetobacter_phage	2.3e-90	74.2
WP_000589038.1\|2743899_2744214_-	hypothetical protein	A0A0S3UFT8	Pseudomonas_phage	5.2e-14	50.5
WP_000004550.1\|2744433_2744664_-	hypothetical protein	NA	NA	NA	NA
WP_000146970.1\|2744660_2745767_-\|head	head morphogenesis protein	A0A0P0IR98	Acinetobacter_phage	2.1e-190	90.2
WP_000301495.1\|2745776_2747117_-	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	3.4e-235	92.2
WP_001132930.1\|2747156_2748449_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	6.4e-215	86.0
WP_000729387.1\|2748408_2748924_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
WP_000435230.1\|2748982_2749624_-	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	6.3e-115	88.7
WP_000378523.1\|2749592_2750027_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	7.4e-67	84.7
WP_001136773.1\|2750087_2750543_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.7e-80	95.4

DBSCAN-SWA_6

2754501 : 2766849

Acinetobacter_phage(95.65%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001277128.1\|2754501_2754978_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
WP_000100162.1\|2754974_2755376_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	2.6e-66	96.2
WP_000462878.1\|2755375_2755768_-	hypothetical protein	J7HXM5	Acinetobacter_phage	1.2e-07	57.8
WP_000647826.1\|2755760_2756099_-	hypothetical protein	A0A0P0IKW4	Acinetobacter_phage	1.1e-30	56.3
WP_001003671.1\|2756095_2756896_-	hypothetical protein	A0A0P0IDV1	Acinetobacter_phage	2.8e-144	95.5
WP_000064627.1\|2756898_2757780_-	replication protein	A0A0P0IKQ2	Acinetobacter_phage	3.3e-138	95.2
WP_000602535.1\|2757772_2757997_-	hypothetical protein	A0A0P0I444	Acinetobacter_phage	3.2e-34	97.3
WP_001984388.1\|2758068_2758347_-	hypothetical protein	J7I0V3	Acinetobacter_phage	6.6e-37	90.2
WP_000048916.1\|2758402_2758723_-	hypothetical protein	A0A0P0HSE9	Acinetobacter_phage	1.2e-42	87.7
WP_000703023.1\|2758733_2758922_-	hypothetical protein	NA	NA	NA	NA
WP_000052252.1\|2759026_2759779_+	phage repressor protein	J7I4M9	Acinetobacter_phage	5.5e-102	74.3
WP_000370485.1\|2759793_2760009_+	hypothetical protein	A0A0P0IKK4	Acinetobacter_phage	9.4e-31	98.6
WP_000048052.1\|2760060_2761068_+	hypothetical protein	A0A0P0IY33	Acinetobacter_phage	2.9e-183	100.0
WP_001129676.1\|2761069_2761573_+	hypothetical protein	A0A0P0I896	Acinetobacter_phage	1.1e-77	100.0
WP_000845537.1\|2761711_2761915_+	hypothetical protein	A0A0P0IKZ8	Acinetobacter_phage	1.2e-27	100.0
WP_000051960.1\|2761921_2762164_-	hypothetical protein	A0A0P0I4B0	Acinetobacter_phage	5.2e-38	100.0
WP_001101038.1\|2762357_2762801_+	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	1.7e-71	94.5
WP_000656405.1\|2762800_2763091_+	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	5.1e-48	95.8
WP_000064463.1\|2763083_2763407_+	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	4.8e-55	95.3
WP_001207474.1\|2763418_2764540_+	ATPase AAA	A0A0N7IRE0	Acinetobacter_phage	2.8e-211	99.5
WP_000698529.1\|2764536_2765469_+	hypothetical protein	A0A0P0I438	Acinetobacter_phage	2.2e-137	80.0
WP_000654846.1\|2765470_2765722_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	6.4e-39	100.0
WP_000147323.1\|2765722_2766130_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	7.5e-13	52.2
WP_000004579.1\|2766126_2766849_+	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	1.7e-55	88.2

DBSCAN-SWA_7

3580078 : 3635297

Staphylococcus_phage(15.38%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000216739.1\|3580078_3581011_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_000907680.1\|3581060_3582257_-	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_000908243.1\|3582281_3583628_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000942498.1\|3583788_3584040_-	hypothetical protein	NA	NA	NA	NA
WP_001278225.1\|3584060_3585914_-	ferrous iron transporter B	NA	NA	NA	NA
WP_001991212.1\|3585910_3586174_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_000608730.1\|3586317_3587238_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	6.7e-33	30.7
WP_000011159.1\|3587384_3588200_+	DsbC family protein	NA	NA	NA	NA
WP_000805827.1\|3588444_3589746_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_000063593.1\|3589801_3590941_+	threonine synthase	NA	NA	NA	NA
WP_000025645.1\|3591047_3592055_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_000633799.1\|3592306_3592942_+	DNA-binding response regulator	NA	NA	NA	NA
WP_002001070.1\|3592997_3594521_+	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.3e-06	26.3
WP_000840549.1\|3594545_3595967_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_000942504.1\|3595970_3597155_-	peptidase S41	A0A0R6PIZ1	Moraxella_phage	8.3e-12	23.0
WP_000128749.1\|3597170_3598718_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_000881094.1\|3598843_3599914_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_000586912.1\|3599913_3601014_-	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_000673449.1\|3601157_3602606_+	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	5.5e-50	36.4
WP_001151592.1\|3602598_3603006_+	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_001988710.1\|3603044_3603683_+	hypothetical protein	NA	NA	NA	NA
WP_000354154.1\|3603813_3604032_+	hypothetical protein	NA	NA	NA	NA
WP_000493866.1\|3604091_3604751_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.5e-34	38.6
WP_001083669.1\|3604793_3606086_-	restriction endonuclease subunit M	A0A0P0BWH0	Ostreococcus_mediterraneus_virus	2.5e-38	32.6
WP_001292506.1\|3606082_3607168_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-48	36.6
WP_000543541.1\|3607183_3607642_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_000738520.1\|3607799_3609197_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	5.4e-34	31.2
WP_000780326.1\|3609254_3609593_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_000894500.1\|3609872_3610100_+	hypothetical protein	NA	NA	NA	NA
WP_000010465.1\|3610165_3611023_+	ATP-binding protein	NA	NA	NA	NA
WP_001144971.1\|3611105_3612893_+	hypothetical protein	NA	NA	NA	NA
WP_001082319.1\|3613275_3614079_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_000480968.1\|3614078_3614915_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_000743213.1\|3615034_3615259_+	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|3615469_3616963_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000512977.1\|3617200_3617605_+	hypothetical protein	NA	NA	NA	NA
WP_001322387.1\|3617582_3618209_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_001089073.1\|3618287_3619505_+	tetracycline efflux MFS transporter Tet(B)	A0A2H4UVM2	Bodo_saltans_virus	3.0e-09	24.4
WP_001144964.1\|3619587_3621384_+	hypothetical protein	NA	NA	NA	NA
WP_000953322.1\|3621678_3623166_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.3e-219	79.4
WP_000034564.1\|3623178_3624030_+	universal stress protein A	A0A2H4J154	uncultured_Caudovirales_phage	8.2e-70	45.9
WP_001095006.1\|3624097_3624397_+	hypothetical protein	NA	NA	NA	NA
WP_000529372.1\|3624469_3624841_+	hypothetical protein	NA	NA	NA	NA
WP_085940413.1\|3625531_3626621_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_000081835.1\|3627827_3628943_-	hypothetical protein	NA	NA	NA	NA
WP_000417085.1\|3628972_3629893_-\|transposase	transposase	NA	NA	NA	NA
WP_020752341.1\|3629897_3631808_-\|transposase	transposase	NA	NA	NA	NA
WP_020752340.1\|3631808_3632519_-\|transposase	heteromeric transposase endonuclease subunit TnsA	I6WI48	Vibriophage	4.1e-06	29.3
WP_071543477.1\|3632723_3633017_+	hypothetical protein	NA	NA	NA	NA
WP_000251875.1\|3632910_3633213_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_001043260.1\|3633299_3634115_-	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
WP_085940413.1\|3634207_3635297_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP026749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026749_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026749_1

18505-18596

Orphan

Consensus_repeat	Method
GTGACAGACCTTCCACTTTACGGTGACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026749_1

>merge|NZ_CP026749|1|18505-18596|CRISPRCasFinder
GTGACAAACCTTCCACTCTTGTGACAGACCTTCCACTTTACGGTGACAGACCCTCCACCTTTGAGTGACAGACCTTCCACCTTTGAGTGACA

>NZ_CP026749|1|1|18505-18596|CRISPRCasFinder
GTGACAAACCTTCCACTCTTGTGACAGA	CCTTCCACTTTACGGTGACAGACCCTCCACCTTTGA
GTGACAGACCTTCCACCTTTGAGTGACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026749.1\|WP_001067784.1\|31590_32295_-\|IS6-family-transposase-IS1006	unknown	unknown	gnl\|CDD\|225853
NZ_CP026749.1\|WP_104915070.1\|15043_15142_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	unknown
NZ_CP026749.1\|WP_001067858.1\|11089_11794_-\|IS6-family-transposase-IS15DI	unknown	unknown	gnl\|CDD\|225853
NZ_CP026749.1\|WP_001067858.1\|13813_14518_+\|IS6-family-transposase-IS15DI	unknown	unknown	gnl\|CDD\|225853
NZ_CP026749.1\|WP_104915061.1\|30817_31555_+\|integrase	unknown	unknown	unknown
NZ_CP026749.1\|WP_104915057.1\|19665_20577_+\|partitioning-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP026749.1\|WP_104915059.1\|25044_28281_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223683
NZ_CP026749.1\|WP_104915063.1\|33777_33990_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|372700
NZ_CP026749.1\|WP_104915060.1\|29228_29618_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|377551
NZ_CP026749.1\|WP_000251875.1\|5475_5778_-\|phosphoglucosamine-mutase	unknown	unknown	gnl\|CDD\|237669
NZ_CP026749.1\|WP_070153144.1\|18878_19652_+\|partitioning-protein	unknown	unknown	gnl\|CDD\|379293
NZ_CP026749.1\|WP_014386425.1\|7194_8178_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP026749.1\|WP_002002480.1\|11997_12840_+\|carbapenem-hydrolyzing-class-D-beta-lactamase-OXA-58	unknown	unknown	gnl\|CDD\|225322
NZ_CP026749.1\|WP_070153147.1\|16849_18022_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP026749.1\|WP_000214119.1\|8205_9420_-\|chloramphenicol/florfenicol-efflux-MFS-transporter-FloR	unknown	unknown	gnl\|CDD\|273229
NZ_CP026749.1\|WP_104915062.1\|32522_33497_+\|calcium/sodium-antiporter	unknown	unknown	gnl\|CDD\|182684
NZ_CP026749.1\|WP_001043260.1\|5864_6680_-\|sulfonamide-resistant-dihydropteroate-synthase-Sul2	unknown	unknown	gnl\|CDD\|238380
NZ_CP026749.1\|WP_104915058.1\|22750_23866_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341156
NZ_CP026749.1\|WP_019837527.1\|28902_29286_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
NZ_CP026749.1\|WP_001445143.1\|5330_5582_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP026749.1\|WP_001067784.1\|31590_32295_-\|IS6-family-transposase-IS1006	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.08648e-71
NZ_CP026749.1\|WP_019837527.1\|28902_29286_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.09528e-10
NZ_CP026749.1\|WP_001067858.1\|11089_11794_-\|IS6-family-transposase-IS15DI	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.07441e-69
NZ_CP026749.1\|WP_001067858.1\|13813_14518_+\|IS6-family-transposase-IS15DI	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.07441e-69
NZ_CP026749.1\|WP_104915062.1\|32522_33497_+\|calcium/sodium-antiporter	gnl\|CDD\|182684	PRK10734, PRK10734, putative calcium/sodium:proton antiporter; Provisional.	1.08953e-69
NZ_CP026749.1\|WP_104915057.1\|19665_20577_+\|partitioning-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	5.01315e-38
NZ_CP026749.1\|WP_104915059.1\|25044_28281_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NZ_CP026749.1\|WP_104915063.1\|33777_33990_-\|transcriptional-regulator	gnl\|CDD\|372700	pfam13744, HTH_37, Helix-turn-helix domain. Members of this family contains a DNA-binding helix-turn-helix domain.	2.04686e-08
NZ_CP026749.1\|WP_104915060.1\|29228_29618_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	1.06725e-34
NZ_CP026749.1\|WP_000251875.1\|5475_5778_-\|phosphoglucosamine-mutase	gnl\|CDD\|237669	PRK14315, glmM, phosphoglucosamine mutase; Provisional.	4.78654e-55
NZ_CP026749.1\|WP_070153144.1\|18878_19652_+\|partitioning-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	5.52921e-51
NZ_CP026749.1\|WP_014386425.1\|7194_8178_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	7.23851e-51
NZ_CP026749.1\|WP_002002480.1\|11997_12840_+\|carbapenem-hydrolyzing-class-D-beta-lactamase-OXA-58	gnl\|CDD\|225322	COG2602, COG2602, Beta-lactamase class D [Defense mechanisms].	1.27072e-69
NZ_CP026749.1\|WP_070153147.1\|16849_18022_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	5.9418e-28
NZ_CP026749.1\|WP_000214119.1\|8205_9420_-\|chloramphenicol/florfenicol-efflux-MFS-transporter-FloR	gnl\|CDD\|273229	TIGR00710, Bicyclomycin_resistance_protein_homolog, drug resistance transporter, Bcr/CflA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 12 membrane-spanning regions. Members with known activity include Bcr (bicyclomycin resistance protein) in E. coli, Flor (chloramphenicol and florfenicol resistance) in Salmonella typhimurium DT104, and CmlA (chloramphenicol resistance) in Pseudomonas sp. plasmid R1033.	2.21312e-80
NZ_CP026749.1\|WP_001043260.1\|5864_6680_-\|sulfonamide-resistant-dihydropteroate-synthase-Sul2	gnl\|CDD\|238380	cd00739, DHPS, DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS. Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.	5.73026e-105
NZ_CP026749.1\|WP_104915058.1\|22750_23866_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341156	cd17267, RMtype1_S_EcoAO83I-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoAO83I TRD1-CR1 and S.AbaB8342I TRD2-CR2. Escherichia coli strain A0 34/86 S subunit (S.EcoAO83I) recognizes 5'... GGANNNNNNNNATGC ... 3, and Acinetobacter baumannii B8342 S subunit (S.AbaB8342I) recognizes 5'... TTCANNNNNNTCC ... 3. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example S.AbaB8342I-TRD1 recognizes TTCA/TGAA and S.AbaB8342I-TRD2 recognizes GGA/TCC. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also includes TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases such as Type IIG restriction enzyme/N6-adenine DNA methyltransferases from Thermus scotoductus RFL1 (RM.TstI) and Acinetobacter lwoffi Ks 4-8 (RM.AloI), as well as type I DNA methyltransferases such as Sideroxydans lithotrophicus ES-1 Type I N6-adenine DNA methyltransferase (M.SliESORF1090P). RM.TstI recognizes 5' ... CACNNNNNNTCC ... 3' and RM.AloI recognizes 5' ... GAACNNNNNNTCC ... 3'.	1.10154e-87

>NZ_CP026749.1|WP_070153147.1|16849_18022_-|replication-initiation-protein
MTESESVQEELNHIPYCIGNIRHNGVVSTSNRLIRPIELSANEYKALLYAMAVANYSEKNRVNGEITEQTYIYLYKDDLADLLGLNKRNSINVAIDRIYKELSSRVAHFIIEEPTDDGKRKTKKVHSVVPIIRELRWEDDSKNAIQIRFTSEVLPYFTQLAGGNFTTYQLKHLFALDSVASMSLYTYFIKNEFKYASQKSYEVPMLLENLKALIDINETKYDRWVDFRRYVLDKIVAEINENTDLQLEYETIKKGRPIVGVNFKLHQRITDKTLNETAVIEKIYLDVPFEDNALVKELGAKFDTNVRSWYIFNNDEKYSQFKKWFKKIGCLTDSQANIVINDTLFQMDFAEVGMSLNDFKRNMKHKLKNNPEFVQSIRDRLNDIFGKELV
>NZ_CP026749.1|WP_104915070.1|15043_15142_+|IS66-family-insertion-sequence-hypothetical-protein
MDMDTAMAQVMRTFGSIKPHCAYLFCNKRSHR
>NZ_CP026749.1|WP_001067858.1|13813_14518_+|IS6-family-transposase-IS15DI
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP026749.1|WP_002002480.1|11997_12840_+|carbapenem-hydrolyzing-class-D-beta-lactamase-OXA-58
MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
>NZ_CP026749.1|WP_001067858.1|11089_11794_-|IS6-family-transposase-IS15DI
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP026749.1|WP_000214119.1|8205_9420_-|chloramphenicol/florfenicol-efflux-MFS-transporter-FloR
MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGILNTTPAMIQLTLSLYMVMLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTAPAFVAFRLLQAVGASAMLVATFATVRDVYANRPEGVVIYGLFSSMLAFVPALGPIAGALIGEFLGWQAIFITLAILAMLALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYTVGFSAGMGTFFVFFSTAPRVLIGQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWGIAGCVARGMALLVCGAVLLGIGELYGSPSFLTFILPMWVVAVGIVFTVSVTANGALAEFDDIAGSAVAFYFCVQSLIVSIVGTLAVALLNGDTAWPVICYATAMAVLVSLGLVLLRLRGAATEKSPVV
>NZ_CP026749.1|WP_014386425.1|7194_8178_-|LysR-family-transcriptional-regulator
MRRTNHRNLVNVGILSGRIPLISLVQFIAVAEHLNFRHAAKALGISQSSVSARVKALEDNLGVLLFERHARGVRLTDAGRHFMERVTAGVDQLDHAVKTAGMTAQGEYGRLRIGIHALIPRSFLTELIRHYREEHTGIEVEITEGTARDAVMQLRADQLDVVFVAGKPEMPDCHTRPIWTEPLVAVLSDGHRLAGQSAITWSDLVGETFIVRYGGTGPQVHDHIVLRLAGRWPAPSIRRFDVGRDTLLSMVGQGFGITIVGEATSLLPTTGIVFLPFLDEPEPVAFTAVWSPFNRNSALKNLLNLAGKMKRDGDSPNRFLDGTRPAR
>NZ_CP026749.1|WP_001043260.1|5864_6680_-|sulfonamide-resistant-dihydropteroate-synthase-Sul2
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR
>NZ_CP026749.1|WP_000251875.1|5475_5778_-|phosphoglucosamine-mutase
MVRKYFGTDGIRGKANEGAMTAETALRVGMAAGRVFRRGDHRHRVVIGKDTRLSGYMLEPALTAGFTSMGMDVFLFGPLPTTYRKNKRPFHPSPTALDRS
>NZ_CP026749.1|WP_001445143.1|5330_5582_+|hypothetical-protein
MLRSQRRGRDPPCWLSEKEPLVGKRRVNFQRCWLPVSRIGLHRRGVERVNCGPKLLDLGEKGVYSSYTLSAAGQKGIRPCPSR
>NZ_CP026749.1|WP_070153144.1|18878_19652_+|partitioning-protein
MSAKIITVANHKGGCGKTTTVVHLASELANLGNKVLVIDLDPQANASLHIGIQHPSEIVVTSAELLVGDISLLADALQEETNFEKVSLIYGSLNLGKTEDQLKEEAPRPSEELSIKLELLKDLYDFILIDCPPSLKLLTSNALASSTHVIIPIESGSQYGLYGVTDLLNHLEKIKRINPNLELLGALLIKHDERQNVCKLIRDEALKQVGKILETTIPQSTKVNQAAILQQPLLKVEKNSKVRKAFESLAYEIVAKV
>NZ_CP026749.1|WP_104915057.1|19665_20577_+|partitioning-protein
MASTKELLAQKLKQNTEKHQLAQKDNIKELKEFRRNVPIEDINRSPNQPRKVFEDSQLKELADSINEIGLLQPITVRKLDNLKYELIAGERRLRAHQLLGKSVIEAIIIDANNEEASLLTLAENLKRQDLTDYEIFIGLNSLDEKLKKNKQRLANSLGLNREDMYKYLSYEKLPKAMLNDLDLEPGLVGRTAATAFKKFLSDHIEQLSEAETALLGAWEKLKEKKLEQSKVTSYAEKLLSQDPEKVTTTSVVRKIEYDGKVAGNIKLNQKQLKISLKISEIDEDSLLQLEDFLKQLIQKSEKV
>NZ_CP026749.1|WP_104915058.1|22750_23866_+|restriction-endonuclease-subunit-S
MSEWQVGRLDSFFTLKRGYDLPKQSRVSGSVPIIASSGFADFHNEAKVNESGVVTGRYGTIGSVFFSDVPFWPLNTSLYVNDFKGNDKKFIYYFLQTLDWEKFSDKSAVPGVNRNDVHQEEICFPSLPEQKAIASILSSLDDKIDLLHCQNKTLEAMAETLFRQWFIEEAKEDWDDLLVSDIATHIKDNVNPSKDPLKTYYHFSLPAFDSGEKPTIELGAEILSNKYRVCENSILVSKLNPRVPRIWLLTDVKDNYVCSTEFQNLKPKVGSHLMFLYSLFNSRDVIDELAMSASGTSGSHQRVKPEDMLNISFKTPSLDYLEEYSLLITPSMQKVSSNKKQIQTLEQLRDTLLPKLMSGEVRVQYQTEEVA
>NZ_CP026749.1|WP_104915059.1|25044_28281_+|DEAD/DEAH-box-helicase
MTESDIELMAIEQLEGLGYTYVYGPEIESKGTNPLRSYKQVILEDKVLDALQRLNPHLSQDKCTEALKQVTNIQSPDLLSNNQAFHRLLTEGINIEVSKEGNTQGEYAWLIDFENPTNNEFLVVNQVTIKEDRWTRRPDIILYVNGLPLVVIELKNATDENATVEGAYKQIQTYQSQIPSLFTYNAFNVISDGLEAKAGTVSADYSRYMAWKTNNGQTKAKKTQAQLEVLIHGLLNPVTLLDMIRHFIVYESTKHEDTNGLITIKTIKKMAAYHQYYAVNAAVLSTIRASAVNSDSKSAEVAMQHQGRSKLELVQQQAVGDKKAGVVWHTQGSGKSLSMVFYTGKIVLALDNPTVVVITDRNDLDDQLFGTFAASSQLLRQTPRQADSREELKELLKVGSGGVIFTTIQKFQPDDGTSVYEQLSDRTNIVVIADEAHRSQYGFNAKEVDVKDEDGKVVGKRTVYGFAKYMRDALPNATYLGFTGTPIEKTDVNTPAVFGNYVDIYDISQAVEDGATVRIFYESRLAKIAISEEGKELIEDFDDQFTEDDLNQTQKERAKWARVEGLIGSKERIKAIAKDIVEHFEQRLKANANQGKGMIVSMSRRIAVDLYNEIVKIKPEWHSDDLNDGVIKVVMTASASDGEVIAKHHTTKQQRQRLADRMKDNDDKLKLVIVRDMWLTGFDAPSMHTLYIDKPMKGHNLMQAIARVNRVYKDKAGGLVVDYLGIASDLKEALSFYSEAGGKGDPALVQDEAATILQEKLEVLDGILHGFNYQEYFTADTSRKLNIILEAEEHILGVDQGEGKTRFLTAVTAMSQAFALAVPHPHAMEVAPLVAFFQAIKARLAKFSDGSGKISGLSNAELETKVKQTIDQALVTEQVVDIFDAAGIQKPDISILSDEFMQEMKGYKHKNIALETLKKLLGDEIKMREQRSVTQGKKLMDMLSSAIKGYQNKVLTAAEVIDELIKLAKTIQESDKLAEELNLTEYEYAFYSAVADNDSARELMQKDILRELAVVLTDSIRKNVTLDWTIKEAARAKLRVIVKRLLKKYGYPPDMALLATETVLEQAEQLAEELSSSK
>NZ_CP026749.1|WP_019837527.1|28902_29286_+|IS66-family-insertion-sequence-hypothetical-protein
MTTNNQTSIASLAKKRRTYSAEFKQQIVQACKAPDVSIASVALQHGLNTNLVSKWIRLFDGKPKNDRSPLPNKPAFIALSCSAPLDPISTNMLTVQITLPHSKAEIGLKWQVSEISALAELLKALAT
>NZ_CP026749.1|WP_104915060.1|29228_29618_+|IS66-family-insertion-sequence-hypothetical-protein
MASIRNICFSRITQGTCNMIRIDEIWLSTQPMDMRAGMDTAMAQVLRAFGSIKPHCAYLFCNKRGHRMKVLVHDGLGIWLCARRLEQGKFHWAQLHQGETVALSLEQLQALIQGLPWQRIGRQQVVTML
>NZ_CP026749.1|WP_104915061.1|30817_31555_+|integrase
MFALKTIHLEKKVSNENQIILLFDLDSFCPCMYPMLYTMKFLRFQSISTQHADLIAIKFWYEFWFEKFATSFCESFYSTSYNFEIIQCEIDNFIVYLENNKKLESNLIRLSNSEHINYTTIGHRVRSFLKFYNFLINEYLSMQSQPQLTLKEIQKIKENLNKYMTIKKKIINNFSKANKTIKSEINHNFKSMNQEMIKGLYSVISPSNSNKYNELNPFRSKNVQLRNFLIIHLMLNYGLRRHCCK
>NZ_CP026749.1|WP_001067784.1|31590_32295_-|IS6-family-transposase-IS1006
MNPFHGRHFQGEIILWAVRWYCKYGISYRELQEMLAERGVNVDHTTIYRWVQRYAPEIEKRLRWYWRNPTDLSSWHIDETYVKVNGRWSYLYRAVDQRGDTIDFYLSSRRNTKSAYCFLGKILNNVKKWQIPQVINTDKAPTYGRALSRLKREGKCPPDLEHRQIKYKNNVIECDHGKLKRIIRATLGFKSMKTAYATIKGIEVMRALRKGQASSFYYGQPQGEVCLINRVFGL
>NZ_CP026749.1|WP_104915062.1|32522_33497_+|calcium/sodium-antiporter
MWLAMLAVVVVGLAILVWSADVFIDGAVALANKLNVPSFLIGVIILGVGTSAPEMIVSMLAALEGSPGLALGNAYGSNIVNIALVLGATVLISPIIIRKSIINRDMPLLLLVTAVAAWQLSDGVLGNTDGIVLIVLLVVVLGIQIILSMREGNHEHEDDTVEETAKAEHSMAQGLGRLFLGLFVLILSSRAIVWGATELATLWGLSELIIGLTIVAIGTSLPELVSSLSAARKGEHDMALGNIIGSNVFNTLGVVGIAALIAPITPSSIILSRDILAMSLLTLLLFVMCLFAFKTKRVFGRTSGTTLVLFFVGYTVWLIQTVSL
>NZ_CP026749.1|WP_104915063.1|33777_33990_-|transcriptional-regulator
MHKVCSADAYEISQKELAETLGIKQPSLSAIENRGNDLKISTMKKYVEAMGGKLRIDVELPTGKHIGFNV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP026749	Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence	17534-17569	0	1.0
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP038501	Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence	45216-45251	2	0.944
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59402-59437	2	0.944
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59468-59503	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	118956-118991	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192198-192233	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP012956	Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence	46824-46859	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22539-22574	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148678-148713	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	70539-70574	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP048015	Acinetobacter towneri strain 205 plasmid pAT205, complete sequence	151076-151111	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116998-117033	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP051867	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence	73329-73364	3	0.917
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	119022-119057	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192264-192299	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22605-22640	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148744-148779	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116932-116967	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP045132	Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence	28211-28246	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP039146	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence	73214-73249	4	0.889
NZ_CP026749_1	1.1\|18533\|36\|NZ_CP026749\|CRISPRCasFinder	18533-18568	36	NZ_CP040912	Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence	74383-74418	4	0.889

1. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP026749 (Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence) position: , mismatch: 0, identity: 1.0

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccctccacctttga	Protospacer
************************************

2. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP038501 (Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.944

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ctttccactttacggtgacagaccttccacctttga	Protospacer
*.**********************.***********

3. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 2, identity: 0.944

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccaccttaga	Protospacer
************************.******** **

4. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
************************.*****.***.*

5. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
********************.***.*********.*

6. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
********************.***.*********.*

7. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP012956 (Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
************************.*****.***.*

8. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
********************.***.*********.*

9. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
********************.***.*********.*

10. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP046044 (Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ctttccactttacggtgacagacctcccacctttga	Protospacer
*.**********************..**********

11. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP048015 (Acinetobacter towneri strain 205 plasmid pAT205, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ctttccactttacggtgacagacctcccacctttga	Protospacer
*.**********************..**********

12. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
********************.***.*********.*

13. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP051867 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence) position: , mismatch: 3, identity: 0.917

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
************************.*****.***.*

14. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
********************.***.********  *

15. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
********************.***.********  *

16. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
********************.***.********  *

17. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
********************.***.********  *

18. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
********************.***.********  *

19. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP045132 (Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
************************.*****.**  *

20. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP039146 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
************************.*****.**  *

21. spacer 1.1|18533|36|NZ_CP026749|CRISPRCasFinder matches to NZ_CP040912 (Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence) position: , mismatch: 4, identity: 0.889

ccttccactttacggtgacagaccctccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
************************.*****.**  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14518

Escherichia_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026438268.1\|189_435_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_005146104.1\|796_2284_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	6.4e-219	79.6
WP_002115246.1\|2296_3148_+	universal stress family protein	A0A2H4J154	uncultured_Caudovirales_phage	5.5e-66	45.2
WP_001067784.1\|3701_4406_-\|transposase	IS6 family transposase IS1006	A0A077SL39	Escherichia_phage	1.9e-120	85.8
WP_001445143.1\|5330_5582_+	hypothetical protein	NA	NA	NA	NA
WP_000251875.1\|5475_5778_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_001043260.1\|5864_6680_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
WP_014386425.1\|7194_8178_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000214119.1\|8205_9420_-	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	4.2e-19	28.7
WP_001067858.1\|11089_11794_-\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_002002480.1\|11997_12840_+	carbapenem-hydrolyzing class D beta-lactamase OXA-58	NA	NA	NA	NA
WP_001067858.1\|13813_14518_+\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6

DBSCAN-SWA_2

18878 : 20577

Natrialba_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070153144.1\|18878_19652_+	partitioning protein	Q8JL10	Natrialba_phage	4.4e-14	33.3
WP_104915057.1\|19665_20577_+	partitioning protein	S5VSZ7	Leptospira_phage	2.0e-13	42.9

DBSCAN-SWA_3

25044 : 28281

Liberibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104915059.1\|25044_28281_+	DEAD/DEAH box helicase	A0A220A398	Liberibacter_phage	1.0e-67	29.6

DBSCAN-SWA_4

31590 : 41077

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067784.1\|31590_32295_-\|transposase	IS6 family transposase IS1006	A0A077SL39	Escherichia_phage	1.9e-120	85.8
WP_104915062.1\|32522_33497_+	calcium/sodium antiporter	A0A2I7QY17	Vibrio_phage	2.8e-05	27.0
WP_104915063.1\|33777_33990_-	transcriptional regulator	NA	NA	NA	NA
WP_004691518.1\|34046_34430_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_104915064.1\|34372_34762_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_104915065.1\|34836_36483_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.6e-144	53.4
WP_104915066.1\|37196_37700_+	hypothetical protein	NA	NA	NA	NA
WP_019838467.1\|37768_38083_-	hypothetical protein	NA	NA	NA	NA
WP_104915071.1\|38045_38357_-	hypothetical protein	NA	NA	NA	NA
WP_004896916.1\|38736_38940_+	hypothetical protein	NA	NA	NA	NA
WP_104915067.1\|38992_39319_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	6.4e-15	48.8
WP_004647749.1\|39320_39617_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	1.2e-15	38.8
WP_104915068.1\|39857_41077_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.6e-77	52.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026750

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP026749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection